Advanced Search (OLGA)

Gene: Noto (notochord homeobox) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Noto

Name:

notochord homeobox

RGD ID:

1557459

MGI Page

MGI

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Acts upstream of or within several processes, including embryonic organ development; motile cilium assembly; and regulation of cilium assembly. Predicted to be located in nucleoplasm. Predicted to be active in nucleus. Is expressed in several structures, including embryo mesoderm; mesendoderm; primitive streak; and tail. Orthologous to human NOTO (notochord homeobox).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Fl; Flh; floating head homolog; homeobox protein notochord; MmN; MmNot; N; Not; Not homeodomain protein; notochord homolog; notochord homolog (Xenopus laevis); tc; truncate

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NOTO (notochord homeobox)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Noto (notochord homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Noto (notochord homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NOTO (notochord homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NOTO (notochord homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Noto (notochord homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SMYD5 (SMYD family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NOTO (notochord homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Noto (notochord homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NOTO (notochord homeobox)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Noto (notochord homeobox)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	noto (notochord homeobox)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|ZFIN)
Drosophila melanogaster (fruit fly):	CG18599	Alliance	DIOPT (Ensembl Compara\|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):	not	Alliance	DIOPT (Ensembl Compara\|OrthoFinder)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	85,400,851 - 85,405,859 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	85,400,868 - 85,405,859 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	85,423,886 - 85,428,877 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	85,423,886 - 85,428,877 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	85,373,880 - 85,378,871 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	85,389,587 - 85,393,928 (+)	NCBI		MGSCv36	mm8
Celera	6	87,395,820 - 87,400,823 (+)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI
cM Map	6	37.44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Noto	Mouse	Alstrom syndrome		ISO	NOTO (Homo sapiens)	8554872	ClinVar Annotator: match by term: Alstrom syndrome	ClinVar	PMID:28492532
Noto	Mouse	congenital disorder of glycosylation type IIb		ISO	NOTO (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital disorder of glycosylation type 2B	ClinVar	PMID:24716661 more ...
Noto	Mouse	dystonia		ISO	NOTO (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dystonia	ClinVar	PMID:16697227 more ...
Noto	Mouse	Methylmalonyl-CoA Epimerase Deficiency		ISO	NOTO (Homo sapiens)	8554872	ClinVar Annotator: match by term: METHYLMALONIC ACIDURIA III	ClinVar	PMID:16697227 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Noto	Mouse	2,3',4,4',5-Pentachlorobiphenyl	increases expression	EXP		6480464	2 more ...	CTD	PMID:31388691
Noto	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of NOTO mRNA	CTD	PMID:21570461 and PMID:24058054
Noto	Mouse	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of NOTO mRNA	CTD	PMID:30951980
Noto	Mouse	actinomycin D	multiple interactions	ISO	NOTO (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of NOTO mRNA	CTD	PMID:38460933
Noto	Mouse	amosite asbestos	decreases methylation	ISO	NOTO (Homo sapiens)	6480464	Asbestos and Amosite results in decreased methylation of NOTO promoter	CTD	PMID:29626692
Noto	Mouse	benzo[a]pyrene	affects methylation	ISO	NOTO (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of NOTO promoter	CTD	PMID:27901495
Noto	Mouse	bisphenol A	decreases expression	ISO	Noto (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of NOTO mRNA	CTD	PMID:25181051
Noto	Mouse	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of NOTO mRNA	CTD	PMID:30951980
Noto	Mouse	bisphenol A	affects methylation	EXP		6480464	bisphenol A affects the methylation of NOTO promoter	CTD	PMID:27334623
Noto	Mouse	bisphenol F	increases expression	EXP		6480464	bisphenol F results in increased expression of NOTO mRNA	CTD	PMID:30951980
Noto	Mouse	CGP 52608	multiple interactions	ISO	NOTO (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to NOTO gene]	CTD	PMID:28238834
Noto	Mouse	crocidolite asbestos	decreases methylation	ISO	NOTO (Homo sapiens)	6480464	Asbestos and Crocidolite results in decreased methylation of NOTO promoter	CTD	PMID:29626692
Noto	Mouse	folic acid	increases expression	EXP		6480464	Folic Acid results in increased expression of NOTO mRNA	CTD	PMID:25629700
Noto	Mouse	Nutlin-3	multiple interactions	ISO	NOTO (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of NOTO mRNA	CTD	PMID:38460933
Noto	Mouse	triptonide	increases expression	EXP		6480464	triptonide results in increased expression of NOTO mRNA	CTD	PMID:33045310

