Advanced Search (OLGA)

Gene: Actrt2 (actin-related protein T2) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Actrt2

Name:

actin-related protein T2

RGD ID:

1557047

MGI Page

MGI

Description:

Predicted to be located in cytoplasm and cytoskeleton. Predicted to be active in actin cytoskeleton. Is expressed in Meckel's cartilage; liver lobe; and skeleton. Orthologous to human ACTRT2 (actin related protein T2).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1700052K15Rik; actin related protein M2 (Arpm2); actin-related protein M2; Ar; Arp; Arp-T2; Arpm2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACTRT2 (actin related protein T2)	HGNC	Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Actrt2 (actin-related protein T2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Actrt2 (actin related protein T2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ACTRT2 (actin related protein T2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACTRT2 (actin related protein T2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Actrt2 (actin related protein T2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACTRT2 (actin related protein T2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACTRT2 (actin related protein T2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Actrt2 (actin related protein T2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ACTRT1 (actin related protein T1)	HGNC	OrthoDB
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Actrt2 (actin-related protein T2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ACTRT2 (actin related protein T2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Arp53D	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	actrt2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	154,750,885 - 154,752,324 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	154,750,890 - 154,752,324 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	154,666,428 - 154,667,867 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	154,666,433 - 154,667,867 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	154,040,537 - 154,041,976 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	153,510,234 - 153,511,533 (-)	NCBI		MGSCv36	mm8
Celera	4	156,945,512 - 156,946,951 (-)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI
cM Map	4	84.69	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Actrt2	Mouse	chromosome 1p36 deletion syndrome		ISO	ACTRT2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 1p36 deletion syndrome	ClinVar
Actrt2	Mouse	dilated cardiomyopathy 1LL		ISO	ACTRT2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Left ventricular noncompaction 8	ClinVar	PMID:28492532
Actrt2	Mouse	Ehlers-Danlos syndrome spondylodysplastic type 2		ISO	ACTRT2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Ehlers-Danlos syndrome more ...	ClinVar	PMID:10862081 more ...
Actrt2	Mouse	Goldberg-Shprintzen syndrome		ISO	ACTRT2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Shprintzen-Goldberg syndrome	ClinVar	PMID:23892090 more ...
Actrt2	Mouse	immunodeficiency 16		ISO	ACTRT2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Combined immunodeficiency due to OX40 deficiency	ClinVar	PMID:10862081 more ...
Actrt2	Mouse	immunodeficiency 38		ISO	ACTRT2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Mendelian susceptibility to mycobacterial diseases due to complete ISG15 deficiency	ClinVar	PMID:10862081 more ...
Actrt2	Mouse	Joubert syndrome 25		ISO	ACTRT2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Joubert syndrome 25	ClinVar	PMID:10862081 more ...
Actrt2	Mouse	Neurodevelopmental Disorders		ISO	ACTRT2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Actrt2	Mouse	Peroxisome Biogenesis Disorder, Complementation Group 7		ISO	ACTRT2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Peroxisome biogenesis disorder and complementation group 7	ClinVar	PMID:10862081 more ...
Actrt2	Mouse	Shprintzen-Goldberg Craniosynostosis		ISO	ACTRT2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Shprintzen-Goldberg syndrome	ClinVar	PMID:23892090 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Actrt2	Mouse	Keloid		ISO	ACTRT2 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:20128793

