Symbol:
Cnih4
Name:
cornichon family member 4
RGD ID:
1559740
Description:
Predicted to enable CCR5 chemokine receptor binding activity. Predicted to be involved in endoplasmic reticulum to Golgi vesicle-mediated transport. Predicted to be located in endoplasmic reticulum and endoplasmic reticulum-Golgi intermediate compartment. Predicted to be active in COPII-coated ER to Golgi transport vesicle and endoplasmic reticulum membrane. Orthologous to human CNIH4 (cornichon family member 4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cornichon family AMPA receptor auxiliary protein 4; cornichon homolog 4; cornichon homolog 4 (Drosophila); LOC289324; RGD1559740; similar to Protein HSPC163
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 95,442,054 - 95,458,163 (+) NCBI GRCr8 mRatBN7.2 13 92,910,315 - 92,926,428 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 92,910,315 - 92,927,853 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 95,415,636 - 95,431,748 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 96,815,538 - 96,831,650 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 93,991,175 - 94,007,276 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 99,469,382 - 99,490,693 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 99,473,044 - 99,489,263 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 104,468,780 - 104,484,267 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 96,921,481 - 96,940,409 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 92,451,600 - 92,467,776 (+) NCBI Celera Cytogenetic Map 13 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cnih4 Rat 1,2-dichloroethane decreases expression ISO Cnih4 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of CNIH4 mRNA CTD PMID:28960355 Cnih4 Rat 1,2-dimethylhydrazine decreases expression ISO Cnih4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CNIH4 mRNA CTD PMID:22206623 Cnih4 Rat 17beta-estradiol decreases expression ISO Cnih4 (Mus musculus) 6480464 Estradiol results in decreased expression of CNIH4 mRNA CTD PMID:39298647 Cnih4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cnih4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CNIH4 mRNA CTD PMID:21570461 Cnih4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CNIH4 mRNA CTD PMID:34747641 Cnih4 Rat 2-hydroxypropanoic acid decreases expression ISO CNIH4 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CNIH4 mRNA CTD PMID:30851411 Cnih4 Rat 2-methylcholine affects expression ISO CNIH4 (Homo sapiens) 6480464 beta-methylcholine affects the expression of CNIH4 mRNA CTD PMID:21179406 Cnih4 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of CNIH4 protein CTD PMID:34915118 Cnih4 Rat 4,4'-sulfonyldiphenol decreases expression ISO Cnih4 (Mus musculus) 6480464 bisphenol S results in decreased expression of CNIH4 mRNA CTD PMID:39298647 Cnih4 Rat 4-phenylbutyric acid decreases expression ISO CNIH4 (Homo sapiens) 6480464 4-phenylbutyric acid results in decreased expression of CNIH4 mRNA CTD PMID:14583596 Cnih4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CNIH4 mRNA CTD PMID:30047161 Cnih4 Rat all-trans-retinoic acid decreases expression ISO CNIH4 (Homo sapiens) 6480464 Tretinoin results in decreased expression of CNIH4 mRNA CTD PMID:23724009 Cnih4 Rat all-trans-retinoic acid increases expression ISO CNIH4 (Homo sapiens) 6480464 Tretinoin results in increased expression of CNIH4 mRNA CTD PMID:33167477 Cnih4 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of CNIH4 mRNA CTD PMID:30047161 Cnih4 Rat Aroclor 1254 increases expression ISO Cnih4 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of CNIH4 mRNA CTD PMID:23650126 Cnih4 Rat arsenite(3-) multiple interactions ISO CNIH4 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to CNIH4 mRNA] CTD PMID:32406909 Cnih4 Rat benzo[a]pyrene affects methylation ISO CNIH4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CNIH4 promoter CTD PMID:27901495 Cnih4 Rat beta-lapachone decreases expression ISO CNIH4 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of CNIH4 mRNA CTD PMID:38218311 Cnih4 Rat beta-lapachone increases expression ISO CNIH4 (Homo sapiens) 6480464 beta-lapachone results in increased expression of CNIH4 mRNA CTD PMID:38218311 Cnih4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CNIH4 mRNA CTD PMID:25181051 Cnih4 Rat bisphenol A increases expression ISO CNIH4 (Homo sapiens) 6480464 bisphenol A results in increased expression of CNIH4 protein CTD PMID:32981897 Cnih4 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of CNIH4 mRNA CTD PMID:33453195 Cnih4 Rat CGP 52608 multiple interactions ISO CNIH4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CNIH4 gene] CTD PMID:28238834 Cnih4 Rat chloropicrin affects expression ISO CNIH4 (Homo sapiens) 6480464 chloropicrin affects the expression of CNIH4 mRNA CTD PMID:26352163 Cnih4 Rat cisplatin increases expression ISO CNIH4 (Homo sapiens) 6480464 Cisplatin results in increased expression of CNIH4 mRNA CTD PMID:27392435 Cnih4 Rat copper(II) sulfate decreases expression ISO CNIH4 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of CNIH4 mRNA CTD PMID:19549813 Cnih4 Rat cyclosporin A increases expression ISO CNIH4 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CNIH4 mRNA CTD PMID:20106945 Cnih4 Rat Dibutyl phosphate affects expression ISO CNIH4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CNIH4 mRNA CTD PMID:37042841 Cnih4 Rat dicrotophos decreases expression ISO CNIH4 (Homo sapiens) 6480464 dicrotophos results in decreased expression of CNIH4 mRNA CTD PMID:28302478 Cnih4 Rat elemental selenium decreases expression ISO CNIH4 (Homo sapiens) 6480464 Selenium results in decreased expression of CNIH4 mRNA CTD PMID:19244175 Cnih4 Rat epoxiconazole increases expression ISO Cnih4 (Mus musculus) 6480464 epoxiconazole results in increased expression of CNIH4 mRNA CTD PMID:35436446 Cnih4 Rat ethanol affects splicing ISO Cnih4 (Mus musculus) 6480464 Ethanol affects the splicing of CNIH4 mRNA CTD PMID:30319688 Cnih4 Rat ethyl methanesulfonate increases expression ISO CNIH4 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of CNIH4 mRNA CTD PMID:23649840 Cnih4 Rat fenthion increases expression ISO Cnih4 (Mus musculus) 6480464 Fenthion results in increased expression of CNIH4 mRNA CTD PMID:34813904 Cnih4 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of CNIH4 mRNA CTD PMID:24136188 Cnih4 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CNIH4 mRNA CTD PMID:24136188 Cnih4 Rat formaldehyde increases expression ISO CNIH4 (Homo sapiens) 6480464 Formaldehyde results in increased expression of CNIH4 mRNA CTD PMID:23649840 Cnih4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CNIH4 mRNA CTD PMID:22061828 Cnih4 Rat ivermectin decreases expression ISO CNIH4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CNIH4 protein CTD PMID:32959892 Cnih4 Rat methidathion increases expression ISO Cnih4 (Mus musculus) 6480464 methidathion results in increased expression of CNIH4 mRNA CTD PMID:34813904 Cnih4 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of CNIH4 mRNA CTD PMID:30047161 Cnih4 Rat methyl methanesulfonate increases expression ISO CNIH4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of CNIH4 mRNA CTD PMID:23649840 Cnih4 Rat monosodium L-glutamate multiple interactions ISO Cnih4 (Mus musculus) 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of CNIH4 mRNA CTD PMID:22078008 Cnih4 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of CNIH4 mRNA CTD PMID:24136188 Cnih4 Rat paracetamol affects expression ISO Cnih4 (Mus musculus) 6480464 Acetaminophen affects the expression of CNIH4 mRNA CTD PMID:17562736 Cnih4 Rat paracetamol increases expression ISO CNIH4 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CNIH4 mRNA CTD PMID:29067470 Cnih4 Rat pirinixic acid increases expression ISO Cnih4 (Mus musculus) 6480464 pirinixic acid results in increased expression of CNIH4 mRNA CTD PMID:18301758 Cnih4 Rat rac-lactic acid decreases expression ISO CNIH4 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CNIH4 mRNA CTD PMID:30851411 Cnih4 Rat Salinomycin decreases expression ISO CNIH4 (Homo sapiens) 6480464 salinomycin results in decreased expression of CNIH4 mRNA CTD PMID:19682730 Cnih4 Rat selenium atom decreases expression ISO CNIH4 (Homo sapiens) 6480464 Selenium results in decreased expression of CNIH4 mRNA CTD PMID:19244175 Cnih4 Rat sunitinib increases expression ISO CNIH4 (Homo sapiens) 6480464 Sunitinib results in increased expression of CNIH4 mRNA CTD PMID:31533062 Cnih4 Rat tetrachloromethane increases expression ISO Cnih4 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CNIH4 mRNA CTD PMID:31919559 Cnih4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CNIH4 mRNA CTD PMID:34492290 Cnih4 Rat thiram decreases expression ISO CNIH4 (Homo sapiens) 6480464 Thiram results in decreased expression of CNIH4 mRNA CTD PMID:38568856 Cnih4 Rat tolcapone decreases expression EXP 6480464 tolcapone results in decreased expression of CNIH4 mRNA CTD PMID:24136188 Cnih4 Rat triadimefon increases expression EXP 6480464 triadimefon results in increased expression of CNIH4 mRNA CTD PMID:30047161 Cnih4 Rat trichostatin A decreases expression ISO CNIH4 (Homo sapiens) 6480464 trichostatin A results in decreased expression of CNIH4 mRNA CTD PMID:24935251 Cnih4 Rat triptonide increases expression ISO Cnih4 (Mus musculus) 6480464 triptonide results in increased expression of CNIH4 mRNA CTD PMID:33045310 Cnih4 Rat valproic acid increases expression ISO CNIH4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CNIH4 mRNA CTD PMID:19101580 and PMID:29154799 Cnih4 Rat vorinostat increases expression ISO CNIH4 (Homo sapiens) 6480464 vorinostat results in increased expression of CNIH4 mRNA CTD PMID:27188386
Cnih4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 95,442,054 - 95,458,163 (+) NCBI GRCr8 mRatBN7.2 13 92,910,315 - 92,926,428 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 92,910,315 - 92,927,853 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 95,415,636 - 95,431,748 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 96,815,538 - 96,831,650 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 93,991,175 - 94,007,276 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 99,469,382 - 99,490,693 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 99,473,044 - 99,489,263 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 104,468,780 - 104,484,267 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 96,921,481 - 96,940,409 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 92,451,600 - 92,467,776 (+) NCBI Celera Cytogenetic Map 13 q26 NCBI
CNIH4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 224,356,803 - 224,379,452 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 224,356,858 - 224,379,459 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 224,544,581 - 224,567,154 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 222,611,218 - 222,630,318 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 197,735,537 - 197,754,630 (+) NCBI Celera Cytogenetic Map 1 q42.11 NCBI HuRef 1 195,064,711 - 195,087,194 (+) NCBI HuRef CHM1_1 1 225,817,049 - 225,839,535 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 223,545,746 - 223,568,267 (+) NCBI T2T-CHM13v2.0
Cnih4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 180,977,437 - 180,996,559 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 180,972,258 - 180,996,559 (+) Ensembl GRCm39 Ensembl GRCm38 1 181,150,366 - 181,168,994 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 181,144,693 - 181,168,994 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 183,081,062 - 183,099,125 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 182,987,662 - 183,003,101 (+) NCBI MGSCv36 mm8 Celera 1 188,217,931 - 188,235,901 (+) NCBI Celera Cytogenetic Map 1 H4 NCBI cM Map 1 84.53 NCBI
Cnih4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955520 991,417 - 1,007,107 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955520 991,477 - 1,006,731 (-) NCBI ChiLan1.0 ChiLan1.0
CNIH4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 25,150,396 - 25,170,703 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 25,101,321 - 25,121,637 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 199,825,889 - 199,848,664 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 204,834,031 - 204,853,888 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 204,834,031 - 204,855,747 (+) Ensembl panpan1.1 panPan2
CNIH4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 40,010,412 - 40,022,425 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 40,010,425 - 40,022,347 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 39,492,398 - 39,508,004 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 39,844,709 - 39,860,649 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 39,844,576 - 39,860,616 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 39,685,664 - 39,701,588 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 39,693,120 - 39,708,864 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 39,961,956 - 39,977,882 (-) NCBI UU_Cfam_GSD_1.0
Cnih4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 53,329,004 - 53,344,647 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936526 1,402,593 - 1,419,315 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936526 1,402,593 - 1,418,710 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CNIH4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 12,688,817 - 12,713,203 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 12,688,833 - 12,705,426 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 15,124,470 - 15,128,426 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CNIH4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 5,402,570 - 5,424,008 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 5,402,151 - 5,423,757 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 5,580,601 - 5,600,358 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cnih4
.
Predicted Target Of
Count of predictions: 683 Count of miRNA genes: 293 Interacting mature miRNAs: 370 Transcripts: ENSRNOT00000004939 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004939 ⟹ ENSRNOP00000004939
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 92,910,357 - 92,927,853 (+) Ensembl Rnor_6.0 Ensembl 13 99,473,044 - 99,489,263 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107775 ⟹ ENSRNOP00000087381
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 92,910,335 - 92,925,451 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114514 ⟹ ENSRNOP00000082866
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 92,910,315 - 92,927,744 (+) Ensembl
RefSeq Acc Id:
NM_001105981 ⟹ NP_001099451
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 95,442,054 - 95,458,163 (+) NCBI mRatBN7.2 13 92,910,315 - 92,926,428 (+) NCBI Rnor_6.0 13 99,473,044 - 99,489,263 (+) NCBI Rnor_5.0 13 104,468,780 - 104,484,267 (+) NCBI RGSC_v3.4 13 96,921,481 - 96,940,409 (+) RGD Celera 13 92,451,600 - 92,467,776 (+) RGD
Sequence:
ATGCATTTCCATGCTTTTCTGGGCCACAACTCCCGGCATGCCGCCTGTCCGGGCGGCGCGGCCCGGAGCTGGTTTGACGGGCGGAGCGGCGGCAGAGGATGGAGGCGGTGGTGTTCCTCTTCTCGCTC
hide sequence
RefSeq Acc Id:
NP_001099451 ⟸ NM_001105981
- UniProtKB:
D3ZTY0 (UniProtKB/TrEMBL), A6JGJ5 (UniProtKB/TrEMBL)
- Sequence:
MEAVVFLFSLLDCCSLIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELVGHTFVTVLMLVSLHWVIFLLNLPVATWNIYRFIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFYLLCFFMY
hide sequence
Ensembl Acc Id:
ENSRNOP00000004939 ⟸ ENSRNOT00000004939
Ensembl Acc Id:
ENSRNOP00000087381 ⟸ ENSRNOT00000107775
Ensembl Acc Id:
ENSRNOP00000082866 ⟸ ENSRNOT00000114514
RGD ID: 13699068 Promoter ID: EPDNEW_R9593 Type: initiation region Name: Cnih4_1 Description: cornichon family AMPA receptor auxiliary protein 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 99,473,114 - 99,473,174 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-03-08
Cnih4
cornichon family member 4
Cnih4
cornichon family AMPA receptor auxiliary protein 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-09-16
Cnih4
cornichon family AMPA receptor auxiliary protein 4
Cnih4
cornichon homolog 4 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-28
Cnih4
cornichon homolog 4 (Drosophila)
RGD1559740_predicted
similar to Protein HSPC163 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1559740_predicted
similar to Protein HSPC163 (predicted)
LOC289324
similar to Protein HSPC163
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC289324
similar to Protein HSPC163
Symbol and Name status set to provisional
70820 PROVISIONAL