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Noto	Mouse	brain development	involved_in	IBA	PANTHER:PTN000678140 more ...	2290270		GO_Central	GO_REF:0000033
Noto	Mouse	central nervous system development	involved_in	IBA	PANTHER:PTN001551821 more ...	2290270		GO_Central	GO_REF:0000033
Noto	Mouse	determination of left/right symmetry	acts_upstream_of_or_within	IMP		2290270	PMID:20350929	MGI	PMID:20350929
Noto	Mouse	determination of left/right symmetry	acts_upstream_of_or_within	IMP	MGI:3053092	2290270	PMID:17884984 and PMID:22357932	MGI	PMID:17884984 and PMID:22357932
Noto	Mouse	dorsal/ventral pattern formation	acts_upstream_of_or_within	IMP	MGI:1857063	2290270	PMID:8155581	MGI	PMID:8155581
Noto	Mouse	embryonic pattern specification	acts_upstream_of_or_within	IMP	MGI:1857063	2290270	PMID:15550757	MGI	PMID:15550757
Noto	Mouse	heart looping	acts_upstream_of_or_within	IMP	MGI:3053092	2290270	PMID:17884984	MGI	PMID:17884984
Noto	Mouse	motile cilium assembly	acts_upstream_of_or_within	IGI	MGI:1347474	2290270	PMID:22357932	MGI	PMID:22357932
Noto	Mouse	neuron differentiation	involved_in	IBA	PANTHER:PTN001551821 more ...	2290270		GO_Central	GO_REF:0000033
Noto	Mouse	notochord development	acts_upstream_of_or_within	IMP	MGI:3053092	2290270	PMID:15231714 and PMID:17884984	MGI	PMID:15231714 and PMID:17884984
Noto	Mouse	notochord development	acts_upstream_of_or_within	IMP		2290270	PMID:20197654	MGI	PMID:20197654
Noto	Mouse	notochord development	acts_upstream_of_or_within	IMP	MGI:1857063	2290270	PMID:13837681 more ...	MGI	PMID:13837681 more ...
Noto	Mouse	regulation of cilium assembly	acts_upstream_of_or_within	IMP	MGI:3053092	2290270	PMID:17884984	MGI	PMID:17884984
Noto	Mouse	regulation of transcription by RNA polymerase II	involved_in	IBA	PANTHER:PTN001216730 more ...	2290270		GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Noto	Mouse	nucleoplasm	located_in	TAS		2290270		Reactome	Reactome:R-MMU-9796302
Noto	Mouse	nucleus	is_active_in	IBA	PANTHER:PTN001216730 more ...	2290270		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Noto	Mouse	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	PANTHER:PTN001216730 more ...	2290270		GO_Central	GO_REF:0000033
Noto	Mouse	protein binding	enables	ISO	UniProtKB:O14770-4 more ...	9068941	PMID:32296183	IntAct	PMID:32296183
Noto	Mouse	protein binding	enables	ISO	UniProtKB:P0DTD1-PRO_0000449627 more ...	9068941	PMID:36217029	IntAct	PMID:36217029
Noto	Mouse	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	PANTHER:PTN001216730 and MGI:95842	2290270		GO_Central	GO_REF:0000033
Noto	Mouse	sequence-specific double-stranded DNA binding	enables	ISO	UniProtKB:A8MTQ0	2290270		GO_Central	GO_REF:0000119
Noto	Mouse	sequence-specific double-stranded DNA binding	enables	IEA	UniProtKB:A8MTQ0 and ensembl:ENSP00000381486	2290270		Ensembl	GO_REF:0000107

