Symbol:
Myl1
Name:
myosin, light polypeptide 1
RGD ID:
1557603
MGI Page
MGI
Description:
Predicted to be a structural constituent of muscle. Predicted to be involved in cardiac muscle contraction. Predicted to be located in myofibril. Predicted to be part of myosin II complex. Predicted to be active in contractile muscle fiber. Is expressed in several structures, including diaphragm; embryo mesenchyme; eye; heart; and skeletal musculature. Human ortholog(s) of this gene implicated in congenital myopathy 14. Orthologous to human MYL1 (myosin light chain 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A1 catalytic; A2 catalytic; AI325107; atrial, embryonic; D12Mgi4; MLC1; MLC1/MLC3; MLC1f; MLC1F/MLC3F; MLC3; MLC3f; Myl; Mylf; myosin light chain 1/3, skeletal muscle isoform; myosin light chain A1/A2; myosin light chain alkali 1/2; myosin light chain, alkali, fast skeletal muscle; myosin, light polypeptide 1, alkali; myosin, light polypeptide 1, alkali, atrial, embryonic; myosin, light polypeptide 4, alkali; myosin, light polypeptide 4, alkali, atrial, embryonic
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MYL1 (myosin light chain 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Myl1 (myosin, light chain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Myl1 (myosin light chain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MYL1 (myosin light chain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MYL1 (myosin light chain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Myl1 (myosin light chain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MYL1 (myosin light chain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MYL1 (myosin light chain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Myl1 (myosin light chain 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
MYL1 (myosin light chain 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Myl1 (myosin, light chain 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mylz3 (myosin, light polypeptide 3, skeletal muscle)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
myl1 (myosin, light chain 1, alkali; skeletal, fast)
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
MLC1
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Mlc-c
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
mlc-5
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
mlc-7
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
mlc-3
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
myl1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Related Pseudogenes:
Mylf-ps
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 66,963,454 - 66,987,091 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 66,963,454 - 66,984,563 (-) Ensembl GRCm39 Ensembl GRCm38 1 66,924,295 - 66,947,932 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 66,924,295 - 66,945,404 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 66,970,869 - 66,991,630 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 66,857,506 - 66,878,240 (-) NCBI MGSCv36 mm8 Celera 1 67,442,110 - 67,462,688 (-) NCBI Celera Cytogenetic Map 1 C3 NCBI cM Map 1 33.71 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Myl1 Mouse (R)-noradrenaline increases phosphorylation ISO MYL1 (Homo sapiens) 6480464 Norepinephrine results in increased phosphorylation of MYL1 protein CTD PMID:37963515 Myl1 Mouse (R)-noradrenaline multiple interactions ISO MYL1 (Homo sapiens) 6480464 PRKD1 protein affects the reaction [Norepinephrine results in increased phosphorylation of MYL1 protein] CTD PMID:37963515 Myl1 Mouse (R)-noradrenaline multiple interactions ISO Myl1 (Rattus norvegicus) 6480464 chelerythrine inhibits the reaction [Norepinephrine results in increased phosphorylation of MYL1 protein] more ... CTD PMID:37963515 Myl1 Mouse (R)-noradrenaline increases phosphorylation ISO Myl1 (Rattus norvegicus) 6480464 Norepinephrine results in increased phosphorylation of MYL1 protein CTD PMID:37963515 Myl1 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of MYL1 mRNA] CTD PMID:22206623 Myl1 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of MYL1 mRNA