Symbol:
Ttyh2
Name:
tweety family member 2
RGD ID:
1557354
MGI Page
MGI
Description:
Enables calcium ion binding activity and volume-sensitive chloride channel activity. Involved in L-glutamate transmembrane transport. Located in plasma membrane. Is expressed in several structures, including adrenal gland; central nervous system; olfactory epithelium; retina layer; and submandibular gland primordium mesenchyme. Orthologous to human TTYH2 (tweety family member 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1110001A03Rik; mTTY2; protein tweety homolog 2; tweety homolog 2; volume-regulated anion channel subunit Ttyh2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TTYH2 (tweety family member 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ttyh2 (tweety family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ttyh2 (tweety family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TTYH2 (tweety family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TTYH2 (tweety family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ttyh2 (tweety family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TTYH2 (tweety family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TTYH2 (tweety family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ttyh2 (tweety family member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TTYH2 (tweety family member 2)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Ttyh2 (tweety family member 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ttyh2 (tweety family member 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
ttyh2l (tweety homolog 2, like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG3638
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
ttyh-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
tty
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ttyh2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 114,566,294 - 114,611,810 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 114,566,257 - 114,611,803 (+) Ensembl GRCm39 Ensembl GRCm38 11 114,675,468 - 114,720,984 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 114,675,431 - 114,720,977 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 114,536,782 - 114,582,298 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 114,491,558 - 114,537,074 (+) NCBI MGSCv36 mm8 Celera 11 126,434,785 - 126,481,284 (+) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 79.85 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ttyh2 Mouse (+)-schisandrin B multiple interactions ISO Ttyh2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TTYH2 mRNA] CTD PMID:31150632 Ttyh2 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TTYH2 mRNA CTD PMID:39298647 Ttyh2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TTYH2 mRNA CTD PMID:19933214 Ttyh2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TTYH2 mRNA CTD PMID:21570461 Ttyh2 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Ttyh2 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Ttyh2 Mouse 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of TTYH2 mRNA CTD PMID:18648102 Ttyh2 Mouse 5-fluorouracil decreases expression ISO TTYH2 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of TTYH2 mRNA CTD PMID:16510598 Ttyh2 Mouse 6-propyl-2-thiouracil increases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of TTYH2 mRNA CTD PMID:30047161 Ttyh2 Mouse acrylamide decreases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of TTYH2 mRNA CTD PMID:28959563 Ttyh2 Mouse actinomycin D multiple interactions ISO TTYH2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of TTYH2 mRNA CTD PMID:38460933 Ttyh2 Mouse aflatoxin B1 increases methylation ISO TTYH2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of TTYH2 gene and Aflatoxin B1 results in increased methylation of TTYH2 promoter CTD PMID:27153756 and PMID:30157460 Ttyh2 Mouse aflatoxin B1 decreases methylation ISO TTYH2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TTYH2 intron CTD PMID:30157460 Ttyh2 Mouse all-trans-retinoic acid