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Noto	Mouse	abnormal blood vessel morphology		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	abnormal dorsal root ganglion morphology		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	abnormal embryonic cilium location or orientation		IAGP		5509061		MGI	PMID:22357932
Noto	Mouse	abnormal floor plate morphology		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	abnormal left-right axis patterning		IAGP		5509061		MGI	PMID:22357932
Noto	Mouse	abnormal motile primary cilium morphology		IAGP		5509061		MGI	PMID:22357932
Noto	Mouse	abnormal motile primary cilium physiology		IAGP		5509061		MGI	PMID:22357932
Noto	Mouse	abnormal primitive node morphology		IAGP		5509061		MGI	PMID:22357932
Noto	Mouse	abnormal sclerotome morphology		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	abnormal somite development		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	abnormal tail morphology		IAGP		5509061		MGI	PMID:19720144
Noto	Mouse	abnormal vertebrae morphology		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	absent nodal flow		IAGP		5509061		MGI	PMID:22357932
Noto	Mouse	absent tail		IAGP		5509061		MGI	PMID:19720144
Noto	Mouse	curly tail		IAGP		5509061		MGI	PMID:19720144
Noto	Mouse	decreased caudal vertebrae number		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	decreased embryonic cilium length		IAGP		5509061		MGI	PMID:22357932
Noto	Mouse	decreased lumbar vertebrae number		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	decreased vertebrae number		IAGP		5509061		MGI	PMID:8155581
Noto	Mouse	decreased vertebrae number		IAGP		5509061		MGI	PMID:15231714
Noto	Mouse	fusion of vertebral bodies		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	hindlimb paralysis		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	hindlimb paralysis		IAGP		5509061		MGI	PMID:15231714
Noto	Mouse	kinked tail		IAGP		5509061		MGI	PMID:22357932
Noto	Mouse	postnatal lethality		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	postnatal lethality		IAGP		5509061		MGI	PMID:15231714
Noto	Mouse	premature death		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	short tail		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	short tail		IAGP		5509061		MGI	PMID:22357932
Noto	Mouse	short tail		IAGP		5509061		MGI	PMID:19720144
Noto	Mouse	short tail		IAGP		5509061		MGI	PMID:15231714
Noto	Mouse	truncated notochord		IAGP		5509061		MGI	PMID:13837681
Noto	Mouse	truncated notochord		IAGP		5509061		MGI	PMID:15550757
Noto	Mouse	truncated notochord		IAGP		5509061		MGI	PMID:8155581
Noto	Mouse	truncated notochord		IAGP		5509061		MGI	PMID:15231714

#	Reference Title	Reference Citation
1.	MGDs mouse GO annotations	MGD data from the GO Consortium
2.	MGD IEA	MGD IEA
3.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8155581	PMID:9745042	PMID:10349636	PMID:10512192	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932	PMID:13837681	PMID:15231714	PMID:15533813
PMID:15550757	PMID:16141072	PMID:16141073	PMID:17884984	PMID:17954925	PMID:18061569	PMID:19720144	PMID:20197654	PMID:20350929	PMID:21677750	PMID:21873635	PMID:22008794
PMID:22028328	PMID:22357932	PMID:23110100	PMID:23383217	PMID:23552073	PMID:23839921	PMID:24585447	PMID:25813538	PMID:27003939	PMID:27305836	PMID:27914912	PMID:28292423
PMID:28666954	PMID:28839193	PMID:29650695	PMID:30279523	PMID:30380057	PMID:31391582	PMID:32597756	PMID:33051257	PMID:34210974	PMID:34531379	PMID:34903892	PMID:37967203