CTD PMID:22206623 Myl1 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of MYL1 mRNA CTD PMID:17555576 Myl1 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of MYL1 mRNA CTD PMID:17942748 Myl1 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MYL1 mRNA CTD PMID:17942748 Myl1 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MYL1 mRNA CTD PMID:19484750 Myl1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MYL1 mRNA CTD PMID:17942748 Myl1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Myl1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MYL1 mRNA CTD PMID:32109520 Myl1 Mouse 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Myl1 (Rattus norvegicus) 6480464 3 more ... CTD PMID:32119087 Myl1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of MYL1 mRNA CTD PMID:30951980 Myl1 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of MYL1 gene CTD PMID:31683443 Myl1 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of MYL1 mRNA CTD PMID:34850234 Myl1 Mouse 6-propyl-2-thiouracil increases expression ISO Myl1 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of MYL1 mRNA CTD PMID:24780913 Myl1 Mouse acrylamide decreases expression ISO Myl1 (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of MYL1 mRNA CTD PMID:22197712 and PMID:28606764 Myl1 Mouse aflatoxin B1 decreases methylation ISO MYL1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MYL1 gene CTD PMID:27153756 Myl1 Mouse alpha-Zearalanol decreases expression ISO Myl1 (Rattus norvegicus) 6480464 Zeranol results in decreased expression of MYL1 mRNA CTD PMID:35163327 Myl1 Mouse alpha-Zearalanol multiple interactions ISO Myl1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MYL1 mRNA CTD PMID:35163327 Myl1 Mouse ammonium chloride affects expression ISO Myl1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of MYL1 mRNA CTD PMID:16483693 Myl1 Mouse arsane decreases expression EXP 6480464 Arsenic results in decreased expression of MYL1 protein CTD PMID:22552367 Myl1 Mouse arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of MYL1 protein CTD PMID:22552367 Myl1 Mouse Azoxymethane multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MYL1 mRNA CTD PMID:29950665 Myl1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of MYL1 mRNA CTD PMID:22228805 Myl1 Mouse benzo[a]pyrene affects methylation ISO MYL1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MYL1 3' UTR CTD PMID:27901495 Myl1 Mouse benzo[b]fluoranthene decreases expression EXP 6480464 benzo(b)fluoranthene results in decreased expression of MYL1 mRNA CTD PMID:26377693 Myl1 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of MYL1 mRNA CTD PMID:28085963 Myl1 Mouse bisphenol A decreases expression ISO Myl1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of MYL1 mRNA CTD PMID:25181051 and PMID:27178563 Myl1 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MYL1 mRNA CTD PMID:24465770 more ... Myl1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of MYL1 mRNA CTD PMID:30951980 Myl1 Mouse cadmium atom decreases expression ISO Myl1 (Rattus norvegicus) 6480464 Cadmium results in decreased expression of MYL1 mRNA CTD PMID:17327700 Myl1 Mouse cadmium dichloride decreases expression ISO Myl1 (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of MYL1 mRNA CTD PMID:17327700 Myl1 Mouse capsaicin multiple interactions ISO Myl1 (Rattus norvegicus) 6480464 Capsaicin inhibits the reaction [Dietary Fats results in decreased expression of MYL1 protein] CTD PMID:20359164 Myl1 Mouse carbofuran increases expression ISO Myl1 (Rattus norvegicus) 6480464 Carbofuran results in increased expression of MYL1 protein CTD PMID:19854236 Myl1 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon analog results in decreased expression of MYL1 mRNA CTD PMID:25620056 Myl1 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of MYL1 mRNA CTD PMID:25620056 Myl1 Mouse CGP 52608 multiple interactions ISO MYL1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MYL1 gene] CTD PMID:28238834 Myl1 Mouse chelerythrine multiple interactions ISO Myl1 (Rattus norvegicus) 6480464 chelerythrine inhibits the reaction [Norepinephrine results in increased phosphorylation of MYL1 protein] CTD PMID:37963515 Myl1 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of MYL1 mRNA CTD PMID:34289071 Myl1 Mouse ciguatoxin CTX1B affects expression EXP 6480464 Ciguatoxins affects the expression of MYL1 mRNA CTD PMID:18353800 Myl1 Mouse clozapine increases expression ISO MYL1 (Homo sapiens) 6480464 Clozapine results in increased expression of MYL1 protein CTD PMID:34122009 Myl1 Mouse deguelin decreases expression ISO MYL1 (Homo sapiens) 6480464 deguelin results in decreased expression of MYL1 mRNA CTD PMID:33512557 Myl1 Mouse dexamethasone increases expression ISO Myl1 (Rattus norvegicus) 6480464 Dexamethasone results in increased expression of MYL1 mRNA CTD PMID:14618091 Myl1 Mouse dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of MYL1 protein CTD PMID:33567340 Myl1 Mouse dextran sulfate multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MYL1 mRNA CTD PMID:29950665 Myl1 Mouse diuron decreases expression ISO Myl1 (Rattus norvegicus) 6480464 Diuron results in decreased expression of MYL1 mRNA CTD PMID:25152437 Myl1 Mouse doxorubicin increases expression ISO Myl1 (Rattus norvegicus) 6480464 Doxorubicin results in increased expression of MYL1 mRNA CTD PMID:19915844 Myl1 Mouse doxorubicin multiple interactions ISO Myl1 (Rattus norvegicus) 6480464 Razoxane inhibits the reaction [Doxorubicin results in increased expression of MYL1 mRNA] CTD PMID:19915844 Myl1 Mouse fasudil multiple interactions ISO Myl1 (Rattus norvegicus) 6480464 fasudil inhibits the reaction [Norepinephrine results in increased phosphorylation of MYL1 protein] CTD PMID:37963515 Myl1 Mouse fenthion increases expression EXP 6480464 Fenthion results in increased expression of MYL1 mRNA CTD PMID:34813904 Myl1 Mouse folic acid multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of MYL1 mRNA] CTD PMID:22206623 Myl1 Mouse graphite increases expression EXP 6480464 Graphite results in increased expression of MYL1 mRNA CTD PMID:27440207 Myl1 Mouse Indeno[1,2,3-cd]pyrene decreases expression EXP 6480464 indeno(1 more ... CTD PMID:26377693 Myl1 Mouse isoprenaline increases expression ISO Myl1 (Rattus norvegicus) 6480464 Isoproterenol results in increased expression of MYL1 protein CTD PMID:19854236 Myl1 Mouse ivermectin decreases expression ISO MYL1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MYL1 protein CTD PMID:32959892 Myl1 Mouse methanol increases expression ISO Myl1 (Rattus norvegicus) 6480464 Methanol results in increased expression of MYL1 protein CTD PMID:22257634 Myl1 Mouse methotrexate affects expression EXP 6480464 Methotrexate affects the expression of MYL1 mRNA CTD PMID:18502557 Myl1 Mouse methylmercury chloride increases expression ISO MYL1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of MYL1 mRNA CTD PMID:34089799 Myl1 Mouse milrinone increases expression ISO Myl1 (Rattus norvegicus) 6480464 Milrinone results in increased expression of MYL1 mRNA CTD PMID:22936366 Myl1 Mouse N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions EXP 6480464 MYBPC3 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of MYL1 mRNA] CTD PMID:25566086 Myl1 Mouse N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of MYL1 mRNA CTD PMID:25566086 Myl1 Mouse N-methyl-4-phenylpyridinium increases expression ISO MYL1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of MYL1 mRNA CTD PMID:24810058 Myl1 Mouse nickel subsulfide increases expression ISO Myl1 (Rattus norvegicus) 6480464 nickel subsulfide results in increased expression of MYL1 mRNA CTD PMID:21086188 Myl1 Mouse nickel sulfate increases expression EXP 6480464 nickel sulfate results in increased expression of MYL1 mRNA CTD PMID:16166746 Myl1 Mouse ozone decreases expression EXP 6480464 Ozone results in decreased expression of MYL1 mRNA CTD PMID:12763052 Myl1 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of MYL1 mRNA CTD PMID:34911549 Myl1 Mouse perfluorooctanoic acid multiple interactions ISO Myl1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MYL1 mRNA CTD PMID:35163327 Myl1 Mouse perfluorooctanoic acid increases expression ISO Myl1 (Rattus norvegicus) 6480464 perfluorooctanoic acid results in increased expression of MYL1 mRNA CTD PMID:35163327 Myl1 Mouse permethrin decreases expression ISO MYL1 (Homo sapiens) 6480464 Permethrin results in decreased expression of MYL1 mRNA CTD PMID:37047231 Myl1 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of MYL1 mRNA CTD PMID:23091169 Myl1 Mouse phenylephrine increases expression ISO Myl1 (Rattus norvegicus) 6480464 Phenylephrine results in increased expression of MYL1 mRNA CTD PMID:18158353 Myl1 Mouse pioglitazone multiple interactions EXP 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of MYL1 mRNA CTD PMID:27935865 Myl1 Mouse progesterone increases expression ISO Myl1 (Rattus norvegicus) 6480464 Progesterone results in increased expression of MYL1 mRNA CTD PMID:20726854 Myl1 Mouse razoxane multiple interactions ISO Myl1 (Rattus norvegicus) 6480464 Razoxane inhibits the reaction [Doxorubicin results in increased expression of MYL1 mRNA] CTD PMID:19915844 Myl1 Mouse resveratrol increases expression ISO Myl1 (Rattus norvegicus) 6480464 resveratrol results in increased expression of MYL1 mRNA CTD PMID:25905778 Myl1 Mouse scoparone decreases phosphorylation ISO MYL1 (Homo sapiens) 6480464 scoparone results in decreased phosphorylation of MYL1 protein CTD PMID:37449671 Myl1 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of MYL1 mRNA CTD PMID:37682722 Myl1 Mouse sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of MYL1 mRNA CTD PMID:22155349 Myl1 Mouse sodium fluoride decreases expression ISO Myl1 (Rattus norvegicus) 6480464 Sodium Fluoride results in decreased expression of MYL1 protein CTD PMID:29653260 Myl1 Mouse spermine increases expression EXP 6480464 Spermine results in increased expression of MYL1 mRNA CTD PMID:18673383 Myl1 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of MYL1 mRNA CTD PMID:17555576 Myl1 Mouse Tanshinone I increases expression ISO MYL1 (Homo sapiens) 6480464 tanshinone results in increased expression of MYL1 mRNA CTD PMID:15849732 Myl1 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of MYL1 mRNA CTD PMID:23557971 and PMID:35295148 Myl1 Mouse titanium dioxide multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MYL1 mRNA CTD PMID:29950665 Myl1 Mouse trichloroethene increases methylation ISO Myl1 (Rattus norvegicus) 6480464 Trichloroethylene results in increased methylation of MYL1 gene CTD PMID:27618143 Myl1 Mouse trichloroethene increases expression ISO Myl1 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of MYL1 mRNA CTD PMID:33387578 Myl1 Mouse triclosan increases expression ISO MYL1 (Homo sapiens) 6480464 Triclosan results in increased expression of MYL1 mRNA CTD PMID:30510588 Myl1 Mouse triticonazole increases expression ISO Myl1 (Rattus norvegicus) 6480464 triticonazole results in increased expression of MYL1 mRNA CTD PMID:36084822 Myl1 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of MYL1 mRNA CTD PMID:17963808 Myl1 Mouse valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of MYL1 mRNA CTD PMID:24896083 Myl1 Mouse zinc atom decreases expression ISO Myl1 (Rattus norvegicus) 6480464 Zinc deficiency results in decreased expression of MYL1 mRNA CTD PMID:19111725 Myl1 Mouse zinc(0) decreases expression ISO Myl1 (Rattus norvegicus) 6480464 Zinc deficiency results in decreased expression of MYL1 mRNA CTD PMID:19111725
(R)-noradrenaline (ISO) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) aflatoxin B1 (ISO) alpha-Zearalanol (ISO) ammonium chloride (ISO) arsane (EXP) arsenic atom (EXP) Azoxymethane (EXP) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium atom (ISO) cadmium dichloride (ISO) capsaicin (ISO) carbofuran (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chelerythrine (ISO) chlorpyrifos (EXP) ciguatoxin CTX1B (EXP) clozapine (ISO) deguelin (ISO) dexamethasone (EXP,ISO) dextran sulfate (EXP) diuron (ISO) doxorubicin (ISO) fasudil (ISO) fenthion (EXP) folic acid (EXP) graphite (EXP) Indeno[1,2,3-cd]pyrene (EXP) isoprenaline (ISO) ivermectin (ISO) methanol (ISO) methotrexate (EXP) methylmercury chloride (ISO) milrinone (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP) N-methyl-4-phenylpyridinium (ISO) nickel subsulfide (ISO) nickel sulfate (EXP) ozone (EXP) perfluorooctanoic acid (ISO) permethrin (ISO) phenobarbital (EXP) phenylephrine (ISO) pioglitazone (EXP) progesterone (ISO) razoxane (ISO) resveratrol (ISO) scoparone (ISO) sodium arsenite (EXP) sodium dichromate (EXP) sodium fluoride (ISO) spermine (EXP) tamoxifen (EXP) Tanshinone I (ISO) titanium dioxide (EXP) trichloroethene (ISO) triclosan (ISO) triticonazole (ISO) valproic acid (EXP) zinc atom (ISO) zinc(0) (ISO)