decreases expression ISO TTYH2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TTYH2 mRNA CTD PMID:21934132 Ttyh2 Mouse amitrole increases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Amitrole results in increased expression of TTYH2 mRNA CTD PMID:30047161 Ttyh2 Mouse amosite asbestos decreases methylation ISO TTYH2 (Homo sapiens) 6480464 Asbestos and Amosite results in decreased methylation of TTYH2 promoter CTD PMID:29626692 Ttyh2 Mouse aristolochic acid A increases expression ISO TTYH2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TTYH2 mRNA CTD PMID:33212167 Ttyh2 Mouse benzatropine increases expression ISO TTYH2 (Homo sapiens) 6480464 Benztropine results in increased expression of TTYH2 protein CTD PMID:34122009 Ttyh2 Mouse benzo[a]pyrene multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to TTYH2 promoter] CTD PMID:19654925 Ttyh2 Mouse benzo[a]pyrene decreases methylation ISO TTYH2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TTYH2 3' UTR more ... CTD PMID:27901495 Ttyh2 Mouse benzo[a]pyrene affects methylation ISO TTYH2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TTYH2 intron and Benzo(a)pyrene affects the methylation of TTYH2 promoter CTD PMID:27901495 and PMID:30157460 Ttyh2 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of TTYH2 mRNA CTD PMID:22228805 Ttyh2 Mouse benzo[e]pyrene increases methylation ISO TTYH2 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of TTYH2 intron CTD PMID:30157460 Ttyh2 Mouse beta-lapachone increases expression ISO TTYH2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of TTYH2 mRNA CTD PMID:38218311 Ttyh2 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of TTYH2 mRNA CTD PMID:33754040 Ttyh2 Mouse bisphenol A affects expression ISO Ttyh2 (Rattus norvegicus) 6480464 bisphenol A affects the expression of TTYH2 mRNA CTD PMID:25181051 Ttyh2 Mouse bisphenol A decreases methylation ISO TTYH2 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of TTYH2 gene CTD PMID:31601247 Ttyh2 Mouse bisphenol A increases expression ISO Ttyh2 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of TTYH2 mRNA CTD PMID:32145629 Ttyh2 Mouse C60 fullerene decreases expression ISO Ttyh2 (Rattus norvegicus) 6480464 fullerene C60 results in decreased expression of TTYH2 mRNA CTD PMID:19167457 Ttyh2 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon analog results in increased expression of TTYH2 mRNA CTD PMID:25554681 Ttyh2 Mouse CGP 52608 multiple interactions ISO TTYH2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TTYH2 gene] CTD PMID:28238834 Ttyh2 Mouse cisplatin multiple interactions ISO TTYH2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of TTYH2 mRNA CTD PMID:27392435 Ttyh2 Mouse cisplatin increases expression ISO TTYH2 (Homo sapiens) 6480464 Cisplatin results in increased expression of TTYH2 mRNA CTD PMID:27392435 Ttyh2 Mouse clozapine increases expression ISO TTYH2 (Homo sapiens) 6480464 Clozapine results in increased expression of TTYH2 protein CTD PMID:34122009 Ttyh2 Mouse crocidolite asbestos decreases methylation ISO TTYH2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased methylation of TTYH2 promoter CTD PMID:29626692 Ttyh2 Mouse Cuprizon decreases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of TTYH2 mRNA CTD PMID:26577399 and PMID:27523638 Ttyh2 Mouse cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of TTYH2 mRNA CTD PMID:19770486 Ttyh2 Mouse Dibutyl phosphate affects expression ISO TTYH2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TTYH2 mRNA CTD PMID:37042841 Ttyh2 Mouse dibutyl phthalate decreases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of TTYH2 mRNA CTD PMID:21266533 Ttyh2 Mouse dibutyl phthalate increases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of TTYH2 mRNA CTD PMID:21266533 Ttyh2 Mouse dorsomorphin multiple interactions ISO TTYH2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ttyh2 Mouse doxorubicin decreases expression ISO TTYH2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TTYH2 mRNA CTD PMID:29803840 Ttyh2 Mouse