Noto
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	85,400,851 - 85,405,859 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	85,400,868 - 85,405,859 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	85,423,886 - 85,428,877 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	85,423,886 - 85,428,877 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	85,373,880 - 85,378,871 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	85,389,587 - 85,393,928 (+)	NCBI		MGSCv36	mm8
Celera	6	87,395,820 - 87,400,823 (+)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI
cM Map	6	37.44	NCBI

NOTO
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	73,202,574 - 73,212,513 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	73,202,574 - 73,212,513 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	73,429,702 - 73,439,641 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	73,283,303 - 73,291,565 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	73,280,211 - 73,289,166 (+)	NCBI		Celera
Cytogenetic Map	2	p13.2	NCBI
HuRef	2	73,165,048 - 73,174,001 (+)	NCBI		HuRef
CHM1_1	2	73,360,196 - 73,369,145 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	73,215,563 - 73,225,502 (+)	NCBI		T2T-CHM13v2.0

Noto
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	119,518,663 - 119,522,902 (+)	NCBI		GRCr8
mRatBN7.2	4	117,961,163 - 117,965,402 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	117,961,163 - 117,965,402 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	123,442,533 - 123,446,764 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	119,217,646 - 119,221,878 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	117,831,017 - 117,835,241 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	117,206,355 - 117,210,856 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	117,206,355 - 117,210,856 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	181,783,984 - 181,788,485 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	119,677,428 - 119,681,667 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	106,943,268 - 106,947,507 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

Noto
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955424	12,424,984 - 12,431,562 (-)	NCBI	ChiLan1.0	ChiLan1.0

NOTO
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	53,168,170 - 53,177,905 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	53,170,954 - 53,180,655 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	73,254,440 - 73,265,315 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	74,744,181 - 74,752,950 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	74,744,181 - 74,752,950 (+)	Ensembl	panpan1.1		panPan2

NOTO
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	17	49,297,679 - 49,303,203 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	50,516,997 - 50,522,508 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	50,520,436 - 50,522,602 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	49,533,281 - 49,538,821 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	49,599,989 - 49,605,677 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	50,159,142 - 50,164,707 (-)	NCBI		UU_Cfam_GSD_1.0

