Symbol:
Kif26b
Name:
kinesin family member 26B
RGD ID:
1560022
Description:
Predicted to enable ATP binding activity; microtubule binding activity; and microtubule motor activity. Predicted to be involved in microtubule-based movement. Predicted to act upstream of or within establishment of cell polarity; positive regulation of cell-cell adhesion; and ureteric bud invasion. Predicted to be located in cytoskeleton. Orthologous to human KIF26B (kinesin family member 26B); INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
kinesin-like protein KIF26B; LOC305012; LOC498294; RGD1560022; RGD1560572; similar to Hypothetical protein 4832420M10; similar to hypothetical protein D230039L06
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 92,815,427 - 93,221,071 (+) NCBI GRCr8 mRatBN7.2 13 90,282,821 - 90,689,058 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 90,283,404 - 90,682,811 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 92,788,644 - 93,188,026 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 94,188,806 - 94,588,203 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 91,365,835 - 91,766,117 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 96,775,356 - 97,173,469 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 96,775,357 - 97,173,469 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 101,794,597 - 102,194,975 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 94,184,947 - 94,606,719 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 89,840,520 - 90,239,545 (+) NCBI Celera Cytogenetic Map 13 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kif26b Rat 1,2-dichloroethane increases expression ISO Kif26b (Mus musculus) 6480464 ethylene dichloride results in increased expression of KIF26B mRNA CTD PMID:28960355 Kif26b Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in decreased expression of KIF26B mRNA CTD PMID:27840820 Kif26b Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Kif26b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kif26b Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Kif26b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kif26b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Kif26b (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of KIF26B mRNA CTD PMID:19933214 Kif26b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KIF26B mRNA CTD PMID:33387578 Kif26b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Kif26b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KIF26B mRNA CTD PMID:21570461 Kif26b Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Kif26b Rat 4,4'-sulfonyldiphenol increases expression ISO Kif26b (Mus musculus) 6480464 bisphenol S results in increased expression of KIF26B mRNA CTD PMID:30951980 Kif26b Rat 5-fluorouracil decreases expression ISO KIF26B (Homo sapiens) 6480464 Fluorouracil results in decreased expression of KIF26B mRNA CTD PMID:34151400 Kif26b Rat acrylamide decreases expression ISO Kif26b (Mus musculus) 6480464 Acrylamide results in decreased expression of KIF26B mRNA CTD PMID:30807115 Kif26b Rat aflatoxin B1 increases methylation ISO KIF26B (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of KIF26B intron CTD PMID:30157460 Kif26b Rat aflatoxin B1 decreases expression ISO KIF26B (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of KIF26B mRNA CTD PMID:32234424 Kif26b Rat Aflatoxin B2 alpha increases methylation ISO KIF26B (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of KIF26B intron CTD PMID:30157460 Kif26b Rat aristolochic acid A decreases expression ISO KIF26B (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of KIF26B mRNA CTD PMID:33212167 Kif26b Rat arsane affects methylation ISO KIF26B (Homo sapiens) 6480464 Arsenic affects the methylation of KIF26B gene CTD PMID:25304211 Kif26b Rat arsenic atom affects methylation ISO KIF26B (Homo sapiens) 6480464 Arsenic affects the methylation of KIF26B gene CTD PMID:25304211 Kif26b Rat benzo[a]pyrene affects methylation ISO KIF26B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of KIF26B intron CTD PMID:30157460 Kif26b Rat benzo[a]pyrene increases methylation ISO KIF26B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KIF26B exon and Benzo(a)pyrene results in increased methylation of KIF26B promoter CTD PMID:27901495 Kif26b Rat benzo[a]pyrene multiple interactions ISO Kif26b (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of KIF26B mRNA CTD PMID:27858113 Kif26b Rat benzo[a]pyrene decreases expression ISO Kif26b (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of