endosulfan decreases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of TTYH2 mRNA CTD PMID:29391264 Ttyh2 Mouse entinostat increases expression ISO TTYH2 (Homo sapiens) 6480464 entinostat results in increased expression of TTYH2 mRNA CTD PMID:26272509 Ttyh2 Mouse entinostat multiple interactions ISO TTYH2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TTYH2 mRNA CTD PMID:27188386 Ttyh2 Mouse epoxiconazole decreases expression EXP 6480464 epoxiconazole results in decreased expression of TTYH2 mRNA CTD PMID:35436446 Ttyh2 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of TTYH2 mRNA CTD PMID:30319688 Ttyh2 Mouse fenamidone increases expression EXP 6480464 fenamidone results in increased expression of TTYH2 mRNA CTD PMID:27029645 Ttyh2 Mouse fenthion decreases expression EXP 6480464 Fenthion results in decreased expression of TTYH2 mRNA CTD PMID:34813904 Ttyh2 Mouse formaldehyde increases expression ISO TTYH2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of TTYH2 mRNA CTD PMID:23649840 Ttyh2 Mouse FR900359 affects phosphorylation ISO TTYH2 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of TTYH2 protein CTD PMID:37730182 Ttyh2 Mouse gentamycin increases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of TTYH2 mRNA CTD PMID:33387578 Ttyh2 Mouse lipopolysaccharide increases expression ISO TTYH2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of TTYH2 mRNA CTD PMID:35811015 Ttyh2 Mouse lipopolysaccharide multiple interactions ISO TTYH2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of TTYH2 mRNA] CTD PMID:35811015 Ttyh2 Mouse methapyrilene increases methylation ISO TTYH2 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of TTYH2 intron CTD PMID:30157460 Ttyh2 Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of TTYH2 mRNA CTD PMID:34813904 Ttyh2 Mouse methimazole increases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Methimazole results in increased expression of TTYH2 mRNA CTD PMID:30047161 Ttyh2 Mouse methylmercury chloride decreases expression ISO TTYH2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of TTYH2 mRNA CTD PMID:28001369 Ttyh2 Mouse mono(2-ethylhexyl) phthalate decreases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of TTYH2 mRNA CTD PMID:22401849 Ttyh2 Mouse N-methyl-4-phenylpyridinium increases expression ISO TTYH2 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of TTYH2 mRNA CTD PMID:24810058 Ttyh2 Mouse nefazodone decreases expression ISO Ttyh2 (Rattus norvegicus) 6480464 nefazodone results in decreased expression of TTYH2 mRNA CTD PMID:24136188 Ttyh2 Mouse nimesulide decreases expression ISO Ttyh2 (Rattus norvegicus) 6480464 nimesulide results in decreased expression of TTYH2 mRNA CTD PMID:24136188 Ttyh2 Mouse Nutlin-3 multiple interactions ISO TTYH2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of TTYH2 mRNA CTD PMID:38460933 Ttyh2 Mouse paracetamol increases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of TTYH2 mRNA CTD PMID:33387578 Ttyh2 Mouse phenylmercury acetate decreases expression ISO TTYH2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of TTYH2 mRNA CTD PMID:26272509 Ttyh2 Mouse phenylmercury acetate multiple interactions ISO TTYH2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TTYH2 mRNA CTD PMID:27188386 Ttyh2 Mouse propanal increases expression ISO TTYH2 (Homo sapiens) 6480464 propionaldehyde results in increased expression of TTYH2 mRNA CTD PMID:26079696 Ttyh2 Mouse propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of TTYH2 mRNA CTD PMID:21278054 Ttyh2 Mouse rotenone increases expression ISO TTYH2 (Homo sapiens) 6480464 Rotenone results in increased expression of TTYH2 mRNA CTD PMID:29955902 Ttyh2 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO TTYH2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of TTYH2 mRNA] CTD PMID:35811015 Ttyh2 Mouse SB 431542 multiple interactions ISO TTYH2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ttyh2 Mouse silicon dioxide increases expression ISO TTYH2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of