Noto
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	11,574,738 - 11,583,644 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936491	16,987,642 - 16,996,579 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936491	16,987,797 - 16,996,423 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SMYD5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	69,567,449 - 69,571,100 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	69,566,112 - 69,571,165 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	72,771,108 - 72,774,415 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NOTO
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	33,962,173 - 33,975,040 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666045	78,110,683 - 78,121,663 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Noto
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624762	430,981 - 439,422 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Noto
225 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	503
Count of miRNA genes:	289
Interacting mature miRNAs:	390
Transcripts:	ENSMUST00000089578, ENSMUST00000174469
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4142271	Egq8_m	early growth QTL 8 (mouse)			Not determined			4503823	96633110	Mouse
10043864	T2dm4sa_m	type 2 diabetes mellitus 4 in SMXA RI mice (mouse)			Not determined		6	83690851	146954059	Mouse
1301521	Pas1c_m	pulmonary adenoma susceptibility 1c (mouse)			Not determined		6	71958006	105958152	Mouse
14697704	Stsl4_m	Salmonella typhimurium susceptibility locus 4 (mouse)					6	77076983	89976982	Mouse
10412119	Stv_m	striatal volumne (mouse)			Not determined		6	60026991	100026967	Mouse
1300954	Fcsa1_m	femoral cross-sectional area 1 (mouse)			Not determined		6	71958006	105958152	Mouse
13824985	Alh1_m	amplitude of lateral head displacement 1 (mouse)					6	77976983	96976961	Mouse
4142259	Tabw2_m	tally ho associated body weight 2 (mouse)			Not determined			46912919	136400690	Mouse
25314319	Histh6_m	histamine hypersensitivity 6 (mouse)					6	48696934	125336963	Mouse
12792979	Fbmd2_m	femoral bone mineral density 2, females only (mouse)					6	75026989	115026943	Mouse
1301571	Arrd1_m	age-related retinal degeneration 1 (mouse)			Not determined		6	75521339	92584431	Mouse
4142126	W3q3_m	weight 3 weeks QTL 3 (mouse)			Not determined			4503823	96633110	Mouse
1300674	Nidd3n_m	non-insulin-dependent diabetes mellitus 3 in NSY (mouse)			Not determined		6	75521339	94202936	Mouse
25314320	Histh5_m	histamine hypersensitivity 5 (mouse)					6	48696934	148351498	Mouse
1558977	Skmw10_m	skeletal muscle weight 10 (mouse)			Not determined		6	58424566	92424693	Mouse
1300869	Stheal5_m	soft tissue heal 5 (mouse)			Not determined		6	71552042	105552160	Mouse
1302020	Bbaa20_m	B.burgdorferi-associated arthritis 20 (mouse)			Not determined		6	71299605	93441074	Mouse
1300618	Pgia19_m	proteoglycan induced arthritis 19 (mouse)			Not determined		6	45290993	87403016	Mouse
1301962	Eila2_m	ethanol induced locomotor activity 2 (mouse)			Not determined		6	48703490	125333748	Mouse
4141990	Etax6_m	ethanol induced ataxia 6 (mouse)			Not determined			71299605	86252701	Mouse
4141028	Mclr_m	methylcholanthrene lymphoma resistance (mouse)			Not determined			54350411	88356155	Mouse
1301320	Ots1_m	ovarian teratoma susceptibility 1 (mouse)			Not determined		6	75424566	104480516	Mouse
10043972	Obq28_m	obesity QTL 28 (mouse)			Not determined		6	58517416	92517416	Mouse
1300556	Cia6_m	collagen induced arthritis QTL 6 (mouse)			Not determined		6	4464884	87403016	Mouse
1558984	Cplaq9_m	circadian period of locomotor activity 9 (mouse)			Not determined		6	38646560	92584431	Mouse
10412157	Fl1n_m	fatty liver 1 in NSY (mouse)			Not determined		6	45290993	128811995	Mouse
11251720	Ewc4_m	ethanol withdrawal and consumption 4 (mouse)					6	84099474	118099474	Mouse
25440480	Moaq2_m	modifier of alien QTL 2 (mouse)					6	3050001	117476961	Mouse
26884414	Bzwq12_m	bi-zygomatic width QTL 12, 16 week (mouse)					6	3400000	139076998	Mouse
10043901	Pfat5_m	predicted fat percentage 5 (mouse)			Not determined		6	75584287	109584431	Mouse
4142361	W10q11_m	weight 10 weeks QTL 11 (mouse)			Not determined			4503823	96633110	Mouse
1301813	Skl3_m	skeletal size (tail length) 3 (mouse)			Not determined		6	70402880	104403016	Mouse
4142232	W6q4_m	weight 6 weeks QTL 4 (mouse)			Not determined			4503823	96633110	Mouse
1357683	Igf1sl1_m	IGF-1 serum levels 1 (mouse)			Not determined		6	52138693	116132228	Mouse
1301876	Bits2_m	bitterness sensitivity 2 (mouse)			Not determined		6	70402880	104403016	Mouse
1357875	Pfat2_m	predicted fat percentage 2 (mouse)			Not determined		6	76440930	110441074	Mouse
15039373	Adip28_m	adiposity 28 (mouse)					6	56285194	90285194	Mouse
15039375	Bw41_m	body weight QTL 41 (mouse)					6	56285194	90285194	Mouse
1301369	Im4_m	immunoregulatory 4 (mouse)			Not determined		6	63461721	97461888	Mouse
10412208	Cypr4_m	cytokine production 4 (mouse)			Not determined		6	75693484	109693678	Mouse
1300650	Bw18_m	body weight QTL 18 (mouse)			Not determined		6	66690851	100691013	Mouse
1301034	Egrm2_m	early growth rate (mouse)			Not determined		6	70402880	104403016	Mouse
14696731	Pairq1_m	P. aeruginosa infection resistance QTL 1 (mouse)					6	81476981	102176961	Mouse
13506930	Recrq9_m	recombination rate in male meiosis QTL 9 (mouse)					6	73476983	134676963	Mouse
10412195	Efw_m	epididymal fat weight (mouse)			Not determined		6	75521339	94202936	Mouse
1301740	Bwq2_m	body weight QTL 2 (mouse)			Not determined		6	60034663	94034782	Mouse
4141376	Dbm1_m	diabetes modifier 1 (mouse)			Not determined		6	78606487	121092347	Mouse