KIF26B mRNA CTD PMID:21569818 and PMID:22610609 Kif26b Rat benzo[a]pyrene decreases expression ISO KIF26B (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of KIF26B mRNA CTD PMID:21871943 Kif26b Rat benzo[b]fluoranthene decreases expression ISO Kif26b (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of KIF26B mRNA CTD PMID:26377693 Kif26b Rat benzo[b]fluoranthene multiple interactions ISO Kif26b (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of KIF26B mRNA CTD PMID:27858113 Kif26b Rat benzo[e]pyrene affects methylation ISO KIF26B (Homo sapiens) 6480464 benzo(e)pyrene affects the methylation of KIF26B intron CTD PMID:30157460 Kif26b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KIF26B mRNA CTD PMID:25181051 Kif26b Rat bisphenol A decreases methylation ISO KIF26B (Homo sapiens) 6480464 bisphenol A results in decreased methylation of KIF26B gene CTD PMID:31601247 Kif26b Rat bisphenol A increases expression ISO Kif26b (Mus musculus) 6480464 bisphenol A results in increased expression of KIF26B mRNA CTD PMID:30951980 Kif26b Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of KIF26B gene CTD PMID:28505145 Kif26b Rat bisphenol A decreases expression ISO KIF26B (Homo sapiens) 6480464 bisphenol A results in decreased expression of KIF26B mRNA CTD PMID:27685785 Kif26b Rat bisphenol F increases expression ISO Kif26b (Mus musculus) 6480464 bisphenol F results in increased expression of KIF26B mRNA CTD PMID:30951980 Kif26b Rat cadmium dichloride increases expression ISO KIF26B (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of KIF26B mRNA CTD PMID:38568856 Kif26b Rat calcitriol decreases expression ISO KIF26B (Homo sapiens) 6480464 Calcitriol results in decreased expression of KIF26B mRNA CTD PMID:26485663 Kif26b Rat carbon nanotube decreases expression ISO Kif26b (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Kif26b Rat chloroprene decreases expression ISO Kif26b (Mus musculus) 6480464 Chloroprene results in decreased expression of KIF26B mRNA CTD PMID:23125180 Kif26b Rat chrysene multiple interactions ISO Kif26b (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of KIF26B mRNA CTD PMID:27858113 Kif26b Rat dexamethasone decreases expression ISO KIF26B (Homo sapiens) 6480464 Dexamethasone results in decreased expression of KIF26B mRNA CTD PMID:25047013 Kif26b Rat dibenz[a,h]anthracene decreases expression ISO Kif26b (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Kif26b Rat dioxygen multiple interactions ISO Kif26b (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of KIF26B mRNA CTD PMID:30529165 Kif26b Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of KIF26B mRNA CTD PMID:29391264 Kif26b Rat ethanol increases expression ISO Kif26b (Mus musculus) 6480464 Ethanol results in increased expression of KIF26B mRNA CTD PMID:30319688 Kif26b Rat FR900359 decreases phosphorylation ISO KIF26B (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of KIF26B protein CTD PMID:37730182 Kif26b Rat furan decreases expression EXP 6480464 furan results in decreased expression of KIF26B mRNA CTD PMID:25539665 Kif26b Rat genistein multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of KIF26B gene CTD PMID:28505145 Kif26b Rat genistein increases expression ISO Kif26b (Mus musculus) 6480464 Genistein results in increased expression of KIF26B mRNA CTD PMID:32186404 Kif26b Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KIF26B mRNA CTD PMID:33387578 Kif26b Rat hydrogen peroxide affects expression ISO KIF26B (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of KIF26B mRNA CTD PMID:20044591 Kif26b Rat hydroquinone O-beta-D-glucopyranoside decreases expression ISO KIF26B (Homo sapiens) 6480464 Arbutin results in decreased expression of KIF26B mRNA CTD PMID:17103032 Kif26b Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of KIF26B mRNA CTD PMID:22129741 Kif26b Rat methapyrilene affects methylation ISO KIF26B (Homo sapiens) 6480464 Methapyrilene affects the methylation of KIF26B intron CTD PMID:30157460 Kif26b Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of KIF26B gene CTD PMID:35440735 Kif26b Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of KIF26B mRNA CTD PMID:22129741 Kif26b Rat N-nitrosodiethylamine multiple interactions ISO Kif26b (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of KIF26B gene CTD PMID:23968726 Kif26b Rat nickel atom decreases expression ISO KIF26B (Homo sapiens) 6480464 Nickel results in decreased expression of KIF26B mRNA CTD PMID:24768652 Kif26b Rat