Myl1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 66,963,454 - 66,987,091 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 66,963,454 - 66,984,563 (-) Ensembl GRCm39 Ensembl GRCm38 1 66,924,295 - 66,947,932 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 66,924,295 - 66,945,404 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 66,970,869 - 66,991,630 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 66,857,506 - 66,878,240 (-) NCBI MGSCv36 mm8 Celera 1 67,442,110 - 67,462,688 (-) NCBI Celera Cytogenetic Map 1 C3 NCBI cM Map 1 33.71 NCBI
MYL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 210,290,150 - 210,315,174 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 210,290,150 - 210,315,174 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 211,154,874 - 211,179,898 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 210,863,113 - 210,888,140 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 210,980,382 - 210,993,845 NCBI Celera 2 204,922,877 - 204,947,923 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI HuRef 2 203,000,114 - 203,025,138 (-) NCBI HuRef CHM1_1 2 211,160,958 - 211,186,022 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 210,770,853 - 210,795,901 (-) NCBI T2T-CHM13v2.0
Myl1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl mRatBN7.2 9 68,437,514 - 68,458,256 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 68,437,517 - 68,458,261 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 76,926,694 - 76,947,188 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 82,055,627 - 82,076,116 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 80,461,970 - 80,482,459 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 73,937,820 - 73,958,480 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 73,937,823 - 73,958,480 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 73,349,226 - 73,369,886 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 65,717,097 - 65,737,576 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 9 65,916,653 - 65,937,125 (-) NCBI Celera Cytogenetic Map 9 q32 NCBI
Myl1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955457 5,146,633 - 5,168,356 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955457 5,147,443 - 5,167,587 (+) NCBI ChiLan1.0 ChiLan1.0
MYL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 112,913,613 - 112,938,932 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 112,928,593 - 112,953,912 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 97,548,013 - 97,573,336 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 215,940,808 - 215,974,852 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 215,950,087 - 215,974,852 (-) Ensembl panpan1.1 panPan2
MYL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 37 18,143,644 - 18,168,208 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 37 18,143,673 - 18,168,187 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 37 19,024,436 - 19,048,975 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 37 18,081,858 - 18,106,400 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 37 18,050,944 - 18,106,386 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 37 18,034,367 - 18,058,915 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 37 17,996,703 - 18,021,269 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 37 18,011,588 - 18,036,161 (-) NCBI UU_Cfam_GSD_1.0
Myl1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 166,612,434 - 166,632,566 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936586 5,993,098 - 6,013,994 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936586 5,993,177 - 6,013,426 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MYL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 113,036,228 - 113,063,321 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 113,038,083 - 113,051,315 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 124,861,888 - 124,875,123 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 15 q23-q26 NCBI
MYL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 96,015,186 - 96,041,862 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 96,015,034 - 96,029,160 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 103,314,602 - 103,340,346 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Myl1
.
Predicted Target Of
Count of predictions: 565 Count of miRNA genes: 391 Interacting mature miRNAs: 449 Transcripts: ENSMUST00000027151, ENSMUST00000119429, ENSMUST00000120415, ENSMUST00000150542, ENSMUST00000151328, ENSMUST00000160100 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4142015 Idd5.3_m insulin dependent diabetes susceptibility 5.3 (mouse) Not determined 66523162 70077076 Mouse 12910788 Pwgrq9_m post-weaning growth rate QTL 9 (mouse) 1 40868008 67270256 Mouse 18182931 Metl1_m metabolite locus 1, pyridoxate (mouse) 1 41275399 75275399 Mouse 12910786 Pwgrq10_m post-weaning growth rate QTL 10 (mouse) 1 40868008 67270256 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 1357721 Sle17_m systematic lupus erythematosus susceptibility 17 (mouse) Not determined 1 39132808 126445310 Mouse 1357824 Estoq4_m embryo survival total QTL 4 (mouse) Not determined 1 34760138 73976915 Mouse 14746998 Mancz1_m mandible centroid size 1 (mouse) 1 57941351 91941351 Mouse 1300746 Skl1_m skeletal size (tail length) 1 (mouse) Not determined 1 57991977 91992080 Mouse 1357488 Splq3_m spleen weight QTL 3 (mouse) Not determined 1 34760138 150193871 Mouse 10043965 Obq24_m obesity QTL 24 (mouse) Not determined 1 50890216 84890216 Mouse 1301430 Cdcs2_m cytokine deficiency colitis susceptibility 2 (mouse) Not determined 1 48892345 82892485 Mouse 1558717 Ses1a_m salmonella enteritidis susceptibility 1a (mouse) Not determined 1 56726922 90727077 Mouse 1357759 W3q12_m weight 3 weeks QTL 12 (mouse) Not determined 1 34760138 73976915 Mouse 1357753 Kidq2_m kidney weight QTL 2 (mouse) Not determined 1 34760138 150193871 Mouse 1301667 Lxw5_m lupus BXSB x NZW 5 (mouse) Not determined 1 58549191 92549443 Mouse 1558822 Vas1_m autoimmune vasitis resistance 1 (mouse) Not determined 1 48889006 82889210 Mouse 1301670 Ssta1_m susceptibility to Salmonella typhimurium antigens 1 (mouse) Not determined 1 45946755 79946882 Mouse 1357475 w3q13_m weight 3 weeks QTL 13 (mouse) Not determined 1 23109591 73976915 Mouse 1357741 Nidd5k_m Nidd5 on KK-A<y> (mouse) Not determined 1 55974948 89975057 Mouse 1301162 Skull1_m skull morphology 1 (mouse) Not determined 1 57991977 91992080 Mouse 4142467 Wbcq1_m white blood cell quantitative locus 1 (mouse) Not determined 1 56266214 90266360 Mouse 1301166 Thypr2_m thymocyte proliferative response 2 (mouse) Not determined 1 41273124 75273271 Mouse 1301933 Insq6_m insulin QTL 6 (mouse) Not determined 1 56726922 90727077 Mouse 1357524 W6q14_m weight 6 weeks QTL 14 (mouse) Not determined 1 34760138 73976915 Mouse 1301714 Vertcling_m vertical clinging (mouse) Not determined 1 42938031 76938167 Mouse 4141305 Tgq9_m triglyceride QTL 9 (mouse) Not determined 51421605 85421605 Mouse 1357651 Lgq5_m late growth QTL 5 (mouse) Not determined 1 34760138 73976915 Mouse 1301211 Bbaa11_m B.burgdorferi-associated arthritis 11 (mouse) Not determined 1 48889006 82889210 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 1558855 Eae30_m experimental allergic encephalomyelitis susceptibility 30 (mouse) Not determined 1 45417773 72975057 Mouse 1301954 Lrnx11_m learning-contextual 11 (mouse) Not determined 1 39132808 74516365 Mouse 1357505 Vtbt1_m vertebral trabecular bone trait 1 (mouse) Not determined 1 56266214 90266360 Mouse 1357506 W10q6_m weight 10 weeks QTL 6 (mouse) Not determined 1 34760138 73976915 Mouse 4141032 Wbcc1_m white blood cell count 1 (mouse) Not determined 42259667 76259667 Mouse 1301444 Alcw5_m alcohol withdrawal 5 (mouse) Not determined 1 58549191 92549443 Mouse 39128207 Lwq16_m liver weight QTL 16 (mouse) 1 34760138 73976915 Mouse 1558860 W10q7_m weight 10 weeks QTL 7 (mouse) Not determined 1 34760138 150193871 Mouse 4142307 Shali1_m survival time to hyperoxic acute lung injury 1 (mouse) Not determined 51964025 70406589 Mouse 14747009 Manh49_m mandible shape 49 (mouse) 1 57941351 91941351 Mouse 1301616 Yaa2_m Y-linked autoimmune acceleration 2 (mouse) Not determined 1 46854690 80854839 Mouse 1301748 Abbp1_m A/J and C57BL/6 blood pressure 1 (mouse) Not determined 1 62946755 120529678 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 1558905 Gct7_m granulosa cell tumorigenesis 7 (mouse) Not determined 1 47349894 81350013 Mouse 1302119 Cia15_m collagen induced arthritis 15 (mouse) Not determined 1 65889006 88496101 Mouse 12910780 Pwgrq11_m post-weaning growth rate QTL 11 (mouse) 1 40868008 67270256 Mouse 1301225 Sle7_m systematic lupus erythematosus susceptibility 7 (mouse) Not determined 1 46854690 80854839 Mouse 1300841 Ssial1_m susceptibility to sialadenitis 1 (mouse) Not determined 1 63920002 153557562 Mouse 1357679 Egrm1_m early growth rate, maternal effect 1 (mouse) Not determined 1 57991977 91992080 Mouse
RH129698
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 66,924,344 - 66,924,533 UniSTS GRCm38 MGSCv37 1 66,970,918 - 66,971,107 UniSTS GRCm37 Cytogenetic Map 1 C3 UniSTS cM Map 1 34.1 UniSTS
AI325107
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 101,221,907 - 101,221,987 UniSTS GRCm38 MGSCv37 12 102,460,117 - 102,460,197 UniSTS GRCm37 Celera 12 102,450,500 - 102,450,580 UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map 1 C3 UniSTS cM Map 1 34.1 UniSTS Whitehead/MRC_RH 12 934.83 UniSTS
D1Mit21.1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 66,946,344 - 66,946,456 UniSTS GRCm38 MGSCv37 1 66,992,918 - 66,993,030 UniSTS GRCm37 Celera 1 67,463,982 - 67,464,094 UniSTS Cytogenetic Map 1 C3 UniSTS cM Map 1 32.8 UniSTS cM Map 1 UniSTS Whitehead Genetic 1 34.2306 UniSTS Whitehead_YAC 1 UniSTS
Mylf
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 C3 UniSTS cM Map 1 34.1 UniSTS
D1Mit21
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 66,946,183 - 66,946,425 UniSTS GRCm38 MGSCv37 1 66,992,757 - 66,992,999 UniSTS GRCm37 Celera 1 67,463,815 - 67,464,063 UniSTS Cytogenetic Map 1 C3 UniSTS cM Map 1 32.8 UniSTS Whitehead Genetic 1 32.8 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000027151 ⟹ ENSMUSP00000027151
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 66,963,454 - 66,984,302 (-) Ensembl GRCm38.p6 Ensembl 1 66,924,295 - 66,945,143 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000119429 ⟹ ENSMUSP00000112861
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 66,963,457 - 66,974,513 (-) Ensembl GRCm38.p6 Ensembl 1 66,924,298 - 66,935,354 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000120415 ⟹ ENSMUSP00000112880
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 66,965,225 - 66,974,492 (-) Ensembl GRCm38.p6 Ensembl 1 66,926,066 - 66,935,333 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000150542
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 66,964,182 - 66,974,509 (-) Ensembl GRCm38.p6 Ensembl 1 66,925,023 - 66,935,350 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000151328
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 66,983,622 - 66,984,563 (-) Ensembl GRCm38.p6 Ensembl 1 66,944,463 - 66,945,404 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000160100 ⟹ ENSMUSP00000125748
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 66,965,781 - 66,984,543 (-) Ensembl GRCm38.p6 Ensembl 1 66,926,622 - 66,945,384 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000186202 ⟹ ENSMUSP00000140834
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 66,963,454 - 66,974,796 (-) Ensembl GRCm38.p6 Ensembl 1 66,924,295 - 66,935,637 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000186346
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 66,969,351 - 66,973,857 (-) Ensembl GRCm38.p6 Ensembl 1 66,930,192 - 66,934,698 (-) Ensembl
RefSeq Acc Id:
NM_001113387 ⟹ NP_001106858
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 66,963,454 - 66,974,507 (-) NCBI GRCm38 1 66,924,295 - 66,935,366 (-) NCBI MGSCv37 1 66,970,869 - 66,991,630 (-) RGD Celera 1 67,442,110 - 67,462,688 (-) RGD cM Map 1 ENTREZGENE
Sequence:
GAGAGAGGTTAAGACTCCACTCAGGGATTGGAGCTGCCTTCAGTTTATCCTCCAGCTCCACTGCTGTTTCGCAGCCTAGAACTCCATCATGTCCTTCAGTGCTGACCAGATTGCCGACTTCAAGGAGG
hide sequence
RefSeq Acc Id:
NM_001420333 ⟹ NP_001407262
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 66,963,454 - 66,984,637 (-) NCBI
RefSeq Acc Id:
NM_001420334 ⟹ NP_001407263
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 66,963,454 - 66,974,507 (-) NCBI
RefSeq Acc Id:
NM_021285 ⟹ NP_067260
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 66,963,454 - 66,984,189 (-) NCBI GRCm38 1 66,924,295 - 66,945,056 (-) NCBI MGSCv37 1 66,970,869 - 66,991,630 (-) RGD Celera 1 67,442,110 - 67,462,688 (-) RGD cM Map 1 ENTREZGENE
Sequence:
ATATGCATGCCCTTATACCATTTAACACTCTGGGTCCACCCTCCAGACGCTGGGCTGCGGGTCA
hide sequence
RefSeq Acc Id:
XM_011238451 ⟹ XP_011236753
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 66,965,225 - 66,974,541 (-) NCBI GRCm38 1 66,926,066 - 66,935,407 (-) NCBI
Sequence:
AAATAAAAGGAAGCCAGAGAGAGGTTAAGACTCCACTCAGGGATTGGAGCTGCCTTCAGTTTAT
hide sequence
RefSeq Acc Id:
XM_036162616 ⟹ XP_036018509
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 66,963,454 - 66,987,091 (-) NCBI
Sequence:
CACATCTAATTGTAACTCCAGTCCCAGGGCTTCTGACACCCTCACAGCAGACATACATGCAGGCAAAGCACCAATGAATATAAATAAAAATAAATTATGTATTAAAAAATAAAATATGCTAATCTGAG
hide sequence
RefSeq Acc Id:
XM_036162618 ⟹ XP_036018511
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 66,963,454 - 66,987,091 (-) NCBI
Sequence:
CACATCTAATTGTAACTCCAGTCCCAGGGCTTCTGACACCCTCACAGCAGACATACATGCAGGC
hide sequence
RefSeq Acc Id:
NP_067260 ⟸ NM_021285
- Peptide Label:
isoform 1f
- UniProtKB:
P05978 (UniProtKB/Swiss-Prot), P05977 (UniProtKB/Swiss-Prot), Q545T7 (UniProtKB/TrEMBL)
- Sequence:
MAPKKDVKKPAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEDFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQGGYEDFVE
hide sequence
RefSeq Acc Id:
NP_001106858 ⟸ NM_001113387
- Peptide Label:
isoform 3f
- UniProtKB:
Q545G5 (UniProtKB/TrEMBL), Q6PCW9 (UniProtKB/TrEMBL)
- Sequence:
MSFSADQIADFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKI
hide sequence
RefSeq Acc Id:
XP_011236753 ⟸ XM_011238451
- Peptide Label:
isoform X2
- UniProtKB:
E9PWG4 (UniProtKB/TrEMBL), Q6PCW9 (UniProtKB/TrEMBL)
- Sequence:
MSFSADQIADFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALL
hide sequence
Ensembl Acc Id:
ENSMUSP00000027151 ⟸ ENSMUST00000027151
Ensembl Acc Id:
ENSMUSP00000112861 ⟸ ENSMUST00000119429
Ensembl Acc Id:
ENSMUSP00000140834 ⟸ ENSMUST00000186202
Ensembl Acc Id:
ENSMUSP00000125748 ⟸ ENSMUST00000160100
Ensembl Acc Id:
ENSMUSP00000112880 ⟸ ENSMUST00000120415
RefSeq Acc Id:
XP_036018509 ⟸ XM_036162616
- Peptide Label:
isoform X1
- UniProtKB:
P05977 (UniProtKB/Swiss-Prot), P05978 (UniProtKB/Swiss-Prot), Q545T7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018511 ⟸ XM_036162618
- Peptide Label:
isoform X1
- UniProtKB:
P05977 (UniProtKB/Swiss-Prot), P05978 (UniProtKB/Swiss-Prot), Q545T7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001407262 ⟸ NM_001420333
- Peptide Label:
isoform 1f
- UniProtKB:
P05978 (UniProtKB/Swiss-Prot), P05977 (UniProtKB/Swiss-Prot), Q545T7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001407263 ⟸ NM_001420334
- Peptide Label:
isoform 3f
- UniProtKB:
Q545G5 (UniProtKB/TrEMBL), Q6PCW9 (UniProtKB/TrEMBL)
RGD ID: 6873982 Promoter ID: EPDNEW_M442 Type: multiple initiation site Name: Myl1_1 Description: Mus musculus myosin, light polypeptide 1 , transcript variant3f, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M443 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 66,935,348 - 66,935,408 EPDNEW
RGD ID: 6873984 Promoter ID: EPDNEW_M443 Type: initiation region Name: Myl1_2 Description: Mus musculus myosin, light polypeptide 1 , transcript variant3f, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M442 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 66,945,030 - 66,945,090 EPDNEW