AU022460

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	85,428,062 - 85,428,274	UniSTS	GRCm38
MGSCv37	6	85,378,056 - 85,378,268	UniSTS	GRCm37
Celera	6	87,400,008 - 87,400,220	UniSTS
Cytogenetic Map	6	C3	UniSTS
cM Map	6	35.5	UniSTS
Whitehead/MRC_RH	6	883.63	UniSTS

Noto

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	6	C3	UniSTS
cM Map	6	35.6	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001007472	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006506356	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC155728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ862873	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ862874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ862875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK135886	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC139154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC139155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR354750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000089578 ⟹ ENSMUSP00000087006

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	6	85,400,868 - 85,405,859 (+)	Ensembl
GRCm38.p6 Ensembl	6	85,423,886 - 85,428,877 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000174469 ⟹ ENSMUSP00000134424

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	6	85,401,050 - 85,405,259 (+)	Ensembl
GRCm38.p6 Ensembl	6	85,424,068 - 85,428,277 (+)	Ensembl

RefSeq Acc Id:

NM_001007472 ⟹ NP_001007473

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	6	85,400,868 - 85,405,859 (+)	NCBI
GRCm38	6	85,423,886 - 85,428,877 (+)	ENTREZGENE
MGSCv37	6	85,373,880 - 85,378,871 (+)	RGD
Celera	6	87,395,820 - 87,400,823 (+)	RGD
cM Map	6		ENTREZGENE

Sequence:

show sequence

AGGGATCCTGATTCACAAGTCTCCCGTTCCTTTAGTAAGGTGACCACCTCTCTCTCTCCCATTGAGCTCCTTGCACAGCCTGGGAGGTCCCCTCAGGGTCGCGCAATGTCCAGCCCTGCTCCCTCAGG
CACTCAGGTCCAGCCCGGGAGCCTGCGCCCCTGTCCGGGAGCTGTTTCCCCAGTTGTCCCGCGCCGACTAGCTCGGGGACGCCTGGAGTCATCCTTCTCTGTCGAGGCCATCCTGGCGAGACCCAAGA
CCCGAGAGCTGGCGGCCACCTCTCTGCCGCTCTCTACCTGCACCAGTCTGAACCTCCTCGGTGCGGTGTCGCAGTACGGGGTCCTGCCCTGGGTGTGCTCCACAGGGTCTTGGCTGCCTGCCTACCTG
AGCGTGGGCGTCTACCCGCTGTGCTCCATGTCCTGCGTGCCCGGACTGAATGTCACTCACCACCAGCAGGGCCTCAGGCTCACAGGATCAGAGCTACCTTACTGTCTAGGCCCTCTGAAATGGGCACC
CACCGTGGACCTTCGGGACCACGGGACCGAGAGACACACAAAGAGGGTTCGCACAACGTTTAACTTGCAGCAGCTGCAAGAGTTGGAGAAGGTGTTTGCAAAGCAGCACAACCTGGTGGGGAAGGAGA
GAGCCCAGCTGGCTGCCAGGCTGCACCTGACGGAGAATCAGGTGAGGATCTGGTTCCAAAATCGCAGGGTGAAGTATCAGAAGCAGCAAAAACTGAAATTGCCTTCCTCCTCTGTCATGGAGGAGCCC
TCCAGCAGCTCAGATGGCAACATCCAGAGTGAAGATGCTGAGTTGGGAATTGGCAGTTAAGGACCGAGCAAGAGGCTTTAGTTATATGGGCTAGTTCTTCCTGTGGTACCTGCTGGCCCTCCCTGTCC
CACATCTCAGTGAAGAGCTTCCTTAAGGTCAAAGGACACCAAATGTACTTGGACAATCAAGCAAGGGAACTCTGGAAGCAGCATAATGGATTGACCTATGTCCTTGGCCAGGTTTTATGTCTTGCGGA
TAGAGGTATATTGATAACTTACACATCTCTCCCAGGGTGAGTTAAGGTCTGTAAAGCACTTACAGAGTACCAGCTGGTGAGGTTTATGGGATAGACGCTGTCCCAGCTCTGCCCTGAAGATGGATTCA
TCAGCTCTCTCCTGGCCTGGCTATGGAGAATAGGCAGCCTTGAATCAGCATCACAGTGTGGAAAGACTCTCCCCAAAGTCTAGAGAGAAGGAGATTTCTTAGCTCGCTTCAAACAAAGTTTCCTGCAT
TTCAACCCTATTTCTTTTCCTCTTGTCACCCTCCTCTGTATCTGGGGATGACTTTGGATTCCTGACCCTCTACTTCCCACGTGCTGGGATTACAGCTGCTTTTTTTTTTTTTTTTTTTGGAGGGGTGG
GGAGATTACAGATTCTCATTATGTGGCACAGATTGGCTTCAAATGCATGGAAATTCTCCTGTTTTAACCTCTCTAGTGTTGAGGTAATGGGTAAAAGCCTCCATGCTTTGCCCAAAGTTTTCTTGTCT
GAGACTACTTTCAATAGGAGTCCATGTCATAGTGAGCTCAGGTTTATGGTAACTGGTTCCTTGGAA

hide sequence

RefSeq Acc Id:

XM_006506356 ⟹ XP_006506419

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	6	85,400,851 - 85,405,255 (+)	NCBI
GRCm38	6	85,423,899 - 85,428,273 (+)	NCBI

Sequence:

show sequence

TGCAAACAGCTGGCCCTAGGGATCCTGATTCACAAGTCTCCCGTTCCTTTAGTAAGGTGACCACCTCTCTCTCTCCCATTGAGCTCCTTGCACAGCCTGGGAGGTCCCCTCAGGGTCGCGCAATGTCC
AGCCCTGCTCCCTCAGGCACTCAGGTCCAGCCCGGGAGCCTGCGCCCCTGTCCGGGAGCTGTTTCCCCAGTTGTCCCGCGCCGACTAGCTCGGGGACGCCTGGAGTCATCCTTCTCTGTCGAGGCCAT
CCTGGCGAGACCCAAGACCCGAGAGCTGGCGGCCACCTCTCTGCCGCTCTCTACCTGCACCAGTCTGAACCTCCTCGGTGCGGTGTCGCAGTACGGGGTCCTGCCCTGGGTGTGCTCCACAGGGTCTT
GGCTGCCTGCCTACCTGAGCGTGGGCGTCTACCCGCTGTGCTCCATGTCCTGCGTGCCCGGACTGAATGTCACTCACCACCAGCAGGGCCTCAGGCTCACAGGTGAGGATCTGGTTCCAAAATCGCAG
GGTGAAGTATCAGAAGCAGCAAAAACTGAAATTGCCTTCCTCCTCTGTCATGGAGGAGCCCTCCAGCAGCTCAGATGGCAACATCCAGAGTGAAGATGCTGAGTTGGGAATTGGCAGTTAAGGACCGA
GCAAGAGGCTTTAGTTATATGGGCTAGTTCTTCCTGTGGTACCTGCTGGCCCTCCCTGTCCCACATCTCAGTGAAGAGCTTCCTTAAGGTCAAAGGACACCAAATGTACTTGGACAATCAAGCAAGGG
AACTCTGGAAGCAGCATAATGGATTGACCTATGTC