TTYH2 mRNA CTD PMID:25895662 Ttyh2 Mouse silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of TTYH2 mRNA CTD PMID:29203145 Ttyh2 Mouse sulfadimethoxine increases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of TTYH2 mRNA CTD PMID:30047161 Ttyh2 Mouse sunitinib decreases expression ISO TTYH2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of TTYH2 mRNA CTD PMID:31533062 Ttyh2 Mouse testosterone increases expression EXP 6480464 Testosterone results in increased expression of TTYH2 mRNA CTD PMID:20403060 Ttyh2 Mouse tetrachloromethane multiple interactions ISO Ttyh2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TTYH2 mRNA] CTD PMID:31150632 Ttyh2 Mouse tetrachloromethane decreases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of TTYH2 mRNA CTD PMID:31150632 Ttyh2 Mouse thimerosal decreases expression ISO TTYH2 (Homo sapiens) 6480464 Thimerosal results in decreased expression of TTYH2 mRNA CTD PMID:27188386 Ttyh2 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of TTYH2 gene CTD PMID:35295148 Ttyh2 Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of TTYH2 mRNA CTD PMID:35295148 Ttyh2 Mouse trichloroethene increases expression ISO Ttyh2 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of TTYH2 mRNA CTD PMID:33387578 Ttyh2 Mouse triphenyl phosphate affects expression ISO TTYH2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TTYH2 mRNA CTD PMID:37042841 Ttyh2 Mouse urethane increases expression ISO TTYH2 (Homo sapiens) 6480464 Urethane results in increased expression of TTYH2 mRNA CTD PMID:28818685 Ttyh2 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of TTYH2 mRNA CTD PMID:17963808 Ttyh2 Mouse valproic acid increases expression ISO TTYH2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TTYH2 mRNA CTD PMID:23179753 and PMID:27188386 Ttyh2 Mouse valproic acid affects expression ISO TTYH2 (Homo sapiens) 6480464 Valproic Acid affects the expression of TTYH2 mRNA CTD PMID:25979313 Ttyh2 Mouse valproic acid increases methylation ISO TTYH2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of TTYH2 gene CTD PMID:29154799 Ttyh2 Mouse vincristine increases expression ISO TTYH2 (Homo sapiens) 6480464 Vincristine results in increased expression of TTYH2 mRNA CTD PMID:23649840
(+)-schisandrin B (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 4,4'-diaminodiphenylmethane (EXP) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (ISO) amosite asbestos (ISO) aristolochic acid A (ISO) benzatropine (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) C60 fullerene (ISO) carbon nanotube (EXP) CGP 52608 (ISO) cisplatin (ISO) clozapine (ISO) crocidolite asbestos (ISO) Cuprizon (ISO) cyclosporin A (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (ISO) entinostat (ISO) epoxiconazole (EXP) ethanol (EXP) fenamidone (EXP) fenthion (EXP) formaldehyde (ISO) FR900359 (ISO) gentamycin (ISO) lipopolysaccharide (ISO) methapyrilene (ISO) methidathion (EXP) methimazole (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (EXP) N-methyl-4-phenylpyridinium (ISO) nefazodone (ISO) nimesulide (ISO) Nutlin-3 (ISO) paracetamol (ISO) phenylmercury acetate (ISO) propanal (ISO) propiconazole (EXP) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (EXP,ISO) sulfadimethoxine (ISO) sunitinib (ISO) testosterone (EXP) tetrachloromethane (ISO) thimerosal (ISO) titanium dioxide (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (EXP,ISO) vincristine (ISO)
Ttyh2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 114,566,294 - 114,611,810 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 114,566,257 - 114,611,803 (+) Ensembl GRCm39 Ensembl GRCm38 11 114,675,468 - 114,720,984 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 114,675,431 - 114,720,977 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 114,536,782 - 114,582,298 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 114,491,558 - 114,537,074 (+) NCBI MGSCv36 mm8 Celera 11 126,434,785 - 126,481,284 (+) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 79.85 NCBI
