Symbol:
Susd4
Name:
sushi domain containing 4
RGD ID:
1557643
MGI Page
MGI
Description:
Involved in regulation of postsynaptic neurotransmitter receptor internalization. Is active in parallel fiber to Purkinje cell synapse and postsynaptic membrane. Is expressed in brain and cortical plate. Orthologous to human SUSD4 (sushi domain containing 4).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AI848994; E430021N18Rik; expressed sequence AI848994; MGC30368; N28096; sushi domain-containing protein 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SUSD4 (sushi domain containing 4) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Susd4 (sushi domain containing 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Susd4 (sushi domain containing 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SUSD4 (sushi domain containing 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SUSD4 (sushi domain containing 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Susd4 (sushi domain containing 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SUSD4 (sushi domain containing 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SUSD4 (sushi domain containing 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Susd4 (sushi domain containing 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Susd4 (sushi domain containing 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SUSD4 (sushi domain containing 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
susd4 (sushi domain containing 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 182,591,609 - 182,724,161 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 182,591,425 - 182,724,156 (+) Ensembl GRCm39 Ensembl GRCm38 1 182,764,044 - 182,896,596 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 182,763,860 - 182,896,591 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 184,695,037 - 184,825,785 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 184,601,581 - 184,732,329 (+) NCBI MGSCv36 mm8 Celera 1 189,807,460 - 189,939,824 (+) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 85.94 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Susd4 Mouse (+)-schisandrin B multiple interactions ISO RGD:1564043 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SUSD4 mRNA] CTD PMID:31150632 Susd4 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SUSD4 mRNA CTD PMID:36331819 Susd4 Mouse 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Susd4 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of SUSD4 mRNA CTD PMID:28960355 Susd4 Mouse 17beta-estradiol multiple interactions ISO RGD:1605987 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of SUSD4 mRNA CTD PMID:19619570 Susd4 Mouse 17beta-estradiol increases expression ISO RGD:1605987 6480464 Estradiol results in increased expression of SUSD4 mRNA CTD PMID:19619570|PMID:31614463 Susd4 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Susd4 Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Susd4 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1605987 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of SUSD4 mRNA CTD PMID:19619570 Susd4 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1564043 6480464 Tetrachlorodibenzodioxin results in decreased expression of SUSD4 mRNA CTD PMID:33387578 Susd4 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1564043 6480464 Tetrachlorodibenzodioxin results in increased expression of SUSD4 mRNA CTD PMID:32109520 Susd4 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SUSD4 mRNA CTD PMID:26290441|PMID:28922406 Susd4 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SUSD4 mRNA CTD PMID:26377647 Susd4 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1605987 6480464 Tetrachlorodibenzodioxin results in increased expression of SUSD4 mRNA CTD PMID:19619570 Susd4 Mouse 2,4,4'-trichlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Susd4 Mouse 3,3',4,4',5-pentachlorobiphenyl increases expression ISO RGD:1564043 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of SUSD4 mRNA CTD PMID:32119087 Susd4 Mouse 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4,4'-diaminodiphenylmethane results in decreased expression of SUSD4 mRNA CTD PMID:18648102 Susd4 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1564043 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Susd4 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of SUSD4 mRNA CTD PMID:28973697 Susd4 Mouse 6-propyl-2-thiouracil decreases expression ISO RGD:1564043 6480464 Propylthiouracil results in decreased expression of SUSD4 mRNA CTD PMID:24780913 Susd4 Mouse aflatoxin B1 decreases expression ISO RGD:1605987 6480464 Aflatoxin B1 results in decreased expression of SUSD4 mRNA CTD PMID:22100608 Susd4 Mouse aflatoxin B1 increases methylation ISO RGD:1605987 6480464 Aflatoxin B1 results in increased methylation of SUSD4 intron CTD PMID:30157460 Susd4 Mouse aflatoxin M1 decreases expression ISO RGD:1605987 6480464 Aflatoxin M1 results in decreased expression of SUSD4 mRNA CTD PMID:30928695 Susd4 Mouse aristolochic acid A decreases expression ISO RGD:1605987 6480464 aristolochic acid I results in decreased expression of SUSD4 mRNA CTD PMID:33212167 Susd4 Mouse arsenous acid increases expression ISO RGD:1605987 6480464 Arsenic Trioxide results in increased expression of SUSD4 mRNA CTD PMID:34108876 Susd4 Mouse atrazine affects methylation ISO RGD:1564043 6480464 Atrazine affects the methylation of SUSD4 gene CTD PMID:28931070|PMID:35440735 Susd4 Mouse benzo[a]pyrene decreases expression ISO RGD:1605987 6480464 Benzo(a)pyrene results in decreased expression of SUSD4 mRNA CTD PMID:20498004|PMID:32234424 Susd4 Mouse benzo[a]pyrene affects methylation ISO RGD:1605987 6480464 Benzo(a)pyrene affects the methylation of SUSD4 exon CTD PMID:30157460 Susd4 Mouse benzo[a]pyrene increases methylation ISO RGD:1605987 6480464 Benzo(a)pyrene results in increased methylation of SUSD4 promoter CTD PMID:27901495 Susd4 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SUSD4 mRNA CTD PMID:23735875 Susd4 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of SUSD4 mRNA CTD PMID:22228805 Susd4 Mouse benzo[b]fluoranthene increases expression EXP 6480464 benzo(b)fluoranthene results in increased expression of SUSD4 mRNA CTD PMID:26377693 Susd4 Mouse Benzo[k]fluoranthene decreases expression EXP 6480464 benzo(k)fluoranthene results in decreased expression of SUSD4 mRNA CTD PMID:26377693 Susd4 Mouse bisphenol A decreases expression ISO RGD:1564043 6480464 bisphenol A results in decreased expression of SUSD4 mRNA CTD PMID:25181051|PMID:30816183|PMID:34947998 Susd4 Mouse bisphenol A multiple interactions ISO RGD:1564043 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Susd4 Mouse bisphenol A decreases expression ISO RGD:1605987 6480464 bisphenol A results in decreased expression of SUSD4 protein CTD PMID:33376534 Susd4 Mouse bisphenol A increases methylation ISO RGD:1564043 6480464 bisphenol A results in increased methylation of SUSD4 gene CTD PMID:28505145 Susd4 Mouse bisphenol F multiple interactions ISO RGD:1564043 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Susd4 Mouse bortezomib decreases expression ISO RGD:1605987 6480464 Bortezomib results in decreased expression of SUSD4 mRNA CTD PMID:20977926 Susd4 Mouse butanal increases expression ISO RGD:1605987 6480464 butyraldehyde results in increased expression of SUSD4 mRNA CTD PMID:26079696 Susd4 Mouse cadmium dichloride increases expression ISO RGD:1605987 6480464 Cadmium Chloride results in increased expression of SUSD4 mRNA CTD PMID:26472689|PMID:38568856 Susd4 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon analog results in decreased expression of SUSD4 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681|PMID:25620056 Susd4 Mouse clothianidin increases expression ISO RGD:1605987 6480464 clothianidin results in increased expression of SUSD4 mRNA CTD PMID:31626844 Susd4 Mouse diarsenic trioxide increases expression ISO RGD:1605987 6480464 Arsenic Trioxide results in increased expression of SUSD4 mRNA CTD PMID:34108876 Susd4 Mouse doxorubicin decreases expression ISO RGD:1605987 6480464 Doxorubicin results in decreased expression of SUSD4 mRNA CTD PMID:29803840 Susd4 Mouse epoxiconazole decreases expression EXP 6480464 epoxiconazole results in decreased expression of SUSD4 mRNA CTD PMID:35436446 Susd4 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of SUSD4 mRNA CTD PMID:30319688 Susd4 Mouse fenthion increases expression EXP 6480464 Fenthion results in increased expression of SUSD4 mRNA CTD PMID:34813904 Susd4 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of SUSD4 mRNA CTD PMID:25629700 Susd4 Mouse furan increases methylation ISO RGD:1564043 6480464 furan results in increased methylation of SUSD4 gene CTD PMID:22079235 Susd4 Mouse gentamycin decreases expression ISO RGD:1564043 6480464 Gentamicins results in decreased expression of SUSD4 mRNA CTD PMID:33387578 Susd4 Mouse lead(0) affects expression ISO RGD:1605987 6480464 Lead affects the expression of SUSD4 mRNA CTD PMID:28903495 Susd4 Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of SUSD4 mRNA CTD PMID:34813904 Susd4 Mouse methoxychlor affects methylation ISO RGD:1564043 6480464 Methoxychlor affects the methylation of SUSD4 gene CTD PMID:35440735 Susd4 Mouse N-methyl-4-phenylpyridinium increases expression ISO RGD:1564043 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SUSD4 mRNA CTD PMID:28801915 Susd4 Mouse O-methyleugenol decreases expression ISO RGD:1605987 6480464 methyleugenol results in decreased expression of SUSD4 mRNA CTD PMID:32234424 Susd4 Mouse okadaic acid increases expression ISO RGD:1605987 6480464 Okadaic Acid results in increased expression of SUSD4 mRNA CTD PMID:38832940 Susd4 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of SUSD4 mRNA CTD PMID:17562736 Susd4 Mouse paracetamol increases expression ISO RGD:1605987 6480464 Acetaminophen results in increased expression of SUSD4 mRNA CTD PMID:26690555 Susd4 Mouse paraquat decreases expression ISO RGD:1564043 6480464 Paraquat results in decreased expression of SUSD4 mRNA CTD PMID:32680482 Susd4 Mouse PCB138 multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Susd4 Mouse perfluorohexanesulfonic acid decreases expression ISO RGD:1605987 6480464 perfluorohexanesulfonic acid results in decreased expression of SUSD4 mRNA CTD PMID:25812627 Susd4 Mouse perfluorononanoic acid decreases expression ISO RGD:1605987 6480464 perfluoro-n-nonanoic acid results in decreased expression of SUSD4 mRNA CTD PMID:25812627 Susd4 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SUSD4 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Susd4 Mouse perfluorooctane-1-sulfonic acid decreases expression ISO RGD:1605987 6480464 perfluorooctane sulfonic acid results in decreased expression of SUSD4 mRNA CTD PMID:25812627 Susd4 Mouse perfluorooctanoic acid decreases expression ISO RGD:1605987 6480464 perfluorooctanoic acid results in decreased expression of SUSD4 mRNA CTD PMID:25812627 Susd4 Mouse phenobarbital multiple interactions EXP 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of SUSD4 mRNA] CTD PMID:19482888 Susd4 Mouse phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of SUSD4 mRNA CTD PMID:19270015|PMID:19482888|PMID:23091169 Susd4 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of SUSD4 mRNA CTD PMID:20813756 Susd4 Mouse propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of SUSD4 mRNA CTD PMID:21278054 Susd4 Mouse silicon dioxide decreases expression ISO RGD:1605987 6480464 Silicon Dioxide analog results in decreased expression of SUSD4 mRNA CTD PMID:25895662 Susd4 Mouse silicon dioxide increases expression ISO RGD:1605987 6480464 Silicon Dioxide results in increased expression of SUSD4 mRNA CTD PMID:34973136 Susd4 Mouse sodium arsenite multiple interactions ISO RGD:1605987 6480464 sodium arsenite results in decreased expression of and affects the splicing of SUSD4 mRNA CTD PMID:25879800 Susd4 Mouse sodium arsenite increases expression ISO RGD:1605987 6480464 sodium arsenite results in increased expression of SUSD4 mRNA CTD PMID:34032870|PMID:38568856 Susd4 Mouse testosterone increases expression EXP 6480464 Testosterone results in increased expression of SUSD4 mRNA CTD PMID:20844152 Susd4 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SUSD4 mRNA CTD PMID:27339419|PMID:29987408|PMID:31919559 Susd4 Mouse tetrachloromethane multiple interactions ISO RGD:1564043 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SUSD4 mRNA] CTD PMID:31150632 Susd4 Mouse tetrachloromethane decreases expression ISO RGD:1564043 6480464 Carbon Tetrachloride results in decreased expression of SUSD4 mRNA CTD PMID:31150632 Susd4 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of SUSD4 mRNA CTD PMID:33045310 Susd4 Mouse valproic acid decreases methylation ISO RGD:1605987 6480464 Valproic Acid results in decreased methylation of SUSD4 gene CTD PMID:29154799 Susd4 Mouse valproic acid increases expression ISO RGD:1605987 6480464 Valproic Acid results in increased expression of SUSD4 mRNA CTD PMID:19101580|PMID:24383497|PMID:28001369|PMID:29154799 Susd4 Mouse valproic acid affects expression ISO RGD:1605987 6480464 Valproic Acid affects the expression of SUSD4 mRNA CTD PMID:25979313
(+)-schisandrin B (ISO) (1->4)-beta-D-glucan (EXP) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (EXP) 1,2-dichloroethane (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (EXP) 6-propyl-2-thiouracil (ISO) aflatoxin B1 (ISO) aflatoxin M1 (ISO) aristolochic acid A (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP) Benzo[k]fluoranthene (EXP) bisphenol A (ISO) bisphenol F (ISO) bortezomib (ISO) butanal (ISO) cadmium dichloride (ISO) carbon nanotube (EXP) clothianidin (ISO) diarsenic trioxide (ISO) doxorubicin (ISO) epoxiconazole (EXP) ethanol (EXP) fenthion (EXP) folic acid (EXP) furan (ISO) gentamycin (ISO) lead(0) (ISO) methidathion (EXP) methoxychlor (ISO) N-methyl-4-phenylpyridinium (ISO) O-methyleugenol (ISO) okadaic acid (ISO) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (EXP) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) pirinixic acid (EXP) propiconazole (EXP) silicon dioxide (ISO) sodium arsenite (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) triptonide (EXP) valproic acid (ISO)
Susd4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 182,591,609 - 182,724,161 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 182,591,425 - 182,724,156 (+) Ensembl GRCm39 Ensembl GRCm38 1 182,764,044 - 182,896,596 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 182,763,860 - 182,896,591 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 184,695,037 - 184,825,785 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 184,601,581 - 184,732,329 (+) NCBI MGSCv36 mm8 Celera 1 189,807,460 - 189,939,824 (+) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 85.94 NCBI
SUSD4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 223,220,831 - 223,365,235 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 223,220,819 - 223,364,233 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 223,394,173 - 223,537,518 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 221,460,784 - 221,604,167 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 196,613,537 - 196,756,905 (-) NCBI Celera Cytogenetic Map 1 q41 NCBI HuRef 1 194,069,335 - 194,212,677 (-) NCBI HuRef CHM1_1 1 224,667,308 - 224,810,684 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 222,458,935 - 222,603,343 (-) NCBI T2T-CHM13v2.0
Susd4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 96,982,867 - 97,109,419 (+) NCBI GRCr8 mRatBN7.2 13 94,455,180 - 94,577,773 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 94,455,165 - 94,577,750 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 96,960,744 - 97,082,219 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 98,360,678 - 98,482,134 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 95,542,859 - 95,664,303 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 101,181,932 - 101,307,912 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 101,181,994 - 101,307,908 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 106,115,242 - 106,237,600 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 98,831,087 - 98,950,911 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 93,985,798 - 94,106,161 (+) NCBI Celera Cytogenetic Map 13 q26 NCBI
Susd4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955520 1,444,618 - 1,523,260 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955520 1,444,618 - 1,523,214 (+) NCBI ChiLan1.0 ChiLan1.0
SUSD4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 25,948,047 - 26,091,295 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 25,904,075 - 26,047,330 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 198,899,771 - 199,043,215 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 203,911,484 - 204,055,677 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 203,911,484 - 204,054,448 (-) Ensembl panpan1.1 panPan2
SUSD4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 23,640,882 - 23,685,288 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 23,639,616 - 23,685,304 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 23,666,708 - 23,712,014 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 23,811,029 - 23,857,829 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 23,810,572 - 23,857,853 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 23,554,411 - 23,602,414 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 24,105,361 - 24,152,794 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 24,508,468 - 24,554,928 (+) NCBI UU_Cfam_GSD_1.0
Susd4
SUSD4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 19,421,565 - 19,551,840 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 19,420,680 - 19,551,941 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 21,915,159 - 22,050,057 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SUSD4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 6,184,878 - 6,327,156 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 6,258,265 - 6,325,793 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 6,415,732 - 6,557,241 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Susd4
.
Predicted Target Of
Count of predictions: 922 Count of miRNA genes: 517 Interacting mature miRNAs: 580 Transcripts: ENSMUST00000085724, ENSMUST00000153348, ENSMUST00000155229 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 4142389 Scfr1_m stem cell frequency regulator 1 (mouse) Not determined 171632048 189303617 Mouse 1300888 Berr1_m berghei resistance locus 1 (mouse) Not determined 1 164143227 190534272 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1302023 Orch4_m autoimmune orchitis resistance 4 (mouse) Not determined 1 175211318 195154279 Mouse 1301385 Radpf2_m radiation pulmonary fibrosis 2 (mouse) Not determined 1 147125258 182873798 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 4141346 Skmw12_m skeletal muscle weight 12 (mouse) Not determined 150756737 184756922 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357620 Aaj1_m anxiety in A/J 1 (mouse) Not determined 1 180832317 191851043 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1301309 Emo1_m emotionality 1 (mouse) Not determined 1 162977097 185994196 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 11532690 Sluc37_m susceptibility to lung cancer 37 (mouse) 1 175468817 194111528 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1301333 Mop3_m morphine preference 3 (mouse) Not determined 1 167756737 189303617 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 12792983 Liq1_m limb inflammation QTL 1 (mouse) 1 167586086 191225397 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 1357692 Axtq1_m anxiety QTL 1 (mouse) Not determined 1 180832317 191851043 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse
AI848994
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 182,896,232 - 182,896,372 UniSTS GRCm38 MGSCv37 1 184,826,363 - 184,826,503 UniSTS GRCm37 Celera 1 189,940,402 - 189,940,542 UniSTS Cytogenetic Map 1 H5 UniSTS Whitehead/MRC_RH 1 2279.96 UniSTS
RH125047
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 H5 UniSTS
N28096
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 182,887,333 - 182,887,500 UniSTS GRCm38 MGSCv37 1 184,817,464 - 184,817,631 UniSTS GRCm37 Celera 1 189,931,244 - 189,931,411 UniSTS Cytogenetic Map 1 H5 UniSTS Whitehead_YAC 1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000085724 ⟹ ENSMUSP00000082873
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 182,592,460 - 182,724,156 (+) Ensembl GRCm38.p6 Ensembl 1 182,764,895 - 182,896,591 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000153348 ⟹ ENSMUSP00000119488
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 182,591,577 - 182,722,797 (+) Ensembl GRCm38.p6 Ensembl 1 182,764,012 - 182,895,232 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000155229 ⟹ ENSMUSP00000142330
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 182,591,425 - 182,681,605 (+) Ensembl GRCm38.p6 Ensembl 1 182,763,860 - 182,854,040 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000193660 ⟹ ENSMUSP00000141794
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 182,591,960 - 182,660,793 (+) Ensembl GRCm38.p6 Ensembl 1 182,764,395 - 182,833,228 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000194981 ⟹ ENSMUSP00000141475
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 182,592,121 - 182,660,819 (+) Ensembl GRCm38.p6 Ensembl 1 182,764,556 - 182,833,254 (+) Ensembl
RefSeq Acc Id:
NM_001356461 ⟹ NP_001343390
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 182,591,781 - 182,724,156 (+) NCBI GRCm38 1 182,764,216 - 182,896,591 (+) NCBI
Sequence:
GGTGTAGCCCGGCAGCCGCCGAGGCTTCCGTCTCGCTCGCTCGCTCGCTCCTCTGTCTTGCTCGCTCGCTCGCTTGCTTGCTCGCGCAGAGGCGGCAGCAGAGGTCGCGCACAGATGCGGGTTAGACT
hide sequence
RefSeq Acc Id:
NM_001356462 ⟹ NP_001343391
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 182,591,609 - 182,724,156 (+) NCBI GRCm38 1 182,764,044 - 182,896,591 (+) NCBI
Sequence:
TCCCGCGCGCGCCCGGGCCTCGTCCCTTCCTCCCCCTCTCCGCGCCGCCGCCGCGCGCTCCCGAGCTCAGACTCTCGCAAGCTGGATGCCCTCTGTGGATGAAAGATGTATCATGGAATGAACCCGAG
hide sequence
RefSeq Acc Id:
NM_001356463 ⟹ NP_001343392
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 182,592,461 - 182,724,156 (+) NCBI GRCm38 1 182,764,896 - 182,896,591 (+) NCBI
Sequence:
GATGGAGCCCGCAAAGCCCAGGCACCGGGCCCCCAGGGTGGAGGAGGGAGAGCTTGGCCCCAGAGCCCGGGCAACCCCGGGGTATTGTCGTGTTCCGCTCCTGGTTGCAGACTCTCGCAAGCTGGATG
hide sequence
RefSeq Acc Id:
NM_001356464 ⟹ NP_001343393
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 182,591,781 - 182,724,156 (+) NCBI GRCm38 1 182,764,216 - 182,896,591 (+) NCBI
Sequence:
GGTGTAGCCCGGCAGCCGCCGAGGCTTCCGTCTCGCTCGCTCGCTCGCTCCTCTGTCTTGCTCG
hide sequence
RefSeq Acc Id:
NM_144796 ⟹ NP_659045
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 182,592,461 - 182,724,156 (+) NCBI GRCm38 1 182,764,896 - 182,896,591 (+) NCBI MGSCv37 1 184,695,037 - 184,825,785 (+) RGD Celera 1 189,807,460 - 189,939,824 (+) RGD cM Map 1 ENTREZGENE
Sequence:
GATGGAGCCCGCAAAGCCCAGGCACCGGGCCCCCAGGGTGGAGGAGGGAGAGCTTGGCCCCAGA
hide sequence
RefSeq Acc Id:
XM_006497063 ⟹ XP_006497126
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 182,591,981 - 182,724,161 (+) NCBI GRCm38 1 182,764,416 - 182,896,596 (+) NCBI
Sequence:
AGGGGCTTGCCTGCCCCGGGGAGGCGTGCGCAGGCCGGGCTGGGCGAGTTGGCTCCTGGCTCAGCTCCCCTAAGGGAGGAATTTTTAAAATAAAAATAACAGCTCAGATTTCATAAGGGACTGGGGCA
hide sequence
RefSeq Acc Id:
XM_030243823 ⟹ XP_030099683
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 182,591,960 - 182,724,161 (+) NCBI GRCm38 1 182,764,395 - 182,896,596 (+) NCBI
Sequence:
AGGTAAGAGCCGGAGCCCGGAAGGGGCTTGCCTGCCCCGGGGAGGCGTGCGCAGGCCGGGCTGGGCGAGTTGGCTCCTGGCTCAGCTCCCCTAAGGGAGGAATTTTTAAAATAAAAATAACAGCTCAG
hide sequence
RefSeq Acc Id:
XM_030243824 ⟹ XP_030099684
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 182,591,666 - 182,724,161 (+) NCBI GRCm38 1 182,764,120 - 182,896,596 (+) NCBI
Sequence:
CTCCCGAGCTCAGGTAGCGGGCGCGCGCAGCCCGGCAGCCGTGGCCCTCGTCACCCCCGCCCCC
hide sequence
RefSeq Acc Id:
NP_659045 ⟸ NM_144796
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q8VC43 (UniProtKB/Swiss-Prot), Q8BH32 (UniProtKB/Swiss-Prot)
- Sequence:
MYHGMNPSNGDGFLEQQLQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLNVCADPGVPENGFRTPSGGVFFESSVTRFHCQDGFRLKGSTKRLCMKHFNGTLGWVPSDKPVCIQEDCRIPQIE
hide sequence
RefSeq Acc Id:
XP_006497126 ⟸ XM_006497063
- Peptide Label:
isoform X1
- UniProtKB:
Q8BH32 (UniProtKB/Swiss-Prot)
- Sequence:
MYHGMNPSNGDGFLEQQLQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLNVCADPGVPENGFRTPSGGVFFESSVTRFHCQDGFRLKGSTKRLCMKHFNGTLGWVPSDKPVCIQEDCRIPQIE
hide sequence
RefSeq Acc Id:
NP_001343391 ⟸ NM_001356462
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q8VC43 (UniProtKB/Swiss-Prot), Q8BH32 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_030099684 ⟸ XM_030243824
- Peptide Label:
isoform X3
RefSeq Acc Id:
NP_001343393 ⟸ NM_001356464
- Peptide Label:
isoform 2 precursor
RefSeq Acc Id:
NP_001343390 ⟸ NM_001356461
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q8VC43 (UniProtKB/Swiss-Prot), Q8BH32 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_030099683 ⟸ XM_030243823
- Peptide Label:
isoform X2
- UniProtKB:
Q8VC43 (UniProtKB/Swiss-Prot), Q8BH32 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001343392 ⟸ NM_001356463
- Peptide Label:
isoform 2 precursor
Ensembl Acc Id:
ENSMUSP00000082873 ⟸ ENSMUST00000085724
Ensembl Acc Id:
ENSMUSP00000141794 ⟸ ENSMUST00000193660
Ensembl Acc Id:
ENSMUSP00000119488 ⟸ ENSMUST00000153348
Ensembl Acc Id:
ENSMUSP00000142330 ⟸ ENSMUST00000155229
Ensembl Acc Id:
ENSMUSP00000141475 ⟸ ENSMUST00000194981
RGD ID: 6875980 Promoter ID: EPDNEW_M1441 Type: single initiation site Name: Susd4_1 Description: Mus musculus sushi domain containing 4 , transcript variant 1,mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 182,765,004 - 182,765,064 EPDNEW
RGD ID: 6818563 Promoter ID: MM_KWN:3194 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney, Lung Transcripts: ENSMUST00000048739, OTTMUST00000066786, OTTMUST00000067235, OTTMUST00000067236 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 184,693,754 - 184,694,254 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-21
Susd4
sushi domain containing 4
AI848994
expressed sequence AI848994
Symbol and/or name change
5135510 APPROVED
2024-08-21
AI848994
expressed sequence AI848994
Susd4
sushi domain containing 4
Symbol and/or name change
5135510 APPROVED