O-methyleugenol decreases expression ISO KIF26B (Homo sapiens) 6480464 methyleugenol results in decreased expression of KIF26B mRNA CTD PMID:32234424 Kif26b Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of KIF26B mRNA CTD PMID:38301995 Kif26b Rat ozone multiple interactions ISO Kif26b (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of KIF26B mRNA CTD PMID:27106289 Kif26b Rat paracetamol affects expression ISO Kif26b (Mus musculus) 6480464 Acetaminophen affects the expression of KIF26B mRNA CTD PMID:17562736 Kif26b Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of KIF26B mRNA CTD PMID:33387578 Kif26b Rat PCB138 multiple interactions ISO Kif26b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kif26b Rat phenobarbital multiple interactions ISO Kif26b (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of KIF26B mRNA] CTD PMID:19482888 Kif26b Rat phenobarbital increases expression ISO Kif26b (Mus musculus) 6480464 Phenobarbital results in increased expression of KIF26B mRNA CTD PMID:19482888 Kif26b Rat phenylmercury acetate increases expression ISO KIF26B (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of KIF26B mRNA CTD PMID:26272509 Kif26b Rat piperonyl butoxide multiple interactions ISO Kif26b (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of KIF26B gene CTD PMID:23968726 Kif26b Rat silicon dioxide increases expression ISO KIF26B (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of KIF26B mRNA CTD PMID:23806026 Kif26b Rat silver atom decreases expression ISO Kif26b (Mus musculus) 6480464 Silver results in decreased expression of KIF26B mRNA CTD PMID:27131904 Kif26b Rat silver(0) decreases expression ISO Kif26b (Mus musculus) 6480464 Silver results in decreased expression of KIF26B mRNA CTD PMID:27131904 Kif26b Rat sodium arsenite increases expression ISO KIF26B (Homo sapiens) 6480464 sodium arsenite results in increased expression of KIF26B mRNA CTD PMID:38568856 Kif26b Rat tetraphene multiple interactions ISO Kif26b (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of KIF26B mRNA CTD PMID:27858113 Kif26b Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of KIF26B mRNA CTD PMID:34492290 Kif26b Rat thiram increases expression ISO KIF26B (Homo sapiens) 6480464 Thiram results in increased expression of KIF26B mRNA CTD PMID:38568856 Kif26b Rat titanium dioxide decreases expression ISO Kif26b (Mus musculus) 6480464 titanium dioxide results in decreased expression of KIF26B mRNA CTD PMID:27760801 Kif26b Rat titanium dioxide decreases methylation ISO Kif26b (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KIF26B gene and titanium dioxide results in decreased methylation of KIF26B promoter CTD PMID:35295148 Kif26b Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of KIF26B mRNA CTD PMID:33387578 Kif26b Rat triclosan decreases expression ISO KIF26B (Homo sapiens) 6480464 Triclosan results in decreased expression of KIF26B mRNA CTD PMID:30510588 Kif26b Rat trimellitic anhydride increases expression ISO Kif26b (Mus musculus) 6480464 trimellitic anhydride results in increased expression of KIF26B mRNA CTD PMID:19042947 Kif26b Rat triphenyl phosphate affects expression ISO KIF26B (Homo sapiens) 6480464 triphenyl phosphate affects the expression of KIF26B mRNA CTD PMID:37042841 Kif26b Rat triptonide increases expression ISO Kif26b (Mus musculus) 6480464 triptonide results in increased expression of KIF26B mRNA CTD PMID:33045310 Kif26b Rat tris(2-butoxyethyl) phosphate affects expression ISO KIF26B (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of KIF26B mRNA CTD PMID:29024780 Kif26b Rat valproic acid increases methylation ISO KIF26B (Homo sapiens) 6480464 Valproic Acid results in increased methylation of KIF26B gene CTD PMID:29154799 Kif26b Rat valproic acid increases expression ISO KIF26B (Homo sapiens) 6480464 Valproic Acid results in increased expression of KIF26B mRNA CTD PMID:26272509 Kif26b Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of KIF26B mRNA CTD PMID:29427782
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) chloroprene (ISO) chrysene (ISO) dexamethasone (ISO) dibenz[a,h]anthracene (ISO) dioxygen (ISO) endosulfan (EXP) ethanol (ISO) FR900359 (ISO) furan (EXP) genistein (EXP,ISO) gentamycin (EXP) hydrogen peroxide (ISO) hydroquinone O-beta-D-glucopyranoside (ISO) indole-3-methanol (EXP) methapyrilene (ISO) methoxychlor (EXP) N-nitrosodiethylamine (EXP,ISO) nickel atom (ISO) O-methyleugenol (ISO) ochratoxin A (EXP) ozone (ISO) paracetamol (EXP,ISO) PCB138 (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) piperonyl butoxide (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) tetraphene (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) triclosan (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (ISO) valproic acid (EXP,ISO)
