Symbol:
Fggy
Name:
FGGY carbohydrate kinase domain containing
RGD ID:
1558424
MGI Page
MGI
Description:
Predicted to enable D-ribulokinase activity. Predicted to be involved in carbohydrate phosphorylation; neuron cellular homeostasis; and pentose metabolic process. Predicted to be active in cytoplasm. Is expressed in liver lobe; metanephros; and olfactory epithelium. Orthologous to human FGGY (FGGY carbohydrate kinase domain containing).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2310009E04Rik; D-ribulokinase FGGY; FGGY carbohydrate kinase domain-containing protein; MGC118640; RP23-472I13.1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FGGY (FGGY carbohydrate kinase domain containing) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Fggy (FGGY carbohydrate kinase domain containing) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fggy (FGGY carbohydrate kinase domain containing) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FGGY (FGGY carbohydrate kinase domain containing) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FGGY (FGGY carbohydrate kinase domain containing) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fggy (FGGY carbohydrate kinase domain containing) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FGGY (FGGY carbohydrate kinase domain containing) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FGGY (FGGY carbohydrate kinase domain containing) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fggy (FGGY carbohydrate kinase domain containing) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Fggy (FGGY carbohydrate kinase domain containing)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
FGGY (FGGY carbohydrate kinase domain containing)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fggy (FGGY carbohydrate kinase domain containing)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG11594
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MPA43
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
YDR109C
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fggy
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 95,445,717 - 95,815,176 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 95,445,744 - 95,815,176 (+) Ensembl GRCm39 Ensembl GRCm38 4 95,557,480 - 95,926,939 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 95,557,507 - 95,926,939 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 95,224,198 - 95,593,630 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 95,071,521 - 95,313,587 (+) NCBI MGSCv36 mm8 Celera 4 93,937,345 - 94,306,693 (+) NCBI Celera Cytogenetic Map 4 C5 NCBI cM Map 4 43.83 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fggy Mouse (+)-schisandrin B multiple interactions ISO RGD:1359429 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of FGGY mRNA] CTD PMID:31150632 Fggy Mouse (-)-alpha-phellandrene increases expression ISO RGD:1605365 6480464 alpha phellandrene results in increased expression of FGGY mRNA CTD PMID:25075043 Fggy Mouse 1,1-dichloroethene decreases expression EXP 6480464 vinylidene chloride results in decreased expression of FGGY mRNA CTD PMID:26682919 Fggy Mouse 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Fggy Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of FGGY mRNA CTD PMID:28960355 Fggy Mouse 17beta-estradiol increases expression ISO RGD:1359429 6480464 Estradiol results in increased expression of FGGY mRNA CTD PMID:32145629 Fggy Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of FGGY mRNA CTD PMID:39298647 Fggy Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Fggy Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Fggy Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1359429 6480464 Tetrachlorodibenzodioxin results in decreased expression of FGGY mRNA CTD PMID:21215274 Fggy Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1359429 6480464 Tetrachlorodibenzodioxin results in increased expression of FGGY mRNA CTD PMID:33387578 Fggy Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FGGY mRNA CTD PMID:19770486 Fggy Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1605365 6480464 Tetrachlorodibenzodioxin results in decreased expression of FGGY mRNA CTD PMID:19692669 Fggy Mouse 2,4,4'-trichlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Fggy Mouse 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO RGD:1605365 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of FGGY mRNA CTD PMID:19692669 Fggy Mouse 3-chloropropane-1,2-diol decreases expression ISO RGD:1359429 6480464 alpha-Chlorohydrin results in decreased expression of FGGY protein CTD PMID:34915118 Fggy Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of FGGY mRNA CTD PMID:39298647 Fggy Mouse 4,4'-sulfonyldiphenol increases methylation ISO RGD:1605365 6480464 bisphenol S results in increased methylation of FGGY gene CTD PMID:31601247 Fggy Mouse 6-propyl-2-thiouracil decreases expression ISO RGD:1359429 6480464 Propylthiouracil results in decreased expression of FGGY mRNA CTD PMID:30047161 Fggy Mouse aflatoxin B1 affects expression ISO RGD:1605365 6480464 Aflatoxin B1 affects the expression of FGGY protein CTD PMID:20106945 Fggy Mouse aflatoxin B1 increases methylation ISO RGD:1605365 6480464 Aflatoxin B1 results in increased methylation of FGGY intron CTD PMID:30157460 Fggy Mouse aflatoxin B1 decreases expression ISO RGD:1605365 6480464 Aflatoxin B1 results in decreased expression of FGGY mRNA CTD PMID:21641981|PMID:22100608|PMID:27153756 Fggy Mouse aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of FGGY mRNA CTD PMID:19770486 Fggy Mouse Aflatoxin B2 alpha increases methylation ISO RGD:1605365 6480464 aflatoxin B2 results in increased methylation of FGGY intron CTD PMID:30157460 Fggy Mouse alpha-phellandrene increases expression ISO RGD:1605365 6480464 alpha phellandrene results in increased expression of FGGY mRNA CTD PMID:25075043 Fggy Mouse amitrole decreases expression ISO RGD:1359429 6480464 Amitrole results in decreased expression of FGGY mRNA CTD PMID:30047161 Fggy Mouse amphetamine increases expression ISO RGD:1359429 6480464 Amphetamine results in increased expression of FGGY mRNA CTD PMID:30779732 Fggy Mouse arsane multiple interactions ISO RGD:1605365 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of FGGY more ... CTD PMID:32525701 Fggy Mouse arsane affects methylation ISO RGD:1605365 6480464 Arsenic affects the methylation of FGGY gene CTD PMID:25304211 Fggy Mouse arsenic atom multiple interactions ISO RGD:1605365 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of FGGY more ... CTD PMID:32525701 Fggy Mouse arsenic atom affects methylation ISO RGD:1605365 6480464 Arsenic affects the methylation of FGGY gene CTD PMID:25304211 Fggy Mouse atrazine increases expression ISO RGD:1605365 6480464 Atrazine results in increased expression of FGGY mRNA CTD PMID:22378314 Fggy Mouse atrazine affects methylation ISO RGD:1359429 6480464 Atrazine affects the methylation of FGGY gene CTD PMID:28931070 Fggy Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of FGGY mRNA CTD PMID:19770486 Fggy Mouse benzo[a]pyrene increases methylation ISO RGD:1605365 6480464 Benzo(a)pyrene results in increased methylation of FGGY 5' UTR CTD PMID:27901495 Fggy Mouse benzo[a]pyrene decreases