TTYH2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 74,213,571 - 74,262,020 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 74,213,571 - 74,262,020 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 72,209,710 - 72,258,159 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 69,721,291 - 69,769,754 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 69,756,099 - 69,769,750 NCBI Celera 17 68,796,241 - 68,850,209 (+) NCBI Celera Cytogenetic Map 17 q25.1 NCBI HuRef 17 67,620,155 - 67,668,483 (+) NCBI HuRef CHM1_1 17 72,274,323 - 72,322,720 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 75,104,409 - 75,152,817 (+) NCBI T2T-CHM13v2.0
Ttyh2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 100,208,129 - 100,252,505 (+) NCBI GRCr8 mRatBN7.2 10 99,709,063 - 99,753,449 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 99,709,007 - 99,753,444 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 104,767,015 - 104,811,823 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 104,230,134 - 104,274,937 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 99,630,130 - 99,674,500 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 103,206,085 - 103,248,911 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 103,206,014 - 103,248,862 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 102,865,658 - 102,908,420 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 104,553,284 - 104,596,673 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 98,313,869 - 98,344,814 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
Ttyh2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955553 1,137,762 - 1,179,195 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955553 1,137,762 - 1,179,195 (+) NCBI ChiLan1.0 ChiLan1.0
TTYH2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 90,244,278 - 90,292,730 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 95,066,716 - 95,115,130 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 68,152,290 - 68,200,690 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 73,710,144 - 73,758,546 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 73,710,144 - 73,758,546 (+) Ensembl panpan1.1 panPan2
TTYH2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 6,120,586 - 6,156,956 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 6,120,575 - 6,156,957 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 6,742,365 - 6,778,896 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 6,792,981 - 6,829,555 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 6,792,986 - 6,829,564 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 6,833,458 - 6,870,176 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 6,936,998 - 6,973,531 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 6,996,992 - 7,033,550 (-) NCBI UU_Cfam_GSD_1.0
Ttyh2
TTYH2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 6,838,425 - 6,881,472 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 6,838,420 - 6,881,562 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 6,865,496 - 6,908,598 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TTYH2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 47,372,879 - 47,421,471 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 47,372,897 - 47,421,435 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 18,187,232 - 18,235,971 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ttyh2
.
Predicted Target Of
Count of predictions: 834 Count of miRNA genes: 477 Interacting mature miRNAs: 576 Transcripts: ENSMUST00000045779, ENSMUST00000141111 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1302034 Pkccl_m protein kinase C content in lungs (mouse) Not determined 11 91604608 121973369 Mouse 39128214 Lwq20_m liver weight QTL 20 (mouse) 11 12268637 118022724 Mouse 1301072 Eae22_m experimental allergic encephalomyelitis 22 (mouse) Not determined 11 82377698 116377820 Mouse 1300944 Alcp20_m alcohol preference locus 20 (mouse) Not determined 11 95403965 121973369 Mouse 1301012 Vispl_m visual placing (mouse) Not determined 11 101022590 121973369 Mouse 4141939 Pregq2_m pregnancy QTL 2 (mouse) Not determined 11 94063779 118022724 Mouse 1301983 Berr2_m berghei resistance locus 2 (mouse) Not determined 11 98352609 121973369 Mouse 1300766 Skull16_m skull morphology 16 (mouse) Not determined 11 81574481 115574636 Mouse 10043976 Obq33_m obesity QTL 33 (mouse) Not determined 11 98500469 121973369 Mouse 1301057 Nidd4_m non-insulin-dependent diabetes mellitus 4 (mouse) Not determined 11 96810136 121973369 Mouse 4141612 Cia40_m collagen induced arthritis 40 (mouse) Not determined 11 103273992 115021444 Mouse 1301958 Alcp18_m alcohol preference locus 18 (mouse) Not determined 11 95403965 121973369 Mouse 14747003 Mancz9_m mandible centroid size 9 (mouse) 11 85844911 119844911 Mouse 10412288 Carg4_m Candida albicans resistance gene 4 (mouse) Not determined 11 81810267 115810267 Mouse 11251723 Ewc5_m ethanol withdrawal and consumption 5 (mouse) 11 89869251 121973369 Mouse 15014785 Mvlq1_m macrovesicular liver lesion QTL 1 (mouse) 11 86608320 120608320 Mouse 4141465 Dbm2_m diabetes modifier 2 (mouse) Not determined 94437183 118022724 Mouse 15039374 Adip29_m adiposity 29 (mouse) 11 86608320 120608320 Mouse 1300962 Cd8mts4_m CD8 memory T cell subset 4 (mouse) Not determined 11 96137674 121973369 Mouse 1301095 El6_m epilepsy 6 (mouse) Not determined 11 93229183 121973369 Mouse 27226731 Tibmd4_m tibia midshaft diameter 4, 10 week (mouse) 11 94190826 118890826 Mouse 11341721 Rvfs2_m Rift Valley fever susceptibility 2 (mouse) 11 100254186 120887165 Mouse 15039376 Bw42_m body weight QTL 42 (mouse) 11 86608320 120608320 Mouse 1558753 Ath19_m atherosclerosis 19 (mouse) Not determined 11 91604608 121973369 Mouse 10044001 Alcw8_m alcohol withdrawal 8 (mouse) Not determined 11 99254187 121973369 Mouse 1300649 Crhq1_m compensatory renal hypertrophy QTL 1 (mouse) Not determined 11 81574481 115574636 Mouse 27226789 Feml16_m femur length 16, 10 week (mouse) 11 87490826 121873369 Mouse 11553867 Stmm5_m skin tumor modifier of MSM 5 (mouse) 11 100058103 121973369 Mouse 10044007 Hbnr14_m Heligmosomoides bakeri nematode resistance 14 (mouse) Not determined 11 87502600 121502698 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000045779 ⟹ ENSMUSP00000037821
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 114,566,257 - 114,611,803 (+) Ensembl GRCm38.p6 Ensembl 11 114,675,431 - 114,720,977 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000141111
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 114,566,342 - 114,581,429 (+) Ensembl GRCm38.p6 Ensembl 11 114,675,516 - 114,690,603 (+) Ensembl
RefSeq Acc Id:
NM_053273 ⟹ NP_444503
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 114,566,294 - 114,611,810 (+) NCBI GRCm38 11 114,675,468 - 114,720,984 (+) ENTREZGENE MGSCv37 11 114,536,782 - 114,582,298 (+) RGD Celera 11 126,434,785 - 126,481,284 (+) RGD cM Map 11 ENTREZGENE
Sequence:
CGGGTCGCTTCCGAGCCGGGTAGTGGTGGTAGCGGCGTTGGCAGGGGCAGTGGACCCGCTGCAGCTTGTGCAAGCCATGCCGGCGGCGCGAGTGGAGTACATCGCGCCCTGGTGGGTCGTGTGGCTGC
hide sequence
RefSeq Acc Id:
NP_444503 ⟸ NM_053273
- UniProtKB:
Q6P9J3 (UniProtKB/Swiss-Prot), Q3U8L3 (UniProtKB/Swiss-Prot), Q3U103 (UniProtKB/Swiss-Prot), Q920A8 (UniProtKB/Swiss-Prot), Q3TH73 (UniProtKB/Swiss-Prot)
- Sequence:
MPAARVEYIAPWWVVWLHSVPHLGLRLQRVDSTFSPGDETYQESLLFLGVLAAIGLGLNLIFLTVYLVCTCCCRRDHTVQTKQQESCCVTWTAVVAGLLCCAAVGVGFYGNSETNDGMHQLIYSLDNA
hide sequence
Ensembl Acc Id:
ENSMUSP00000037821 ⟸ ENSMUST00000045779
RGD ID: 6822399 Promoter ID: MM_KWN:10474 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000100242, OTTMUST00000007222, OTTMUST00000007223 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 114,535,821 - 114,536,952 (+) MPROMDB
RGD ID: 8677276 Promoter ID: EPDNEW_M16668 Type: initiation region Name: Ttyh2_1 Description: Mus musculus tweety family member 2 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 114,675,489 - 114,675,549 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-14
Ttyh2
tweety family member 2
tweety homolog 2 (Drosophila)
Symbol and/or name change
5135510 APPROVED