Kif26b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 92,815,427 - 93,221,071 (+) NCBI GRCr8 mRatBN7.2 13 90,282,821 - 90,689,058 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 90,283,404 - 90,682,811 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 92,788,644 - 93,188,026 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 94,188,806 - 94,588,203 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 91,365,835 - 91,766,117 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 96,775,356 - 97,173,469 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 96,775,357 - 97,173,469 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 101,794,597 - 102,194,975 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 94,184,947 - 94,606,719 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 89,840,520 - 90,239,545 (+) NCBI Celera Cytogenetic Map 13 q26 NCBI
KIF26B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 245,154,985 - 245,709,432 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 245,154,985 - 245,709,432 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 245,318,287 - 245,872,734 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 243,384,910 - 243,933,051 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 218,607,159 - 219,157,882 (+) NCBI Celera Cytogenetic Map 1 q44 NCBI HuRef 1 215,701,421 - 216,254,032 (+) NCBI HuRef CHM1_1 1 246,590,595 - 247,138,523 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 244,572,450 - 245,130,184 (+) NCBI T2T-CHM13v2.0
Kif26b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 178,356,690 - 178,766,765 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 178,356,690 - 178,766,765 (+) Ensembl GRCm39 Ensembl GRCm38 1 178,529,125 - 178,932,857 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 178,529,125 - 178,939,200 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 180,459,256 - 180,862,988 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 180,701,650 - 180,769,527 (+) NCBI MGSCv36 mm8 Celera 1 185,591,356 - 185,992,064 (+) NCBI Celera Cytogenetic Map 1 H4 NCBI cM Map 1 83.16 NCBI
Kif26b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 8,290,046 - 8,731,226 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 8,289,774 - 8,738,131 (+) NCBI ChiLan1.0 ChiLan1.0
KIF26B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 3,433,092 - 3,993,275 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 3,656,595 - 4,216,868 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 220,756,171 - 221,321,969 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 226,343,827 - 226,688,452 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 226,343,821 - 226,681,669 (+) Ensembl panpan1.1 panPan2
KIF26B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 36,087,483 - 36,529,334 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 36,088,050 - 36,522,653 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 35,561,234 - 36,005,056 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 35,918,281 - 36,360,127 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 35,918,424 - 36,354,046 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 35,752,326 - 36,195,843 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 35,767,424 - 36,209,134 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 36,033,218 - 36,477,290 (+) NCBI UU_Cfam_GSD_1.0
Kif26b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 49,015,099 - 49,499,220 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936526 5,255,227 - 5,434,697 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936526 5,250,154 - 5,434,699 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KIF26B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 18,081,754 - 18,219,848 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 17,708,365 - 18,220,052 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 20,383,677 - 20,762,886 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KIF26B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 82,177,587 - 82,735,055 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 82,631,337 - 82,734,410 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 84,409,130 - 84,992,517 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kif26b
.
Predicted Target Of
Count of predictions: 212 Count of miRNA genes: 149 Interacting mature miRNAs: 171 Transcripts: ENSRNOT00000017784 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
D13Rat54
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 13 93,135,505 - 93,135,614 (+) Marker Load Pipeline Rnor_5.0 13 101,878,983 - 101,879,092 NCBI Rnor5.0 Rnor_5.0 13 101,878,982 - 101,879,093 NCBI Rnor5.0 RGSC_v3.4 13 94,524,904 - 94,525,014 RGD RGSC3.4 RGSC_v3.4 13 94,524,905 - 94,525,013 UniSTS RGSC3.4 RGSC_v3.1 13 94,713,840 - 94,713,950 RGD Celera 13 90,160,324 - 90,160,432 UniSTS RH 3.4 Map 13 611.0 RGD RH 3.4 Map 13 611.0 UniSTS RH 2.0 Map 13 658.3 RGD FHH x ACI Map 13 46.13 RGD Cytogenetic Map 13 q26 UniSTS
D13Mco16
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 13 93,094,196 - 93,094,392 (+) Marker Load Pipeline mRatBN7.2 13 90,562,204 - 90,562,400 (-) MAPPER mRatBN7.2 Rnor_6.0 13 96,895,515 - 96,895,710 NCBI Rnor6.0 Rnor_5.0 13 101,919,119 - 101,919,314 UniSTS Rnor5.0 RGSC_v3.4 13 94,483,926 - 94,484,122 RGD RGSC3.4 RGSC_v3.4 13 94,483,927 - 94,484,122 UniSTS RGSC3.4 RGSC_v3.1 13 94,672,862 - 94,673,058 RGD Celera 13 90,118,817 - 90,119,012 UniSTS Cytogenetic Map 13 q26 UniSTS
BE099345
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 90,449,542 - 90,449,740 (-) MAPPER mRatBN7.2 Rnor_6.0 13 97,007,633 - 97,007,830 NCBI Rnor6.0 Rnor_5.0 13 102,029,855 - 102,030,052 UniSTS Rnor5.0 RGSC_v3.4 13 94,354,956 - 94,355,153 UniSTS RGSC3.4 Celera 13 90,006,495 - 90,006,692 UniSTS RH 3.4 Map 13 610.9 UniSTS Cytogenetic Map 13 q26 UniSTS
BF403417
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 90,348,063 - 90,348,224 (-) MAPPER mRatBN7.2 Rnor_6.0 13 97,109,179 - 97,109,339 NCBI Rnor6.0 Rnor_5.0 13 102,131,114 - 102,131,274 UniSTS Rnor5.0 RGSC_v3.4 13 94,251,051 - 94,251,211 UniSTS RGSC3.4 Celera 13 89,905,100 - 89,905,260 UniSTS RH 3.4 Map 13 612.6 UniSTS Cytogenetic Map 13 q26 UniSTS
AU048808
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 90,322,013 - 90,322,178 (-) MAPPER mRatBN7.2 Rnor_6.0 13 97,135,207 - 97,135,371 NCBI Rnor6.0 Rnor_5.0 13 102,157,142 - 102,157,306 UniSTS Rnor5.0 RGSC_v3.4 13 94,224,933 - 94,225,097 UniSTS RGSC3.4 Celera 13 89,879,147 - 89,879,301 UniSTS Cytogenetic Map 13 q26 UniSTS
AU049220
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 90,675,850 - 90,675,984 (-) MAPPER mRatBN7.2 Rnor_6.0 13 96,782,184 - 96,782,317 NCBI Rnor6.0 Rnor_5.0 13 101,807,670 - 101,807,803 UniSTS Rnor5.0 RGSC_v3.4 13 94,599,758 - 94,599,891 UniSTS RGSC3.4 Celera 13 90,232,584 - 90,232,717 UniSTS Cytogenetic Map 13 q26 UniSTS
ha2905
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 90,481,858 - 90,482,630 (-) MAPPER mRatBN7.2 Rnor_6.0 13 96,974,679 - 96,975,450 NCBI Rnor6.0 Rnor_5.0 13 101,997,340 - 101,998,111 UniSTS Rnor5.0 Cytogenetic Map 13 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
46
113
89
88
57
20
57
6
208
89
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017784 ⟹ ENSRNOP00000017784
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 90,283,404 - 90,682,811 (+) Ensembl Rnor_6.0 Ensembl 13 96,775,357 - 97,173,469 (-) Ensembl
RefSeq Acc Id:
NM_001109079 ⟹ NP_001102549
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 92,815,427 - 93,214,826 (+) NCBI mRatBN7.2 13 90,283,404 - 90,682,812 (+) NCBI Rnor_6.0 13 96,775,356 - 97,173,469 (-) NCBI Rnor_5.0 13 101,794,597 - 102,194,975 (-) NCBI RGSC_v3.4 13 94,184,947 - 94,606,719 (+) RGD Celera 13 89,840,520 - 90,239,545 (+) RGD
Sequence:
AGTTAGCGAGCTCGGGGAAGGAGGCAAGTTCCCACCGCCGGCTCGGCTCGGAGAGGGCTCGCCCACCTTCCCTGCAGCCGCCCTGCGTCCTCGCCGCCTTCTCGTCCTCCTCCTGTCGGCCCCGCTAA
hide sequence
RefSeq Acc Id:
XM_039090818 ⟹ XP_038946746
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 93,079,430 - 93,221,071 (+) NCBI mRatBN7.2 13 90,547,426 - 90,689,058 (+) NCBI
RefSeq Acc Id:
XM_063272386 ⟹ XP_063128456
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 93,021,536 - 93,221,071 (+) NCBI
RefSeq Acc Id:
XM_063272387 ⟹ XP_063128457
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 93,037,257 - 93,221,071 (+) NCBI
RefSeq Acc Id:
XM_063272388 ⟹ XP_063128458
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 93,040,226 - 93,221,071 (+) NCBI
RefSeq Acc Id:
NP_001102549 ⟸ NM_001109079
- UniProtKB:
D4ADC4 (UniProtKB/TrEMBL)
- Sequence:
MNSVAGNKERLAVSTRGKKYGVNEMCSPTKPSAPFSPESWYRKAYEESRAGSRPTPEGAGSALGSSGTPSPGSGTSSPSSFTGSPGPASPGIGTSSPGSLGGSPGFGTGSPGSGSGGGSSPGSDRGVW
hide sequence
Ensembl Acc Id:
ENSRNOP00000017784 ⟸ ENSRNOT00000017784
RefSeq Acc Id:
XP_038946746 ⟸ XM_039090818
- Peptide Label:
isoform X3
- UniProtKB:
A6JGF1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128456 ⟸ XM_063272386
- Peptide Label:
isoform X1
- UniProtKB:
A6JGF1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128457 ⟸ XM_063272387
- Peptide Label:
isoform X2
- UniProtKB:
A6JGF1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128458 ⟸ XM_063272388
- Peptide Label:
isoform X2
- UniProtKB:
A6JGF1 (UniProtKB/TrEMBL)
RGD ID: 13699051 Promoter ID: EPDNEW_R9576 Type: single initiation site Name: Kif26b_1 Description: kinesin family member 26B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 97,173,469 - 97,173,529 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-06-15
Kif26b
kinesin family member 26B
RGD1560572
similar to hypothetical protein D230039L06
Data merged from RGD:1560572
1643240 APPROVED
2009-06-08
Kif26b
kinesin family member 26B
RGD1560572
similar to hypothetical protein D230039L06
Data merged from RGD:1560572
737654 APPROVED
2008-09-16
Kif26b
kinesin family member 26B
RGD1560022
similar to Hypothetical protein 4832420M10
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1560022
similar to Hypothetical protein 4832420M10
RGD1560022_predicted
similar to Hypothetical protein 4832420M10 (predicted)
'predicted' is removed
2292626 APPROVED
2008-04-30
RGD1560572
similar to hypothetical protein D230039L06
RGD1560572_predicted
similar to hypothetical protein D230039L06 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
RGD1560022_predicted
similar to Hypothetical protein 4832420M10 (predicted)
LOC305012
similar to Hypothetical protein 4832420M10
Symbol and Name status set to approved
1299863 APPROVED
2006-03-07
RGD1560572_predicted
similar to hypothetical protein D230039L06 (predicted)
LOC498294
similar to hypothetical protein D230039L06
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC498294
similar to hypothetical protein D230039L06
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-02-09
LOC305012
similar to Hypothetical protein 4832420M10
Symbol and Name status set to provisional
70820 PROVISIONAL