expression ISO RGD:1605365 6480464 Benzo(a)pyrene results in decreased expression of FGGY mRNA CTD PMID:20106945|PMID:21632981|PMID:22316170|PMID:26238291|PMID:32234424 Fggy Mouse benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1605365 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of FGGY mRNA CTD PMID:26238291 Fggy Mouse benzo[e]pyrene increases methylation ISO RGD:1605365 6480464 benzo(e)pyrene results in increased methylation of FGGY intron CTD PMID:30157460 Fggy Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of FGGY mRNA CTD PMID:27405655|PMID:35716406 Fggy Mouse bisphenol A affects expression ISO RGD:1359429 6480464 bisphenol A affects the expression of FGGY mRNA CTD PMID:25181051 Fggy Mouse bisphenol A decreases methylation ISO RGD:1605365 6480464 bisphenol A results in decreased methylation of FGGY gene CTD PMID:31601247 Fggy Mouse bisphenol A multiple interactions ISO RGD:1605365 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of FGGY gene CTD PMID:31601247 Fggy Mouse bisphenol A increases expression ISO RGD:1359429 6480464 bisphenol A results in increased expression of FGGY mRNA CTD PMID:32145629 Fggy Mouse bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of FGGY promoter CTD PMID:29220483 Fggy Mouse bisphenol A increases methylation ISO RGD:1359429 6480464 bisphenol A results in increased methylation of FGGY gene CTD PMID:28505145 Fggy Mouse bisphenol A increases expression ISO RGD:1605365 6480464 bisphenol A results in increased expression of FGGY mRNA CTD PMID:27685785 Fggy Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FGGY mRNA CTD PMID:25594700|PMID:29220483 Fggy Mouse cadmium dichloride decreases expression ISO RGD:1605365 6480464 Cadmium Chloride results in decreased expression of FGGY mRNA CTD PMID:21457566 Fggy Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon analog results in decreased expression of FGGY mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681|PMID:25620056 Fggy Mouse cisplatin decreases expression ISO RGD:1359429 6480464 Cisplatin results in decreased expression of FGGY mRNA CTD PMID:22023808 Fggy Mouse cisplatin decreases expression ISO RGD:1605365 6480464 Cisplatin results in decreased expression of FGGY mRNA CTD PMID:27594783 Fggy Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of FGGY mRNA CTD PMID:17585979 Fggy Mouse cobalt dichloride decreases expression ISO RGD:1359429 6480464 cobaltous chloride results in decreased expression of FGGY mRNA CTD PMID:24386269 Fggy Mouse coumarin decreases expression ISO RGD:1359429 6480464 coumarin results in decreased expression of FGGY mRNA CTD PMID:18480146 Fggy Mouse cyclosporin A decreases expression ISO RGD:1605365 6480464 Cyclosporine results in decreased expression of FGGY mRNA CTD PMID:20106945 Fggy Mouse cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of FGGY mRNA CTD PMID:19770486 Fggy Mouse Dibutyl phosphate affects expression ISO RGD:1605365 6480464 di-n-butylphosphoric acid affects the expression of FGGY mRNA CTD PMID:37042841 Fggy Mouse doxorubicin affects methylation ISO RGD:1359429 6480464 Doxorubicin affects the methylation of FGGY gene CTD PMID:28962528 Fggy Mouse endosulfan decreases expression ISO RGD:1359429 6480464 Endosulfan results in decreased expression of FGGY mRNA CTD PMID:29391264 Fggy Mouse epoxiconazole decreases expression EXP 6480464 epoxiconazole results in decreased expression of FGGY mRNA CTD PMID:35436446 Fggy Mouse ethylparaben decreases expression ISO RGD:1605365 6480464 ethyl-p-hydroxybenzoate results in decreased expression of FGGY mRNA CTD PMID:37690743 Fggy Mouse flutamide decreases expression ISO RGD:1359429 6480464 Flutamide results in decreased expression of FGGY mRNA CTD PMID:24793618 Fggy Mouse fulvestrant multiple interactions ISO RGD:1605365 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of FGGY gene CTD PMID:31601247 Fggy Mouse furan decreases expression ISO RGD:1359429 6480464 furan results in decreased expression of FGGY mRNA CTD PMID:26194646 Fggy Mouse methapyrilene decreases expression ISO RGD:1359429 6480464 Methapyrilene results in decreased expression of FGGY mRNA CTD PMID:30467583 Fggy Mouse methapyrilene increases methylation ISO RGD:1605365 6480464 Methapyrilene results in increased methylation of FGGY intron CTD PMID:30157460 Fggy Mouse methimazole decreases expression ISO RGD:1359429 6480464 Methimazole results in decreased expression of FGGY mRNA CTD PMID:30047161 Fggy Mouse methylmercury chloride decreases expression ISO RGD:1605365 6480464 methylmercuric chloride results in decreased expression of FGGY mRNA CTD PMID:28001369 Fggy Mouse N-nitrosodiethylamine multiple interactions ISO RGD:1359429 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of FGGY mRNA CTD PMID:28943392 Fggy Mouse N-Nitrosopyrrolidine decreases expression ISO RGD:1605365 6480464 N-Nitrosopyrrolidine results in decreased expression of FGGY mRNA CTD PMID:32234424 Fggy Mouse nefazodone decreases expression ISO RGD:1359429 6480464 nefazodone results in decreased expression of FGGY mRNA CTD PMID:24136188 Fggy Mouse nickel atom decreases expression ISO RGD:1605365 6480464 Nickel results in decreased expression of FGGY mRNA CTD PMID:25583101 Fggy Mouse O-methyleugenol decreases expression ISO RGD:1605365 6480464 methyleugenol results in decreased expression of FGGY mRNA CTD PMID:32234424 Fggy Mouse okadaic acid decreases expression ISO RGD:1605365 6480464 Okadaic Acid results in decreased expression of FGGY mRNA; Okadaic Acid results in decreased expression more ... CTD PMID:38832940 Fggy Mouse p-toluidine decreases expression ISO RGD:1359429 6480464 4-toluidine results in decreased expression of FGGY mRNA CTD PMID:27638505 Fggy Mouse paracetamol decreases expression ISO RGD:1605365 6480464 Acetaminophen results in decreased expression of FGGY mRNA CTD PMID:29067470 Fggy Mouse paracetamol increases expression ISO RGD:1359429 6480464 Acetaminophen results in increased expression of FGGY mRNA CTD PMID:33387578 Fggy Mouse PCB138 multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Fggy Mouse rotenone decreases expression ISO RGD:1359429 6480464 Rotenone results in decreased expression of FGGY mRNA CTD PMID:28374803 Fggy Mouse S-nitrosoglutathione decreases expression ISO RGD:1605365 6480464 S-Nitrosoglutathione results in decreased expression of FGGY mRNA CTD PMID:38825487 Fggy Mouse sodium arsenate multiple interactions ISO RGD:1605365 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of FGGY more ... CTD PMID:32525701 Fggy Mouse sodium arsenite increases expression ISO RGD:1605365 6480464 sodium arsenite results in increased expression of FGGY mRNA CTD PMID:38568856 Fggy Mouse sodium dichromate decreases expression ISO RGD:1359429 6480464 sodium bichromate results in decreased expression of FGGY mRNA CTD PMID:25993096 Fggy Mouse sulfadimethoxine decreases expression ISO RGD:1359429 6480464 Sulfadimethoxine results in decreased expression of FGGY mRNA CTD PMID:30047161 Fggy Mouse sunitinib increases expression ISO RGD:1605365 6480464 Sunitinib results in increased expression of FGGY mRNA CTD PMID:31533062 Fggy Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of FGGY mRNA CTD PMID:27339419|PMID:31919559 Fggy Mouse tetrachloromethane decreases expression