hide sequence


Protein RefSeqs	NP_001007473	(Get FASTA)	NCBI Sequence Viewer
	XP_006506419	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI39155	(Get FASTA)	NCBI Sequence Viewer
	AAI39156	(Get FASTA)	NCBI Sequence Viewer
	BAE22716	(Get FASTA)	NCBI Sequence Viewer
	CAI05851	(Get FASTA)	NCBI Sequence Viewer
	CAI05852	(Get FASTA)	NCBI Sequence Viewer
	CAI05853	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000087006
	ENSMUSP00000087006.7
	ENSMUSP00000134424
GenBank Protein	Q5TIS6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001007473 ⟸ NM_001007472

- UniProtKB:

Q5TIS6 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSSPAPSGTQVQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLPLSTCTSLNLLGAVSQYGVLPWVCSTGSWLPAYLSVGVYPLCSMSCVPGLNVTHHQQGLRLTGSELPYC
LGPLKWAPTVDLRDHGTERHTKRVRTTFNLQQLQELEKVFAKQHNLVGKERAQLAARLHLTENQVRIWFQNRRVKYQKQQKLKLPSSSVMEEPSSSSDGNIQSEDAELGIGS

hide sequence

RefSeq Acc Id:	XP_006506419 ⟸ XM_006506356
- Peptide Label:	isoform X1
- UniProtKB:	G3UZB3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSSPAPSGTQVQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLPLSTCTSLNLLGAVSQYGVLPWVCSTGSWLPAYLSVGVYPLCSMSCVPGLNVTHHQQGLRLTGEDLVPK SQGEVSEAAKTEIAFLLCHGGALQQLRWQHPE hide sequence

Ensembl Acc Id:

ENSMUSP00000134424 ⟸ ENSMUST00000174469

Ensembl Acc Id:

ENSMUSP00000087006 ⟸ ENSMUST00000089578

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5TIS6-F1-model_v2	AlphaFold	Q5TIS6	1-240	view protein structure

RGD ID:

6839694

Promoter ID:

MM_KWN:46680

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Spleen

Transcripts:

ENSMUST00000089578

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	6	85,373,236 - 85,373,736 (+)	MPROMDB

RGD ID:

6890222

Promoter ID:

EPDNEW_M8562

Type:

single initiation site

Name:

Noto_1

Description:

Mus musculus notochord homeobox , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	6	85,423,886 - 85,423,946	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000068302	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000089578	ENTREZGENE
	ENSMUST00000089578.9	UniProtKB/Swiss-Prot
	ENSMUST00000174469	ENTREZGENE
Gene3D-CATH	Homeodomain-like	UniProtKB/Swiss-Prot
InterPro	EMX-VAX-Noto_Homeobox_TFs	UniProtKB/Swiss-Prot
	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
KEGG Report	mmu:384452	UniProtKB/Swiss-Prot
MGD	MGI:3053002	ENTREZGENE
NCBI Gene	Noto	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN EMX-RELATED	UniProtKB/Swiss-Prot
	HOMEOBOX PROTEIN NOTOCHORD	UniProtKB/Swiss-Prot
Pfam	Homeodomain	UniProtKB/Swiss-Prot
PhenoGen	Noto	PhenoGen
PROSITE	HOMEOBOX_2	UniProtKB/Swiss-Prot
SMART	HOX	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
UniProt	G3UZB3	ENTREZGENE, UniProtKB/TrEMBL
	NOTO_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-08-21	Noto	notochord homeobox	Noto	notochord homolog (Xenopus laevis)	Symbol and/or name change	5135510	APPROVED
2024-08-21	Noto	notochord homolog (Xenopus laevis)	Noto	notochord homeobox	Symbol and/or name change	5135510	APPROVED
2016-02-29	Noto	notochord homeobox		notochord homolog (Xenopus laevis)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype