Symbol:
Bcl7b
Name:
B cell CLL/lymphoma 7B
RGD ID:
1557893
MGI Page
MGI
Description:
Predicted to be involved in several processes, including positive regulation of stem cell population maintenance; regulation of cell cycle process; and regulation of nucleobase-containing compound metabolic process. Part of SWI/SNF complex. Is expressed in several structures, including brain; cardiovascular system; genitourinary system; gut; and skin. Orthologous to human BCL7B (BAF chromatin remodeling complex subunit BCL7B).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
B-cell CLL/lymphoma 7 protein family member B; B-cell CLL/lymphoma 7B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BCL7B (BAF chromatin remodeling complex subunit BCL7B) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Bcl7b (BAF chromatin remodeling complex subunit BCL7B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bcl7b (BAF chromatin remodeling complex subunit BCL7B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BCL7B (BAF chromatin remodeling complex subunit BCL7B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BCL7B (BAF chromatin remodeling complex subunit BCL7B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bcl7b (BAF chromatin remodeling complex subunit BCL7B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BCL7B (BAF chromatin remodeling complex subunit BCL7B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BCL7B (BAF chromatin remodeling complex subunit BCL7B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bcl7b (BAF chromatin remodeling complex subunit BCL7B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
BCL7B (BAF chromatin remodeling complex subunit BCL7B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Bcl7b (BAF chromatin remodeling complex subunit BCL7B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bcl7bb (BAF chromatin remodeling complex subunit BCL7B b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|ZFIN)
Danio rerio (zebrafish):
bcl7ba (BAF chromatin remodeling complex subunit BCL7B a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
BCL7-like
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
bcl-7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bcl7b
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 135,197,226 - 135,210,706 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 135,197,137 - 135,210,709 (+) Ensembl GRCm39 Ensembl GRCm38 5 135,168,372 - 135,181,852 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 135,168,283 - 135,181,855 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 135,644,242 - 135,657,722 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 135,453,119 - 135,466,472 (+) NCBI MGSCv36 mm8 Celera 5 132,179,566 - 132,193,046 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 75.04 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bcl7b Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of BCL7B mRNA CTD PMID:22206623 Bcl7b Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of BCL7B mRNA CTD PMID:17555576 Bcl7b Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Bcl7b (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BCL7B mRNA CTD PMID:21215274 Bcl7b Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Bcl7b (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BCL7B mRNA CTD PMID:33387578 Bcl7b Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of BCL7B mRNA CTD PMID:21570461 and PMID:24680724 Bcl7b Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO BCL7B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of BCL7B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of BCL7B mRNA CTD PMID:28628672 Bcl7b Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Bcl7b (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of BCL7B mRNA CTD PMID:36041667 Bcl7b Mouse antimycin A decreases expression ISO BCL7B (Homo sapiens) 6480464 Antimycin A results in decreased expression of BCL7B mRNA CTD PMID:33512557 Bcl7b Mouse arsane affects methylation ISO BCL7B (Homo sapiens) 6480464 Arsenic affects the methylation of BCL7B gene CTD PMID:25304211 Bcl7b Mouse arsenic atom affects methylation ISO BCL7B (Homo sapiens) 6480464 Arsenic affects the methylation of BCL7B gene CTD PMID:25304211 Bcl7b Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BCL7B mRNA CTD PMID:27858113 Bcl7b Mouse benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BCL7B mRNA CTD PMID:27858113 Bcl7b Mouse Benzo[k]fluoranthene increases expression EXP 6480464 benzo(k)fluoranthene results in increased expression of BCL7B mRNA CTD PMID:26377693 Bcl7b Mouse bisphenol A increases expression ISO Bcl7b (Rattus norvegicus) 6480464 bisphenol A results in increased expression of BCL7B mRNA CTD PMID:25181051 Bcl7b Mouse bisphenol A multiple interactions ISO Bcl7b (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of BCL7B mRNA CTD PMID:36041667 Bcl7b Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BCL7B mRNA CTD PMID:33221593 Bcl7b Mouse bisphenol A multiple interactions ISO BCL7B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of BCL7B mRNA CTD PMID:28628672 Bcl7b Mouse bisphenol F multiple interactions ISO BCL7B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of BCL7B mRNA CTD PMID:28628672 Bcl7b Mouse bisphenol F multiple interactions ISO Bcl7b (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of BCL7B mRNA CTD PMID:36041667 Bcl7b Mouse cadmium atom multiple interactions ISO BCL7B (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of BCL7B mRNA CTD PMID:35301059 Bcl7b Mouse cadmium dichloride multiple interactions ISO BCL7B (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of BCL7B mRNA CTD PMID:35301059 Bcl7b Mouse caffeine affects phosphorylation ISO BCL7B (Homo sapiens) 6480464 Caffeine affects the phosphorylation of BCL7B protein CTD PMID:35688186 Bcl7b Mouse cannabidiol decreases expression ISO BCL7B (Homo sapiens) 6480464 Cannabidiol results in decreased expression of BCL7B mRNA CTD PMID:27918106 and PMID:27932991 Bcl7b Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon analog results in decreased expression of BCL7B mRNA CTD PMID:25554681 Bcl7b Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of BCL7B mRNA CTD PMID:37019170 Bcl7b Mouse chrysene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BCL7B mRNA CTD PMID:27858113 Bcl7b Mouse coumarin increases phosphorylation ISO BCL7B (Homo sapiens) 6480464 coumarin results in increased phosphorylation of BCL7B protein CTD PMID:35688186 Bcl7b Mouse dexamethasone multiple interactions ISO BCL7B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of BCL7B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of BCL7B mRNA CTD PMID:28628672 Bcl7b Mouse elemental selenium increases expression ISO BCL7B (Homo sapiens) 6480464 Selenium results in increased expression of BCL7B mRNA CTD PMID:19244175 Bcl7b Mouse FR900359 increases phosphorylation ISO BCL7B (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of BCL7B protein CTD PMID:37730182 Bcl7b Mouse gentamycin increases expression ISO Bcl7b (Rattus norvegicus) 6480464 Gentamicins results in increased expression of BCL7B mRNA CTD PMID:33387578 Bcl7b Mouse glycidyl methacrylate decreases expression ISO BCL7B (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of BCL7B protein CTD PMID:36641056 Bcl7b Mouse indometacin multiple interactions ISO BCL7B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of BCL7B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of BCL7B mRNA CTD PMID:28628672 Bcl7b Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of BCL7B mRNA CTD PMID:36331819 Bcl7b Mouse ivermectin decreases expression ISO BCL7B (Homo sapiens) 6480464 Ivermectin results in decreased expression of BCL7B protein CTD PMID:32959892 Bcl7b Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of BCL7B mRNA CTD PMID:35964746 Bcl7b Mouse p-menthan-3-ol increases expression ISO BCL7B (Homo sapiens) 6480464 Menthol results in increased expression of BCL7B mRNA CTD PMID:26760959 Bcl7b Mouse paracetamol increases expression ISO BCL7B (Homo sapiens) 6480464 Acetaminophen results in increased expression of BCL7B mRNA CTD PMID:22230336 Bcl7b Mouse paracetamol increases expression ISO Bcl7b (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of BCL7B mRNA CTD PMID:33387578 Bcl7b Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of BCL7B mRNA CTD PMID:36331819 Bcl7b Mouse rotenone decreases expression ISO BCL7B (Homo sapiens) 6480464 Rotenone results in decreased expression of BCL7B mRNA CTD PMID:33512557 Bcl7b Mouse selenium atom increases expression ISO BCL7B (Homo sapiens) 6480464 Selenium results in increased expression of BCL7B mRNA CTD PMID:19244175 Bcl7b Mouse sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of BCL7B mRNA CTD PMID:31558096 Bcl7b Mouse sunitinib increases expression ISO BCL7B (Homo sapiens) 6480464 Sunitinib results in increased expression of BCL7B mRNA CTD PMID:31533062 Bcl7b Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of BCL7B mRNA CTD PMID:17555576 Bcl7b Mouse tebufenpyrad decreases expression ISO BCL7B (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of BCL7B mRNA CTD PMID:33512557 Bcl7b Mouse tetraphene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BCL7B mRNA CTD PMID:27858113 Bcl7b Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of BCL7B promoter CTD PMID:35295148 Bcl7b Mouse trichloroethene increases expression ISO Bcl7b (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of BCL7B mRNA CTD PMID:33387578 Bcl7b Mouse triphenyl phosphate affects expression ISO BCL7B (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BCL7B mRNA CTD PMID:37042841 Bcl7b Mouse urethane increases expression ISO BCL7B (Homo sapiens) 6480464 Urethane results in increased expression of BCL7B mRNA CTD PMID:28818685 Bcl7b Mouse valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of BCL7B mRNA CTD PMID:21427059 Bcl7b Mouse valproic acid affects expression ISO BCL7B (Homo sapiens) 6480464 Valproic Acid affects the expression of BCL7B mRNA CTD PMID:25979313 Bcl7b Mouse vinclozolin increases expression ISO Bcl7b (Rattus norvegicus) 6480464 vinclozolin results in increased expression of BCL7B mRNA CTD PMID:23034163
Bcl7b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 135,197,226 - 135,210,706 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 135,197,137 - 135,210,709 (+) Ensembl GRCm39 Ensembl GRCm38 5 135,168,372 - 135,181,852 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 135,168,283 - 135,181,855 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 135,644,242 - 135,657,722 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 135,453,119 - 135,466,472 (+) NCBI MGSCv36 mm8 Celera 5 132,179,566 - 132,193,046 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 75.04 NCBI
BCL7B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 73,536,356 - 73,557,690 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 73,536,356 - 73,557,690 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 72,950,686 - 72,972,020 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 72,588,622 - 72,609,960 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 72,395,336 - 72,416,675 NCBI Celera 7 68,428,601 - 68,449,940 (-) NCBI Celera Cytogenetic Map 7 q11.23 NCBI HuRef 7 68,832,300 - 68,853,680 (-) NCBI HuRef CHM1_1 7 73,096,104 - 73,117,479 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 74,736,839 - 74,758,190 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 72,283,755 - 72,305,137 (-) NCBI
Bcl7b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 27,133,412 - 27,146,631 (-) NCBI GRCr8 mRatBN7.2 12 21,496,860 - 21,510,079 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 21,496,856 - 21,510,202 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 22,638,494 - 22,651,869 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 23,250,819 - 23,264,194 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 22,317,282 - 22,330,657 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 24,543,748 - 24,557,093 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 24,543,759 - 24,556,976 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 26,541,051 - 26,554,396 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 22,651,275 - 22,656,141 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 23,259,412 - 23,272,757 (-) NCBI Celera Cytogenetic Map 12 q12 NCBI
Bcl7b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955456 14,148,868 - 14,167,653 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955456 14,149,484 - 14,166,753 (+) NCBI ChiLan1.0 ChiLan1.0
BCL7B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 91,344,072 - 91,365,509 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 139,608,747 - 139,630,142 (+) NCBI NHGRI_mPanPan1 PanPan1.1 7 80,688,360 - 80,712,657 (-) NCBI panpan1.1 PanPan1.1 panPan2
BCL7B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 6,680,619 - 6,701,601 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 6,680,735 - 6,700,639 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 8,377,928 - 8,398,893 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 6,495,597 - 6,516,598 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 6,471,231 - 6,516,598 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 6,485,070 - 6,506,023 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 6,432,831 - 6,453,818 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 6,596,500 - 6,617,465 (+) NCBI UU_Cfam_GSD_1.0
Bcl7b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 131,214,623 - 131,242,920 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936543 2,799,571 - 2,821,956 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936543 2,793,098 - 2,821,933 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BCL7B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 10,850,354 - 10,869,288 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 10,850,347 - 10,887,485 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 10,550,010 - 10,587,144 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BCL7B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 9,498,053 - 9,527,419 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 9,498,161 - 9,526,542 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666070 6,952,624 - 6,978,801 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bcl7b
.
Predicted Target Of
Count of predictions: 919 Count of miRNA genes: 366 Interacting mature miRNAs: 438 Transcripts: ENSMUST00000031692, ENSMUST00000111187, ENSMUST00000111188, ENSMUST00000145329 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
27226719 Tibw6_m tibia width 6, proximal, 16 week (mouse) 5 72857343 139985755 Mouse 1301715 Elmaz2_m elevated maze behavior 2 (mouse) Not determined 5 125178229 141700466 Mouse 10412191 Bbaa24_m B.burgdorferi-associated arthritis 24 (mouse) Not determined 5 119945037 141700466 Mouse 13464143 Bbaa2b_m B.burgdorferi-associated arthritis 2b (mouse) 5 133052969 140709801 Mouse 11528552 Scram1_m spinal cord resistance to astrocytoma modifier 1 (mouse) 5 121455402 151758149 Mouse 1300827 Cora1_m correlation in cytokine production 1 (mouse) Not determined 5 115156883 149157015 Mouse 14746986 Manh58_m mandible shape 58 (mouse) 5 102446283 136446283 Mouse 10412239 Alpq7_m alcohol preference QTL 7 (mouse) Not determined 5 104705939 138705939 Mouse 12880406 Jcdq2_m joint cartilage degeneration QTL 2 (mouse) 5 129787831 151758149 Mouse 4141218 Ath24_m atherosclerosis 24 (mouse) Not determined 129520084 151758149 Mouse 12859290 Criq2_m Citrobacter rodentium infection QTL 2 (mouse) 5 101332579 135332579 Mouse 1301363 Pbwg13_m postnatal body weight growth 13 (mouse) Not determined 5 125133457 151758149 Mouse 1301362 Prnr1_m prion resistance 1 (mouse) Not determined 5 89418876 146787935 Mouse 1300913 Bwefm_m body weight females and males day 10 (mouse) Not determined 5 109439348 143439459 Mouse 4141081 Nidd7k_m Nidd7 on KK-A (mouse) Not determined 119945037 149347326 Mouse 1301624 Aevm2_m autoimmune extremity vasculitis in MRL mice 2 (mouse) Not determined 5 101863832 135864028 Mouse 10043890 Trigq4_m triglyceride QTL 4 (mouse) Not determined 5 107906299 141906412 Mouse 1302079 Lbw3_m lupus NZB x NZW 3 (mouse) Not determined 5 124700335 151758149 Mouse 11532736 Sluc33b_m susceptibility to lung cancer 33b (mouse) 5 102945037 136945196 Mouse 1301986 Bpq4_m blood pressure QTL 4 (mouse) Not determined 5 121555236 151758149 Mouse 1301857 Bglq14_m body growth late QTL 14 (mouse) Not determined 5 118948964 151758149 Mouse 10412202 Bbaa26_m B.burgdorferi-associated arthritis 26 (mouse) Not determined 5 104583688 138555455 Mouse 1301543 Hypch_m hypercholesterolemia (mouse) Not determined 5 109238624 139118905 Mouse 4142473 Chlq11_m circulating hormone level QTL 11 (mouse) Not determined 5 107906299 141906412 Mouse 13464251 Ahl21_m age related hearing loss, early onset 21 (mouse) 5 109167240 143167381 Mouse 11341716 Rvfs3_m Rift Valley fever susceptibility 3 (mouse) 5 26441234 138455402 Mouse 1301226 Bbaa2_m B.burgdorferi-associated arthritis 2 (mouse) Not determined 5 115156883 149157015 Mouse 10412197 Bbaa25_m B.burgdorferi-associated arthritis 25 (mouse) Not determined 5 109167240 143167381 Mouse 1301102 Cia14_m collagen induced arthritis 14 (mouse) Not determined 5 113320385 138555455 Mouse 11049557 Lmr26_m leishmaniasis resistance 26 (mouse) 5 133925558 151758149 Mouse 13464243 Ahl20_m age related hearing loss, early onset 20 (mouse) 5 107906299 141906412 Mouse
AJ011145
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 135,181,528 - 135,181,654 UniSTS GRCm38 MGSCv37 5 135,657,398 - 135,657,524 UniSTS GRCm37 Celera 5 132,192,722 - 132,192,848 UniSTS Cytogenetic Map 5 G2 UniSTS Whitehead/MRC_RH 5 1637.95 UniSTS
Bcl7b
Mouse Assembly Chr Position (strand) Source JBrowse MGSCv37 5 135,656,405 - 135,656,903 UniSTS GRCm37 Celera 5 132,191,729 - 132,192,227 UniSTS Cytogenetic Map 5 G2 UniSTS cM Map 5 UniSTS
Bcl7b
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 135,180,535 - 135,181,033 UniSTS GRCm38 MGSCv37 5 135,656,405 - 135,656,903 UniSTS GRCm37 Celera 5 132,191,729 - 132,192,227 UniSTS Cytogenetic Map 5 G2 UniSTS cM Map 5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000031692 ⟹ ENSMUSP00000031692
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 135,197,137 - 135,210,709 (+) Ensembl GRCm38.p6 Ensembl 5 135,168,283 - 135,181,855 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000111187 ⟹ ENSMUSP00000106818
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 135,197,243 - 135,202,302 (+) Ensembl GRCm38.p6 Ensembl 5 135,168,389 - 135,173,448 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000111188 ⟹ ENSMUSP00000106819
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 135,197,266 - 135,210,685 (+) Ensembl GRCm38.p6 Ensembl 5 135,168,412 - 135,181,831 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000145329
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 135,208,436 - 135,209,979 (+) Ensembl GRCm38.p6 Ensembl 5 135,179,582 - 135,181,125 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000202606 ⟹ ENSMUSP00000144538
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 135,197,299 - 135,209,449 (+) Ensembl GRCm38.p6 Ensembl 5 135,168,445 - 135,180,595 (+) Ensembl
RefSeq Acc Id:
NM_009745 ⟹ NP_033875
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 135,197,226 - 135,210,706 (+) NCBI GRCm38 5 135,168,372 - 135,181,852 (+) ENTREZGENE MGSCv37 5 135,644,242 - 135,657,722 (+) RGD Celera 5 132,179,566 - 132,193,046 (+) RGD cM Map 5 ENTREZGENE
Sequence:
ACGCGCGCACGGAGGGGGGGCGACGGCCGCGGTGACGTGCTGCGGTGGCAGCGGGTGGACGGCGACGCGTGAGGCGCGTGATATCCCGCGTCTTGGGAGCACTGTCCCGGCCCCCAGCCACTCCCCGC
hide sequence
RefSeq Acc Id:
NP_033875 ⟸ NM_009745
- UniProtKB:
Q3TV31 (UniProtKB/Swiss-Prot), O89022 (UniProtKB/Swiss-Prot), Q3U2W0 (UniProtKB/Swiss-Prot), Q921K9 (UniProtKB/Swiss-Prot)
- Sequence:
MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNNTAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSD
hide sequence
Ensembl Acc Id:
ENSMUSP00000106818 ⟸ ENSMUST00000111187
Ensembl Acc Id:
ENSMUSP00000106819 ⟸ ENSMUST00000111188
Ensembl Acc Id:
ENSMUSP00000031692 ⟸ ENSMUST00000031692
Ensembl Acc Id:
ENSMUSP00000144538 ⟸ ENSMUST00000202606
RGD ID: 6888310 Promoter ID: EPDNEW_M7606 Type: initiation region Name: Bcl7b_1 Description: Mus musculus B cell CLL/lymphoma 7B , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 135,168,402 - 135,168,462 EPDNEW
RGD ID: 6837172 Promoter ID: MM_KWN:44342 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Liver, Lung, MEF_B6, Spleen Transcripts: ENSMUST00000111188, OTTMUST00000064241, OTTMUST00000064242, UC008ZXW.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 135,643,266 - 135,644,577 (+) MPROMDB
RGD ID: 6837173 Promoter ID: MM_KWN:44343 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: OTTMUST00000064291 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 135,654,941 - 135,655,892 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-02-07
Bcl7b
B cell CLL/lymphoma 7B
Bcl7b
B-cell CLL/lymphoma 7B
Symbol and/or name change
5135510 APPROVED