ISO RGD:1359429 6480464 Carbon Tetrachloride results in decreased expression of FGGY mRNA CTD PMID:31150632 Fggy Mouse tetrachloromethane multiple interactions ISO RGD:1359429 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of FGGY mRNA] CTD PMID:31150632 Fggy Mouse thapsigargin increases expression ISO RGD:1605365 6480464 Thapsigargin results in increased expression of FGGY mRNA CTD PMID:22378314 Fggy Mouse thioacetamide decreases expression ISO RGD:1359429 6480464 Thioacetamide results in decreased expression of FGGY mRNA CTD PMID:23411599|PMID:34492290 Fggy Mouse thioacetamide multiple interactions ISO RGD:1359429 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of FGGY mRNA CTD PMID:28943392 Fggy Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of FGGY mRNA CTD PMID:35295148 Fggy Mouse trichloroethene increases expression ISO RGD:1359429 6480464 Trichloroethylene results in increased expression of FGGY mRNA CTD PMID:33387578 Fggy Mouse triphenyl phosphate affects expression ISO RGD:1605365 6480464 triphenyl phosphate affects the expression of FGGY mRNA CTD PMID:37042841 Fggy Mouse tunicamycin increases expression ISO RGD:1605365 6480464 Tunicamycin results in increased expression of FGGY mRNA CTD PMID:22378314 Fggy Mouse urethane decreases expression ISO RGD:1605365 6480464 Urethane results in decreased expression of FGGY mRNA CTD PMID:28818685 Fggy Mouse valdecoxib decreases expression ISO RGD:1359429 6480464 valdecoxib results in decreased expression of FGGY mRNA CTD PMID:24136188 Fggy Mouse valproic acid affects expression ISO RGD:1605365 6480464 Valproic Acid affects the expression of FGGY mRNA CTD PMID:25979313
(+)-schisandrin B (ISO) (-)-alpha-phellandrene (ISO) 1,1-dichloroethene (EXP) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (EXP) 1,2-dichloroethane (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-chloropropane-1,2-diol (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (ISO) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) alpha-phellandrene (ISO) amitrole (ISO) amphetamine (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) cadmium dichloride (ISO) carbon nanotube (EXP) cisplatin (ISO) clofibrate (EXP) cobalt dichloride (ISO) coumarin (ISO) cyclosporin A (EXP,ISO) Dibutyl phosphate (ISO) doxorubicin (ISO) endosulfan (ISO) epoxiconazole (EXP) ethylparaben (ISO) flutamide (ISO) fulvestrant (ISO) furan (ISO) methapyrilene (ISO) methimazole (ISO) methylmercury chloride (ISO) N-nitrosodiethylamine (ISO) N-Nitrosopyrrolidine (ISO) nefazodone (ISO) nickel atom (ISO) O-methyleugenol (ISO) okadaic acid (ISO) p-toluidine (ISO) paracetamol (ISO) PCB138 (EXP) rotenone (ISO) S-nitrosoglutathione (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sulfadimethoxine (ISO) sunitinib (ISO) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thioacetamide (ISO) titanium dioxide (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) urethane (ISO) valdecoxib (ISO) valproic acid (ISO)
Fggy Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 95,445,717 - 95,815,176 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 95,445,744 - 95,815,176 (+) Ensembl GRCm39 Ensembl GRCm38 4 95,557,480 - 95,926,939 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 95,557,507 - 95,926,939 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 95,224,198 - 95,593,630 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 95,071,521 - 95,313,587 (+) NCBI MGSCv36 mm8 Celera 4 93,937,345 - 94,306,693 (+) NCBI Celera Cytogenetic Map 4 C5 NCBI cM Map 4 43.83 NCBI
FGGY Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 59,296,378 - 59,762,730 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 59,296,638 - 59,810,647 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 59,762,485 - 60,228,402 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 59,535,328 - 60,000,987 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 58,050,760 - 58,517,212 (+) NCBI Celera Cytogenetic Map 1 p32.1 NCBI HuRef 1 57,873,726 - 58,339,725 (+) NCBI HuRef CHM1_1 1 59,878,088 - 60,343,919 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 59,174,750 - 59,641,176 (+) NCBI T2T-CHM13v2.0
Fggy Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 115,514,573 - 115,901,713 (+) NCBI GRCr8 mRatBN7.2 5 110,398,866 - 110,786,019 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 110,398,863 - 110,786,017 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 112,964,291 - 113,359,443 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 114,689,808 - 115,084,963 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 114,752,336 - 115,147,501 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 114,516,860 - 114,901,571 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 114,516,889 - 114,901,564 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 118,461,629 - 118,848,796 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 115,881,466 - 116,286,358 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 115,916,199 - 116,291,581 (+) NCBI Celera 5 109,010,541 - 109,391,555 (+) NCBI Celera Cytogenetic Map 5 q33 NCBI
Fggy Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 188,188 - 683,209 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 188,037 - 683,230 (-) NCBI ChiLan1.0 ChiLan1.0
FGGY Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 167,089,858 - 167,549,309 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 166,240,926 - 166,701,547 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 58,561,066 - 59,020,520 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 60,265,564 - 60,725,528 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 60,265,564 - 60,725,528 (+) Ensembl panpan1.1 panPan2
FGGY Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 50,109,660 - 50,523,896 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 50,109,660 - 50,522,630 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 50,176,033 - 50,589,869 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 50,289,699 - 50,704,307 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 50,289,701 - 50,704,337 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 50,240,536 - 50,654,464 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 50,185,976 - 50,599,822 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 50,468,743 - 50,883,534 (-) NCBI UU_Cfam_GSD_1.0
Fggy Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 72,826,955 - 73,220,184 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936522 2,196,015 - 2,589,296 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936522 2,196,664 - 2,589,311 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FGGY Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 152,754,924 - 153,213,127 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 152,754,923 - 153,213,179 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 140,364,062 - 140,400,807 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FGGY Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 73,249,685 - 73,690,591 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 73,249,684 - 73,670,860 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 43,692,740 - 44,137,087 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fggy
.
Predicted Target Of
Count of predictions: 2025 Count of miRNA genes: 721 Interacting mature miRNAs: 932 Transcripts: ENSMUST00000043335, ENSMUST00000079223, ENSMUST00000107091, ENSMUST00000125742, ENSMUST00000130541, ENSMUST00000131654, ENSMUST00000134012, ENSMUST00000141248, ENSMUST00000142384, ENSMUST00000143742, ENSMUST00000147766, ENSMUST00000147783, ENSMUST00000150830, ENSMUST00000153119, ENSMUST00000156223, ENSMUST00000176162, ENSMUST00000176840, ENSMUST00000177394 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
13824979 Epid1_m epididymis and vas deferens weight 1 (mouse) 4 89888237 99857197 Mouse 27226782 Tibl2_m tibia length 2, 5 week (mouse) 4 90888237 111257197 Mouse 13824982 Svwq1_m seminal vesicle weight QTL 1 (mouse) 4 89888237 118857197 Mouse 11532714 Sluc43_m susceptibility to lung cancer 43 (mouse) 4 46642108 123127211 Mouse 13506251 Cytrq1_m cytokine response QTL 1 (mouse) 4 65718086 99718086 Mouse 12904002 Opfaq9_m open field activity QTL 9 (mouse) 4 92975790 126975790 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 1357726 Lnopy1_m lens opacity 1 (mouse) Not determined 4 85428838 119429037 Mouse 11532708 Sluc43i_m susceptibility to lung cancer 43i (mouse) 4 74444699 108444983 Mouse 11532707 Sluc43h_m susceptibility to lung cancer 43h (mouse) 4 74444699 108444983 Mouse 11532706 Sluc43c_m susceptibility to lung cancer 43c (mouse) 4 74444699 108444983 Mouse 27226770 Tibl11_m tibia length 11, 10 week (mouse) 4 88518237 108357197 Mouse 11532705 Sluc43b_m susceptibility to lung cancer 43b (mouse) 4 74444699 108444983 Mouse 1302044 Nss1_m NOD Sjogren's syndrome 1 (mouse) Not determined 4 71982069 105982216 Mouse 11532704 Sluc43a_m susceptibility to lung cancer 43a (mouse) 4 74444699 108444983 Mouse 27226766 Tibl17_m tibia length 17, 16 week (mouse) 4 88518237 108457197 Mouse 27226760 Feml19_m femur length 19, 16 week (mouse) 4 90888237 108457197 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 1302031 Bulb1_m bulb size 1 (mouse) Not determined 4 74033887 108034029 Mouse 27095939 Ulnl9_m ulna length 9, 16 week (mouse) 4 65318237 118857197 Mouse 27095938 Ulnl6_m ulna length 6, 10 week (mouse) 4 66718237 98588237 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 12904933 Edlmmq3_m extensor digitorum longus muscle mass QTL 3 (mouse) 4 81213991 115213991 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300918 Stheal4_m soft tissue heal 4 (mouse) Not determined 4 89969627 123969747 Mouse 1301556 Cd4vts1_m CD4 virgin T cell subset 1 (mouse) Not determined 4 85428838 119429037 Mouse 26884406 Huml3_m humerus length 3, 10 week (mouse) 4 75618237 100157197 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 27226801 Feml6_m femur length 6, 5 week (mouse) 4 87518237 103257197 Mouse 1302204 Spm1_m splenomegaly modifier (mouse) Not determined 4 82244395 116244582 Mouse 11532703 Sluc43g_m susceptibility to lung cancer 43g (mouse) 4 74444699 108444983 Mouse 11532702 Sluc43f_m susceptibility to lung cancer 43f (mouse) 4 74444699 108444983 Mouse 11532701 Sluc43e_m susceptibility to lung cancer 43e (mouse) 4 74444699 108444983 Mouse 1558948 Ath8_m atherosclerosis 8 (mouse) Not determined 4 45658442 105156995 Mouse 11532700 Sluc43d_m susceptibility to lung cancer 43d (mouse) 4 74444699 108444983 Mouse 11039517 Ltpr4_m Leishmania tropica response 4 (mouse) 4 79365751 113365867 Mouse 11039504 Ltpr4a_m Leishmania tropica response 4a (mouse) 4 79365751 113365867 Mouse 11039505 Ltpr4c_m Leishmania tropica response 4c (mouse) 4 79365751 113365867 Mouse 1301930 Papg1_m pulmonary adenoma progression 1 (mouse) Not determined 4 85781167 119781279 Mouse 1357870 Pfat1_m predicted fat percentage 1 (mouse) Not determined 4 63619526 97619685 Mouse 1302057 Pgia27_m proteoglycan induced arthritis 27 (mouse) Not determined 4 70067227 104067464 Mouse 1301545 Gauc_m glucose area under curve (mouse) Not determined 4 76763107 110763305 Mouse 11039506 Ltpr4b_m Leishmania tropica response 4b (mouse) 4 79365751 113365867 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 27226787 Feml14_m femur length 14, 10 week (mouse) 4 84918237 107157197 Mouse 10412193 Plep_m plasma lepin levels (mouse) Not determined 4 74444699 108444983 Mouse 27095900 Scvln9_m sacral vertebrae length 2, 10 week (mouse) 4 68018237 107157197 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 27226716 Metcl2_m metatarsal-calcaneal length 2, 5 week (mouse) 4 88118237 118557197 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 26884434 Zlq1_m zygomatic length QTL 1, 5 week (mouse) 4 53700000 103257197 Mouse 26884435 Zlq4_m zygomatic length QTL 4, 10 week (mouse) 4 85118237 104957197 Mouse 1300697 Sle2_m systemic lupus erythmatosus susceptibility 2 (mouse) Not determined 4 77957579 111957775 Mouse 1301597 Anxty_m anxiety (mouse) Not determined 4 74137574 128009280 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 12880404 Embq1_m emotional behavior QTL 1 (mouse) 4 65757203 95921546 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 26884431 Zlq8_m zygomatic length QTL 8, 16 week (mouse) 4 74718237 108357197 Mouse 12879903 Berr8_m berghei resistance locus 8 (mouse) 4 64222460 98222460 Mouse 12879897 Berr4_m berghei resistance locus 4 (mouse) 4 71982069 105982216 Mouse 4142047 Mvwf3_m modifier of von Willebrand factor 3 (mouse) Not determined 14010457 117072206 Mouse 1301233 Sbw2_m splenomegaly-NZB x NZW 2 (mouse) Not determined 4 94957579 128009280 Mouse 27226746 Metcl8_m metatarsal-calcaneal length 8, 10 week (mouse) 4 87518237 107157197 Mouse 27095924 Pglq2_m pelvic girdle length QTL 2, 5 week (mouse) 4 69118237 130727311 Mouse 27095927 Pglq7_m pelvic girdle length QTL 7, 10 week (mouse) 4 88118237 108357197 Mouse 27095921 Pglq12_m pelvic girdle length QTL 12, 16 week (mouse) 4 83118237 108357197 Mouse 27226739 Metcl14_m metatarsal-calcaneal length 14, 16 week (mouse) 4 87518237 108357197 Mouse 1357561 Mbsyd_m metabolic syndrome (mouse) Not determined 4 66888445 100888588 Mouse 1301118 Bbaa23_m B.burgdorferi-associated arthritis 23 (mouse) Not determined 4 85781167 119781279 Mouse 11532738 Abd1_m autoimmune biliary disease 1 (mouse) 4 88982069 116271120 Mouse 15039368 Nmrs19_m NAFLD-associated magnetic resonance shift 19 (mouse) 4 90882780 124882780 Mouse 1301757 Tlsr4_m thymic lymphoma suppressor region 4 (mouse) Not determined 4 66757130 100757258 Mouse 27095917 Scvln14_m sacral vertebrae length 2, 16 week (mouse) 4 68018237 130277062 Mouse 1301731 Cafq2_m caffeine metabolism QTL 2 (mouse) Not determined 4 94732255 128732454 Mouse 4141900 Skts-fp1_m skin tumor susceptibility in FVB and PWK 1 (mouse) Not determined 4 53550839 124055180 Mouse 1300966 Pabr2_m plasma apolipoprotein B (human) regulator 2 (mouse) Not determined 4 46332646 105801860 Mouse 1301739 Pitm2_m prion incubation time 2 (mouse) Not determined 4 71982069 105982216 Mouse 1301867 Idd11_m insulin dependent diabetes susceptibility 11 (mouse) Not determined 4 83604870 117605006 Mouse 26884449 Sklq2_m skull length QTL 2, 5 week (mouse) 4 36700000 128993793 Mouse 27226724 Tibw2_m tibia width 2, proximal, 10 week (mouse) 4 43000000 108357197 Mouse 27095905 Scvln3_m sacral vertebrae length 2, 5 week (mouse) 4 55600000 128993793 Mouse 11553870 Cmmm_m carcinoma modifier of MSM (mouse) 4 90590668 124590781 Mouse
UniSTS:234964
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 95,653,379 - 95,653,600 UniSTS GRCm38 MGSCv37 4 95,320,070 - 95,320,291 UniSTS GRCm37 Celera 4 94,033,231 - 94,033,452 UniSTS Cytogenetic Map 4 C5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000043335 ⟹ ENSMUSP00000043460
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,467,658 - 95,709,806 (+) Ensembl GRCm38.p6 Ensembl 4 95,579,421 - 95,821,569 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000079223 ⟹ ENSMUSP00000078216
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,445,744 - 95,815,176 (+) Ensembl GRCm38.p6 Ensembl 4 95,557,507 - 95,926,939 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000107091 ⟹ ENSMUSP00000102706
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,473,481 - 95,815,041 (+) Ensembl GRCm38.p6 Ensembl 4 95,585,244 - 95,926,804 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000125742
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,525,124 - 95,710,219 (+) Ensembl GRCm38.p6 Ensembl 4 95,636,887 - 95,821,982 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000130541 ⟹ ENSMUSP00000115688
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,657,746 - 95,815,176 (+) Ensembl GRCm38.p6 Ensembl 4 95,769,509 - 95,926,939 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000131654 ⟹ ENSMUSP00000116264
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,473,481 - 95,700,406 (+) Ensembl GRCm38.p6 Ensembl 4 95,585,244 - 95,812,169 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000134012 ⟹ ENSMUSP00000115859
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,467,731 - 95,657,673 (+) Ensembl GRCm38.p6 Ensembl 4 95,579,494 - 95,769,436 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000141248
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,445,756 - 95,815,172 (+) Ensembl GRCm38.p6 Ensembl 4 95,557,519 - 95,926,935 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000142384 ⟹ ENSMUSP00000123407
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,737,862 - 95,815,171 (+) Ensembl GRCm38.p6 Ensembl 4 95,849,625 - 95,926,934 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000143742 ⟹ ENSMUSP00000117386
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,511,793 - 95,627,159 (+) Ensembl GRCm38.p6 Ensembl 4 95,623,556 - 95,738,922 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000147766
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,511,786 - 95,765,340 (+) Ensembl GRCm38.p6 Ensembl 4 95,623,549 - 95,877,103 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000147783
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,467,721 - 95,489,294 (+) Ensembl GRCm38.p6 Ensembl 4 95,579,484 - 95,601,057 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000150830 ⟹ ENSMUSP00000115546
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,467,726 - 95,485,893 (+) Ensembl GRCm38.p6 Ensembl 4 95,579,489 - 95,597,656 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000153119
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,626,645 - 95,657,682 (+) Ensembl GRCm38.p6 Ensembl 4 95,738,408 - 95,769,445 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000156223 ⟹ ENSMUSP00000118147
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,710,215 - 95,815,041 (+) Ensembl GRCm38.p6 Ensembl 4 95,821,978 - 95,926,804 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000176162
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,445,748 - 95,728,891 (+) Ensembl GRCm38.p6 Ensembl 4 95,557,511 - 95,840,654 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000176840
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,475,152 - 95,627,102 (+) Ensembl GRCm38.p6 Ensembl 4 95,586,915 - 95,738,865 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000177394 ⟹ ENSMUSP00000134881
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 95,445,757 - 95,485,887 (+) Ensembl GRCm38.p6 Ensembl 4 95,557,520 - 95,597,650 (+) Ensembl
RefSeq Acc Id:
NM_001113412 ⟹ NP_001106883
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,445,744 - 95,815,176 (+) NCBI GRCm38 4 95,557,507 - 95,926,939 (+) NCBI MGSCv37 4 95,224,198 - 95,593,630 (+) RGD Celera 4 93,937,345 - 94,306,693 (+) RGD cM Map 4 ENTREZGENE
Sequence:
GTTTGGACCGCCCTGCTGGGTGCGGTGCGGCTGTGCATGGTGGCCTGCTGGCCTGCTAGCTAGAATGTGATTTCATATTGGACAAGTAGAGGGGACCATGATGTCTGGCAGAGACCAGGAACCAAGTC
hide sequence
RefSeq Acc Id:
NM_029347 ⟹ NP_083623
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,467,658 - 95,709,806 (+) NCBI GRCm38 4 95,579,421 - 95,821,569 (+) NCBI MGSCv37 4 95,224,198 - 95,593,630 (+) RGD Celera 4 93,937,345 - 94,306,693 (+) RGD cM Map 4 ENTREZGENE
Sequence:
GTAGAGTTCAAAGATCACTGTTAAAAGAGGACACTGAGTTGAGTTTTCTCCCCTGGCCTGGGACTTACTTTCTGTAGGCTGTCACCAACGAAACTGAACCTGGAGGAGTGGTTCTTTAAGAAGCAGAA
hide sequence
RefSeq Acc Id:
XM_006503461 ⟹ XP_006503524
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,466,564 - 95,815,176 (+) NCBI GRCm38 4 95,579,424 - 95,926,939 (+) NCBI
Sequence:
TCTGAGCAGACAGGTGGTTTGGCTGGTGCATGCTCTGTTTTGGTTTAGTATTTTAAGTAGTCTGGGTCTCTGAGAACTGACATCTCTTCGGTATTGTGGGCTTTTCTTGGGCAGGAATTTAGGCAGCT
hide sequence
RefSeq Acc Id:
XM_006503468 ⟹ XP_006503531
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,759,354 (+) NCBI GRCm38 4 95,557,486 - 95,871,117 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTATGCATGGAGGCTGAGGTAGAGGGGACCATGATGTCTGGCAGAGACCAGGAACCAAGTCGCTACTA
hide sequence
RefSeq Acc Id:
XM_006503472 ⟹ XP_006503535
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,445,722 - 95,728,891 (+) NCBI GRCm38 4 95,557,505 - 95,840,654 (+) NCBI
Sequence:
GAAGCGGGCGGAGTCACAGCTTGTTTGGACCGCCCTGCTGGGTGCGGTGCGGCTGTGCATGGTG
hide sequence
RefSeq Acc Id:
XM_006503474 ⟹ XP_006503537
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,445,745 - 95,815,176 (+) NCBI GRCm38 4 95,557,508 - 95,926,939 (+) NCBI
Sequence:
TTTGGACCGCCCTGCTGGGTGCGGTGCGGCTGTGCATGGTGGCCTGCTGGCCTGCTAGCTAGAA
hide sequence
RefSeq Acc Id:
XM_006503476 ⟹ XP_006503539
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,626,611 - 95,815,176 (+) NCBI GRCm38 4 95,738,374 - 95,926,939 (+) NCBI
Sequence:
GGGTCATTGCATTGCAAAACTCCAAAGAACTGTCTCTGTGTAAGCAGTAGCCTCGTGGAATCTCCCAAGGTTTCAGCTGGGCTAGCTCATGCAGCTGGAACACAAAACGAAACCTCGTGTTGCTTCCT
hide sequence
RefSeq Acc Id:
XM_011240633 ⟹ XP_011238935
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,079 - 95,815,176 (+) NCBI GRCm38 4 95,565,842 - 95,926,939 (+) NCBI
Sequence:
GTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTATGCATGGAGGCTGAGGTAGAGGGGACCATGATGTCTGGCAGAGACCAGGAACCAAGTCGCTACTATGTGGGCATCGATGTGGGAACAGG
hide sequence
RefSeq Acc Id:
XM_011240635 ⟹ XP_011238937
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,759,365 (+) NCBI GRCm38 4 95,565,818 - 95,871,128 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTATGCATGGAGGCTGAGGTAGAGGGGACCATGATGTCTGGCAGAGACCAGGAACCAAGTCGCTACTA
hide sequence
RefSeq Acc Id:
XM_011240636 ⟹ XP_011238938
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,801,165 (+) NCBI GRCm38 4 95,565,818 - 95,911,776 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTAT
hide sequence
RefSeq Acc Id:
XM_011240637 ⟹ XP_011238939
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,815,176 (+) NCBI GRCm38 4 95,565,818 - 95,926,939 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTATGCATGGAGGCTGAGGTAGAGGGGACCATGATGTCTGGCAGAGACCAGGAACCAAGTCGCTACTA
hide sequence
RefSeq Acc Id:
XM_011240639 ⟹ XP_011238941
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,749,611 (+) NCBI GRCm38 4 95,565,818 - 95,861,356 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTATGCATGGAGGCTGAGGTAGAGGGGACCATGATGTCTGGCAGAGACCAGGAACCAAGTCGCTACTA
hide sequence
RefSeq Acc Id:
XM_011240643 ⟹ XP_011238945
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,728,895 (+) NCBI GRCm38 4 95,565,818 - 95,840,658 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTATGCATGGAGGCTGAGGTAGAGGGGACCATGATGTCTGGCAGAGACCAGGAACCAAGTCGCTACTA
hide sequence
RefSeq Acc Id:
XM_011240644 ⟹ XP_011238946
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,815,176 (+) NCBI GRCm38 4 95,565,818 - 95,926,939 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTATGCATGGAGGCTGAGGTAGAGGGGACCATGATGTCTGGCAGAGACCAGGAACCAAGTCGCTACTA
hide sequence
RefSeq Acc Id:
XM_011240645 ⟹ XP_011238947
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,815,176 (+) NCBI GRCm38 4 95,565,818 - 95,926,939 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTATGCATGGAGGCTGAGGTAGAGGGGACCATGATGTCTGGCAGAGACCAGGAACCAAGTCGCTACTA
hide sequence
RefSeq Acc Id:
XM_017320430 ⟹ XP_017175919
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,445,717 - 95,801,165 (+) NCBI GRCm38 4 95,557,480 - 95,911,888 (+) NCBI
Sequence:
GGACTGAAGCGGGCGGAGTCACAGCTTGTTTGGACCGCCCTGCTGGGTGCGGTGCGGCTGTGCA
hide sequence
RefSeq Acc Id:
XM_017320431 ⟹ XP_017175920
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,445,722 - 95,728,895 (+) NCBI GRCm38 4 95,557,485 - 95,840,658 (+) NCBI
Sequence:
GAAGCGGGCGGAGTCACAGCTTGTTTGGACCGCCCTGCTGGGTGCGGTGCGGCTGTGCATGGTGGCCTGCTGGCCTGCTAGCTAGAATGTGATTTCATATTGGACAATTGTGCAGAGTTGAGCCACTG
hide sequence
RefSeq Acc Id:
XM_030253870 ⟹ XP_030109730
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,467,686 - 95,815,176 (+) NCBI GRCm38 4 95,579,424 - 95,926,939 (+) NCBI
Sequence:
GGACACTGAGTTGAGTTTTCTCCCCTGGCCTGGGACTTACTTTCTGTAGGCTGTCACCAACGAAACTGAACCTGGAGGAGTGGTTCTTTAAGAAGCAGAATCTAAGGTAGAGGGGACCATGATGTCTG
hide sequence
RefSeq Acc Id:
XM_030253871 ⟹ XP_030109731
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,445,722 - 95,815,176 (+) NCBI GRCm38 4 95,557,505 - 95,926,939 (+) NCBI
Sequence:
GAAGCGGGCGGAGTCACAGCTTGTTTGGACCGCCCTGCTGGGTGCGGTGCGGCTGTGCATGGTG
hide sequence
RefSeq Acc Id:
XM_030253872 ⟹ XP_030109732
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,445,722 - 95,709,792 (+) NCBI GRCm38 4 95,557,505 - 95,821,555 (+) NCBI
Sequence:
GAAGCGGGCGGAGTCACAGCTTGTTTGGACCGCCCTGCTGGGTGCGGTGCGGCTGTGCATGGTGGCCTGCTGGCCTGCTAGCTAGAATGTGATTTCATATTGGACAAGTAGAGGGGACCATGATGTCT
hide sequence
RefSeq Acc Id:
XM_030253873 ⟹ XP_030109733
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,466,564 - 95,815,176 (+) NCBI GRCm38 4 95,579,427 - 95,926,939 (+) NCBI
Sequence:
TCTGAGCAGACAGGTGGTTTGGCTGGTGCATGCTCTGTTTTGGTTTAGTATTTTAAGTAGTCTGGGTCTCTGAGAACTGACATCTCTTCGGTATTGTGGGCTTTTCTTGGGCAGGAATTTAGGCAGCT
hide sequence
RefSeq Acc Id:
XM_030253874 ⟹ XP_030109734
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,445,730 - 95,815,176 (+) NCBI GRCm38 4 95,557,493 - 95,926,939 (+) NCBI
Sequence:
CGGAGTCACAGCTTGTTTGGACCGCCCTGCTGGGTGCGGTGCGGCTGTGCATGGTGGCCTGCTG
hide sequence
RefSeq Acc Id:
XM_036164515 ⟹ XP_036020408
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,804,300 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTATGCATGGAGGCTGAGGTAGAGGGGACCATGATGTCTGGCAGAGACCAGGAACCAAGTCGCTACTA
hide sequence
RefSeq Acc Id:
XM_036164516 ⟹ XP_036020409
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,801,165 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTATGCATGGAGGCTGAGGTAGAGGGGACCATGATGTCTGGCAGAGACCAGGAACCAAGTCGCTACTA
hide sequence
RefSeq Acc Id:
XM_036164517 ⟹ XP_036020410
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,782,825 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTAT
hide sequence
RefSeq Acc Id:
XM_036164518 ⟹ XP_036020411
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,804,300 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTAT
hide sequence
RefSeq Acc Id:
XM_036164519 ⟹ XP_036020412
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,782,781 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTAT
hide sequence
RefSeq Acc Id:
XM_036164520 ⟹ XP_036020413
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,749,614 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTAT
hide sequence
RefSeq Acc Id:
XM_036164521 ⟹ XP_036020414
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,445,724 - 95,716,349 (+) NCBI
Sequence:
AGCGGGCGGAGTCACAGCTTGTTTGGACCGCCCTGCTGGGTGCGGTGCGGCTGTGCATGGTGGC
hide sequence
RefSeq Acc Id:
XM_036164522 ⟹ XP_036020415
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 95,454,055 - 95,709,803 (+) NCBI
Sequence:
TTGTGCAGAGTTGAGCCACTGCATGTATGTTTGTGAGCCGCGTATGAAGACTCAGGCTGAGTAT
hide sequence
RefSeq Acc Id:
NP_083623 ⟸ NM_029347
- Peptide Label:
isoform b
- UniProtKB:
A0A8X8RHI6 (UniProtKB/TrEMBL)
- Sequence:
MMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNHEGDSSRNVIMWLDHRAVSQVHRIN
hide sequence
RefSeq Acc Id:
NP_001106883 ⟸ NM_001113412
- Peptide Label:
isoform a
- UniProtKB:
Q8K0F0 (UniProtKB/Swiss-Prot), Q8BUF2 (UniProtKB/Swiss-Prot), Q9D7H0 (UniProtKB/Swiss-Prot), A2AJL3 (UniProtKB/Swiss-Prot), A0A8X8M4B3 (UniProtKB/TrEMBL)
- Sequence:
MMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACC
hide sequence
RefSeq Acc Id:
XP_006503531 ⟸ XM_006503468
- Peptide Label:
isoform X14
- Sequence:
MEAEVEGTMMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNHEGDSSRNVIMWLDHRA
hide sequence
RefSeq Acc Id:
XP_006503535 ⟸ XM_006503472
- Peptide Label:
isoform X18
- Sequence:
MMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNHEGDSSRNVIMWLDHRAVSQVHRIN
hide sequence
RefSeq Acc Id:
XP_006503537 ⟸ XM_006503474
- Peptide Label:
isoform X21
- UniProtKB:
A2AJL4 (UniProtKB/TrEMBL)
- Sequence:
MWLDHRAVSQVHRINETKHRVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMIGLEDLIDDNYSKIGNLVLLPGAALGIGLTP
hide sequence
RefSeq Acc Id:
XP_006503524 ⟸ XM_006503461
- Peptide Label:
isoform X2
- UniProtKB:
Q8K0F0 (UniProtKB/Swiss-Prot), Q8BUF2 (UniProtKB/Swiss-Prot), Q9D7H0 (UniProtKB/Swiss-Prot), A2AJL3 (UniProtKB/Swiss-Prot), A0A8X8M4B3 (UniProtKB/TrEMBL)
- Sequence:
MMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACC
hide sequence
RefSeq Acc Id:
XP_006503539 ⟸ XM_006503476
- Peptide Label:
isoform X26
- UniProtKB:
A2AJL3 (UniProtKB/Swiss-Prot)
- Sequence:
MGISKDPVFVPGVWGPYYSAMVPGFWLNEGGQSVTGKLIDHMVQGHPAFPELQAKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLTLSQDLDDLAILYLAT
hide sequence
RefSeq Acc Id:
XP_011238946 ⟸ XM_011240644
- Peptide Label:
isoform X17
- Sequence:
MEAEVEGTMMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNHEGDSSRNVIMWLDHRA
hide sequence
RefSeq Acc Id:
XP_011238947 ⟸ XM_011240645
- Peptide Label:
isoform X19
- UniProtKB:
A0A8X8M4B3 (UniProtKB/TrEMBL)
- Sequence:
MEAEVEGTMMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNHEGDSSRNVIMWLDHRA
hide sequence
RefSeq Acc Id:
XP_011238938 ⟸ XM_011240636
- Peptide Label:
isoform X4
- UniProtKB:
A0A8X8M4B3 (UniProtKB/TrEMBL)
- Sequence:
MEAEVEGTMMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNHEGDSSRNVIMWLDHRA
hide sequence
RefSeq Acc Id:
XP_011238937 ⟸ XM_011240635
- Peptide Label:
isoform X5
- UniProtKB:
A0A8X8M4B3 (UniProtKB/TrEMBL)
- Sequence:
MEAEVEGTMMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSS
hide sequence
RefSeq Acc Id:
XP_011238945 ⟸ XM_011240643
- Peptide Label:
isoform X15
- Sequence:
MEAEVEGTMMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNHEGDSSRNVIMWLDHRA
hide sequence
RefSeq Acc Id:
XP_011238939 ⟸ XM_011240637
- Peptide Label:
isoform X7
- UniProtKB:
A0A8X8M4B3 (UniProtKB/TrEMBL)
- Sequence:
MEAEVEGTMMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNHEGDSSRNVIMWLDHRA
hide sequence
RefSeq Acc Id:
XP_011238941 ⟸ XM_011240639
- Peptide Label:
isoform X9
- UniProtKB:
A0A8X8M4B3 (UniProtKB/TrEMBL)
- Sequence:
MEAEVEGTMMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSS
hide sequence
RefSeq Acc Id:
XP_011238935 ⟸ XM_011240633
- Peptide Label:
isoform X1
- UniProtKB:
A0A8X8M4B3 (UniProtKB/TrEMBL)
- Sequence:
MEAEVEGTMMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNHEGDSSRNVIMWLDHRA
hide sequence
RefSeq Acc Id:
XP_017175919 ⟸ XM_017320430
- Peptide Label:
isoform X8
- Sequence:
MMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACC
hide sequence
RefSeq Acc Id:
XP_017175920 ⟸ XM_017320431
- Peptide Label:
isoform X20
- Sequence:
MEAEVEGTMMSGRDQEPSRYYVGIDVGTGSVRAALVDQRGLLLAFAEQPIKKWEPQFNHHEQSSEDIWAACCLVTKEVVQGIDAHRIRGLGFDATCSLVVLDKEFHPLPVNHEGDSSRNVIMWLDHRA
hide sequence
RefSeq Acc Id:
XP_030109734 ⟸ XM_030253874
- Peptide Label:
isoform X25
RefSeq Acc Id:
XP_030109731 ⟸ XM_030253871
- Peptide Label:
isoform X11
- UniProtKB:
A0A8X8M4B3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_030109732 ⟸ XM_030253872
- Peptide Label:
isoform X24
- UniProtKB:
A0A8X8RHI6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_030109730 ⟸ XM_030253870
- Peptide Label:
isoform X11
- UniProtKB:
A0A8X8M4B3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_030109733 ⟸ XM_030253873
- Peptide Label:
isoform X25
Ensembl Acc Id:
ENSMUSP00000115546 ⟸ ENSMUST00000150830
Ensembl Acc Id:
ENSMUSP00000115688 ⟸ ENSMUST00000130541
Ensembl Acc Id:
ENSMUSP00000117386 ⟸ ENSMUST00000143742
Ensembl Acc Id:
ENSMUSP00000078216 ⟸ ENSMUST00000079223
Ensembl Acc Id:
ENSMUSP00000134881 ⟸ ENSMUST00000177394
Ensembl Acc Id:
ENSMUSP00000102706 ⟸ ENSMUST00000107091
Ensembl Acc Id:
ENSMUSP00000116264 ⟸ ENSMUST00000131654
Ensembl Acc Id:
ENSMUSP00000115859 ⟸ ENSMUST00000134012
Ensembl Acc Id:
ENSMUSP00000123407 ⟸ ENSMUST00000142384
Ensembl Acc Id:
ENSMUSP00000118147 ⟸ ENSMUST00000156223
Ensembl Acc Id:
ENSMUSP00000043460 ⟸ ENSMUST00000043335
RefSeq Acc Id:
XP_036020414 ⟸ XM_036164521
- Peptide Label:
isoform X22
RefSeq Acc Id:
XP_036020408 ⟸ XM_036164515
- Peptide Label:
isoform X3
- UniProtKB:
A0A8X8M4B3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036020411 ⟸ XM_036164518
- Peptide Label:
isoform X12
RefSeq Acc Id:
XP_036020409 ⟸ XM_036164516
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_036020410 ⟸ XM_036164517
- Peptide Label:
isoform X10
- UniProtKB:
A0A8X8M4B3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036020412 ⟸ XM_036164519
- Peptide Label:
isoform X13
RefSeq Acc Id:
XP_036020413 ⟸ XM_036164520
- Peptide Label:
isoform X16
RefSeq Acc Id:
XP_036020415 ⟸ XM_036164522
- Peptide Label:
isoform X23
- UniProtKB:
A0A8X8RHI6 (UniProtKB/TrEMBL)
RGD ID: 6835329 Promoter ID: MM_KWN:38505 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, Liver Transcripts: ENSMUST00000107087, ENSMUST00000107089, ENSMUST00000107090, OTTMUST00000018255, OTTMUST00000018256, OTTMUST00000018337, UC008TSX.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 95,245,891 - 95,246,391 (+) MPROMDB
RGD ID: 6835321 Promoter ID: MM_KWN:38507 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Liver Transcripts: OTTMUST00000018257, OTTMUST00000018258 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 95,289,491 - 95,289,991 (+) MPROMDB
RGD ID: 6835334 Promoter ID: MM_KWN:38509 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney Transcripts: OTTMUST00000018336, UC008TSY.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 95,404,796 - 95,405,296 (+) MPROMDB
RGD ID: 6835323 Promoter ID: MM_KWN:38510 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney Transcripts: OTTMUST00000018338 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 95,434,996 - 95,435,496 (+) MPROMDB
RGD ID: 6835324 Promoter ID: MM_KWN:38511 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Liver Transcripts: OTTMUST00000018376 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 95,488,491 - 95,488,991 (+) MPROMDB
RGD ID: 6883876 Promoter ID: EPDNEW_M5389 Type: multiple initiation site Name: Fggy_1 Description: Mus musculus FGGY carbohydrate kinase domain containing , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5390 EPDNEW_M5391 EPDNEW_M5392 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 95,557,507 - 95,557,567 EPDNEW
RGD ID: 6883878 Promoter ID: EPDNEW_M5390 Type: single initiation site Name: Fggy_4 Description: Mus musculus FGGY carbohydrate kinase domain containing , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5389 EPDNEW_M5391 EPDNEW_M5392 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 95,568,122 - 95,568,182 EPDNEW
RGD ID: 6883880 Promoter ID: EPDNEW_M5391 Type: initiation region Name: Fggy_2 Description: Mus musculus FGGY carbohydrate kinase domain containing , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5389 EPDNEW_M5390 EPDNEW_M5392 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 95,579,487 - 95,579,547 EPDNEW
RGD ID: 6883882 Promoter ID: EPDNEW_M5392 Type: multiple initiation site Name: Fggy_3 Description: Mus musculus FGGY carbohydrate kinase domain containing , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5389 EPDNEW_M5390 EPDNEW_M5391 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 95,849,584 - 95,849,644 EPDNEW