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Actrt2	Mouse	(S)-nicotine	decreases expression	ISO	Actrt2 (Rattus norvegicus)	6480464	Nicotine results in decreased expression of ACTRT2 mRNA	CTD	PMID:27782041
Actrt2	Mouse	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	ACTRT2 (Homo sapiens)	6480464	2 more ...	CTD	PMID:23146750
Actrt2	Mouse	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	AHR protein promotes the reaction [Tetrachlorodibenzodioxin results in decreased expression of ACTRT2 mRNA]	CTD	PMID:19759094
Actrt2	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of ACTRT2 mRNA	CTD	PMID:19759094 and PMID:21354282
Actrt2	Mouse	3,3',4,4',5-pentachlorobiphenyl	decreases expression	ISO	ACTRT2 (Homo sapiens)	6480464	3 more ...	CTD	PMID:23146750
Actrt2	Mouse	4,4'-diaminodiphenylmethane	decreases expression	EXP		6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of ACTRT2 mRNA	CTD	PMID:18648102
Actrt2	Mouse	6-propyl-2-thiouracil	decreases expression	ISO	Actrt2 (Rattus norvegicus)	6480464	Propylthiouracil results in decreased expression of ACTRT2 mRNA	CTD	PMID:24780913 and PMID:30047161
Actrt2	Mouse	acetamiprid	decreases expression	ISO	Actrt2 (Rattus norvegicus)	6480464	acetamiprid results in decreased expression of ACTRT2 mRNA	CTD	PMID:27782041
Actrt2	Mouse	benzo[a]pyrene	affects methylation	ISO	ACTRT2 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of ACTRT2 exon	CTD	PMID:27901495
Actrt2	Mouse	benzo[a]pyrene	decreases methylation	ISO	ACTRT2 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of ACTRT2 promoter	CTD	PMID:27901495
Actrt2	Mouse	bisphenol A	decreases expression	ISO	ACTRT2 (Homo sapiens)	6480464	bisphenol A results in decreased expression of ACTRT2 mRNA	CTD	PMID:23146750
Actrt2	Mouse	bisphenol A	increases methylation	ISO	Actrt2 (Rattus norvegicus)	6480464	bisphenol A results in increased methylation of ACTRT2 gene	CTD	PMID:28505145
Actrt2	Mouse	bisphenol A	decreases expression	ISO	Actrt2 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of ACTRT2 mRNA	CTD	PMID:25181051
Actrt2	Mouse	C60 fullerene	decreases expression	ISO	Actrt2 (Rattus norvegicus)	6480464	fullerene C60 results in decreased expression of ACTRT2 mRNA	CTD	PMID:19167457
Actrt2	Mouse	CGP 52608	multiple interactions	ISO	ACTRT2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to ACTRT2 gene]	CTD	PMID:28238834
Actrt2	Mouse	Cuprizon	decreases expression	ISO	Actrt2 (Rattus norvegicus)	6480464	Cuprizone results in decreased expression of ACTRT2 mRNA	CTD	PMID:27523638
Actrt2	Mouse	folic acid	decreases expression	ISO	ACTRT2 (Homo sapiens)	6480464	Folic Acid results in decreased expression of ACTRT2 mRNA	CTD	PMID:21867686
Actrt2	Mouse	methoxychlor	affects methylation	ISO	Actrt2 (Rattus norvegicus)	6480464	Methoxychlor affects the methylation of ACTRT2 gene	CTD	PMID:35440735
Actrt2	Mouse	nicotine	decreases expression	ISO	Actrt2 (Rattus norvegicus)	6480464	Nicotine results in decreased expression of ACTRT2 mRNA	CTD	PMID:27782041
Actrt2	Mouse	ozone	multiple interactions	ISO	ACTRT2 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the methylation of ACTRT2 gene	CTD	PMID:35835166
Actrt2	Mouse	perfluorooctanoic acid	decreases expression	ISO	ACTRT2 (Homo sapiens)	6480464	perfluorooctanoic acid results in decreased expression of ACTRT2 mRNA	CTD	PMID:23146750
Actrt2	Mouse	pregnenolone 16alpha-carbonitrile	decreases expression	ISO	Actrt2 (Rattus norvegicus)	6480464	Pregnenolone Carbonitrile results in decreased expression of ACTRT2 mRNA	CTD	PMID:30047161
Actrt2	Mouse	propiconazole	decreases expression	ISO	Actrt2 (Rattus norvegicus)	6480464	propiconazole results in decreased expression of ACTRT2 mRNA	CTD	PMID:30047161
Actrt2	Mouse	sodium arsenite	increases expression	ISO	ACTRT2 (Homo sapiens)	6480464	sodium arsenite results in increased expression of ACTRT2 mRNA	CTD	PMID:25879800
Actrt2	Mouse	sulfadimethoxine	decreases expression	ISO	Actrt2 (Rattus norvegicus)	6480464	Sulfadimethoxine results in decreased expression of ACTRT2 mRNA	CTD	PMID:30047161
Actrt2	Mouse	tamoxifen	decreases expression	EXP		6480464	Tamoxifen results in decreased expression of ACTRT2 mRNA	CTD	PMID:17555576
Actrt2	Mouse	titanium dioxide	decreases expression	EXP		6480464	titanium dioxide results in decreased expression of ACTRT2 mRNA	CTD	PMID:29264374
Actrt2	Mouse	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of ACTRT2 mRNA	CTD	PMID:17292431
Actrt2	Mouse	valproic acid	increases methylation	ISO	ACTRT2 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of ACTRT2 gene	CTD	PMID:29154799
Actrt2	Mouse	vinclozolin	increases methylation	ISO	Actrt2 (Rattus norvegicus)	6480464	vinclozolin results in increased methylation of ACTRT2 gene	CTD	PMID:31682807

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Actrt2	Mouse	biological_process	involved_in	ND		2290270		MGI	GO_REF:0000015

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Actrt2	Mouse	actin cytoskeleton	is_active_in	IBA	PANTHER:PTN002631484 more ...	2290270		GO_Central	GO_REF:0000033
Actrt2	Mouse	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	2290270		UniProt	GO_REF:0000043
Actrt2	Mouse	cytoskeleton	located_in	IEA	UniProtKB-SubCell:SL-0090	2290270		UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Actrt2	Mouse	molecular_function	enables	ND		2290270		MGI	GO_REF:0000015
Actrt2	Mouse	protein binding	enables	ISO	UniProtKB:Q9H2J4	9068941	PMID:33961781	IntAct	PMID:33961781

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	MGDs mouse GO annotations	MGD data from the GO Consortium
3.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10349636	PMID:11042159	PMID:11076861	PMID:12077353	PMID:12243744	PMID:12477932	PMID:15489334	PMID:16141072	PMID:16141073	PMID:21267068	PMID:21873635

Actrt2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	154,750,885 - 154,752,324 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	154,750,890 - 154,752,324 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	154,666,428 - 154,667,867 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	154,666,433 - 154,667,867 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	154,040,537 - 154,041,976 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	153,510,234 - 153,511,533 (-)	NCBI		MGSCv36	mm8
Celera	4	156,945,512 - 156,946,951 (-)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI
cM Map	4	84.69	NCBI

ACTRT2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	3,021,467 - 3,022,903 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	3,021,467 - 3,022,903 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	2,938,031 - 2,939,467 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	2,927,906 - 2,929,327 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	2,136,394 - 2,137,815 (+)	NCBI		Celera
Cytogenetic Map	1	p36.32	NCBI
HuRef	1	2,233,024 - 2,234,445 (+)	NCBI		HuRef
CHM1_1	1	2,925,090 - 2,926,511 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	2,523,087 - 2,524,523 (+)	NCBI		T2T-CHM13v2.0

Actrt2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	170,518,470 - 170,519,870 (-)	NCBI		GRCr8
mRatBN7.2	5	165,236,092 - 165,237,492 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	165,236,086 - 165,237,629 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	167,940,981 - 167,942,381 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	169,762,387 - 169,763,787 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	169,724,919 - 169,726,319 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	172,077,290 - 172,078,690 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	172,077,282 - 172,078,760 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	175,534,186 - 175,535,586 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	171,473,765 - 171,475,165 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	171,484,260 - 171,485,660 (-)	NCBI
Celera	5	163,443,936 - 163,445,336 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

Actrt2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	8,465,620 - 8,466,744 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955486	8,465,523 - 8,466,841 (-)	NCBI	ChiLan1.0	ChiLan1.0

ACTRT2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	225,297,615 - 225,299,858 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	223,942,329 - 223,944,572 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	1,680,590 - 1,682,020 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	2,818,691 - 2,820,133 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	2,818,917 - 2,820,050 (+)	Ensembl	panpan1.1		panPan2

ACTRT2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	57,659,055 - 57,660,479 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	57,659,262 - 57,660,395 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	57,671,258 - 57,672,681 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	57,861,591 - 57,863,014 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	57,861,794 - 57,862,927 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	57,852,649 - 57,854,072 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	57,745,180 - 57,746,603 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	58,135,055 - 58,136,480 (+)	NCBI		UU_Cfam_GSD_1.0

Actrt2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	28,699,309 - 28,700,931 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936737	765,125 - 766,432 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936737	765,125 - 766,432 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACTRT2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	64,664,641 - 64,665,774 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	64,664,484 - 64,665,774 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	59,253,686 - 59,255,135 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACTRT2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	128,660,029 - 128,665,485 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	128,660,121 - 128,661,254 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	32,946,475 - 32,947,937 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Actrt2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624818	7,288,304 - 7,289,434 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624818	7,288,206 - 7,289,499 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Actrt2
95 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	188
Count of miRNA genes:	181
Interacting mature miRNAs:	188
Transcripts:	ENSMUST00000060062
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
11567249	Elorr3_m	ethanol induced loss of righting response 3 (mouse)					4	3722677	156268235	Mouse
4142077	Ignpq2_m	IgA nephropathy QTL 2 (mouse)			Not determined		4	133676733	156860686	Mouse
4142139	Adip12_m	adiposity 12 (mouse)			Not determined		4	124621281	156860686	Mouse
10043996	Gct5_m	granulosa cell tumorigenesis 5 (mouse)			Not determined		4	127784226	156860686	Mouse
1301108	Scon2_m	sucrose consumption 2 (mouse)			Not determined		4	134654451	156860686	Mouse
10043985	Stheal12_m	soft tissue heal 12 (mouse)			Not determined		4	121342649	155342753	Mouse
1300858	Tafat_m	tally ho associated mesenteric fat pad weight (mouse)			Not determined		4	124621281	156860686	Mouse
1300537	Ap3q_m	alcohol preference 3 QTL (mouse)			Not determined		4	134654451	156860686	Mouse
1301982	Pltiq1_m	phospholipid transfer protein inducibility QTL 1 (mouse)			Not determined		4	124621281	156860686	Mouse
10045620	Heal22_m	wound healing/regeneration 22 (mouse)			Not determined		4	125230872	156860686	Mouse
4142481	Gct1_m	granulosa cell tumorigenesis 1 (mouse)			Not determined		4	127784226	156860686	Mouse
26884437	Sklq13_m	skull length QTL 13, 16 week (mouse)					4	57700000	155684457	Mouse
10755531	Lymph3_m	lymphocyte differential 3 (mouse)					4	124553483	156860686	Mouse
4142061	Chlq16_m	circulating hormone level QTL 16 (mouse)			Not determined		4	121342649	155342753	Mouse
11533916	Mts1_m	mammary tumor susceptibility 1 (mouse)					4	125289325	156860686	Mouse
1300933	Cdcs9_m	cytokine deficiency colitis susceptibility 9 (mouse)			Not determined		4	125230872	156860686	Mouse
1300874	Gasa2_m	gastritis type A susceptibility locus 2 (mouse)			Not determined		4	133010494	156860686	Mouse
1300621	Tpnr1_m	thermal pain response 1 (mouse)			Not determined		4	125230872	156860686	Mouse
1301452	Elsgp1_m	elevated serum gp70 1 (mouse)			Not determined		4	121342649	155342753	Mouse
1300780	Cocrb16_m	cocaine related behavior 16 (mouse)			Not determined		4	138943725	156860686	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_028513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK006772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK077010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL627127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC052344	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BU946350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY446288	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000060062 ⟹ ENSMUSP00000050377

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	154,750,890 - 154,752,324 (-)	Ensembl
GRCm38.p6 Ensembl	4	154,666,433 - 154,667,867 (-)	Ensembl

RefSeq Acc Id:

NM_028513 ⟹ NP_082789

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	154,750,885 - 154,752,324 (-)	NCBI
GRCm38	4	154,666,428 - 154,667,867 (-)	ENTREZGENE
MGSCv37	4	154,040,537 - 154,041,976 (-)	RGD
Celera	4	156,945,512 - 156,946,951 (-)	RGD
cM Map	4		ENTREZGENE

Sequence:

show sequence

GAGAGGAAAGCAGACCACCTCGGAGGATGGAGGGTTCCCGGGCACTGGGGTGGGTTTGCTAGCTGTGCCTGGGAGGCCTCCAGGAACCCTGGAATCCTGTGAACTTCCAGGGCAACCTATTGTGACAC
GAACTGGTCCAAGAAAACTCACCTGGCTGTATTTTGTGTCACCAGAAGGGATTGCCGCAGACATGTTTAACCCACTGGTACTAGATTCTCCTTCTGTGATTTTTGACAACGGATCTGGACTCTGTAAG
GCAGGACTGTCTGGGGAGATTGGGCCCCGTCATGTCACCAGCTCTGTCGTGGGGTACCCGAAGTTCAAGGCGCCCCCCACGGGAGCTAGTCAGAAGAAGTACTTTGTCGGGGAAGAAGCCCTGTACAA
ACAGGAGGCCTTGAGCCTGCACTACCCCATTGACCGGGGTCTGGTCACGAGCTGGGACGATGTGGAGAAACTCTGGAGACATCTCTTCGAATGGGAACTGGGTGTGAAGCCCTGCGAACGACCCGTGC
TCGTGACGGAACCCTCCCTGAACCCCAGGGAGAATCGCGAGAAGACGGCAGAGATGATGTTTGAGACCTTCGAGGTACCTGCCTTCTACCTGTCAGACCAGGCAGTGCTGGCGCTCTACTCCTCTGCC
TGTGTCACAGGCCTGGTGGTGGACAGTGGGGATGGGGTCACCTGCACTGTCCCCATCTATGAAGGTTACTCCCTGCCTCACGCAGTCAGCAAGCTTTACGTGGCCGGCAAAGACATCACAGAGCTCCT
CACCCGGCTGCTGCTGGCCAGTGGACGAGCCTTTCCATGCCCACTGGAAAAGGCCCTGGCGGATGACATCAAGGAGAAGCTGTGCTATGTGGCCCTGGAGCCTGAGGAGGAGCTGTCTCGGCGGGCAG
AAGATGTCTTGAGAGAGTACAAACTGCCCGACGGGAATGTCATTTACATCGGAGACCAGCTGTACCAGGCTCCTGAGGTCCTGTTCTCACCAGACCAGTTGGGCACCCATGGTCCAGGGCTGGCACAG
ATGGCATCTAACAGCATAACCAAGTGTGATGCTGACATACAGAAGACACTCTTTGGGGAGATTGTCTTGTCGGGGGGAAGCACGCTGTTTCAGGGGCTGGATGACAGGCTCCTGAAAGAACTGGAACA
GCTGGCTTCCAAGGGGGTCCCCATCAAAATCACAGCGCCGCCCGACCGCTGGTTCTCTACGTGGATCGGGGCCTCCATTGTCACGTCTCTGAGCAGCTTTAAGCAGATGTGGATCACTGCTGCAGACT
TCAAAGAGTTTGGAGTGTCCGTGGTCCAGAGGCGGTGCTTCTGAAGGGCTGCACAGTCCCAGTAGCTGCAGTGTCCCTTGCAAGGGACACCCATGGGAAGAGAGCCTCTCCCATGGCCTTTAGCACCA
CATTTAATTAAAGATGAATAGTGATACACTTG

hide sequence


Protein RefSeqs	NP_082789	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH52344	(Get FASTA)	NCBI Sequence Viewer
	BAB24733	(Get FASTA)	NCBI Sequence Viewer
	EDL14976	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000050377
	ENSMUSP00000050377.4
GenBank Protein	Q9D9L5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_082789 ⟸ NM_028513

- UniProtKB:

Q9D9L5 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MFNPLVLDSPSVIFDNGSGLCKAGLSGEIGPRHVTSSVVGYPKFKAPPTGASQKKYFVGEEALYKQEALSLHYPIDRGLVTSWDDVEKLWRHLFEWELGVKPCERPVLVTEPSLNPRENREKTAEMMF
ETFEVPAFYLSDQAVLALYSSACVTGLVVDSGDGVTCTVPIYEGYSLPHAVSKLYVAGKDITELLTRLLLASGRAFPCPLEKALADDIKEKLCYVALEPEEELSRRAEDVLREYKLPDGNVIYIGDQL
YQAPEVLFSPDQLGTHGPGLAQMASNSITKCDADIQKTLFGEIVLSGGSTLFQGLDDRLLKELEQLASKGVPIKITAPPDRWFSTWIGASIVTSLSSFKQMWITAADFKEFGVSVVQRRCF

hide sequence

Ensembl Acc Id:

ENSMUSP00000050377 ⟸ ENSMUST00000060062

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9D9L5-F1-model_v2	AlphaFold	Q9D9L5	1-377	view protein structure

RGD ID:

6885738

Promoter ID:

EPDNEW_M6320

Type:

multiple initiation site

Name:

Actrt2_1

Description:

Mus musculus actin-related protein T2 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	4	154,667,867 - 154,667,927	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000051276	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000060062	ENTREZGENE
	ENSMUST00000060062.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.420.40	UniProtKB/Swiss-Prot
	Actin, Chain A, domain 4	UniProtKB/Swiss-Prot
InterPro	Actin	UniProtKB/Swiss-Prot
	Actin/actin-like_CS	UniProtKB/Swiss-Prot
	ATPase_NBD	UniProtKB/Swiss-Prot
KEGG Report	mmu:73353	UniProtKB/Swiss-Prot
MGD	MGI:1920603	ENTREZGENE
NCBI Gene	73353	ENTREZGENE
PANTHER	PTHR11937	UniProtKB/Swiss-Prot
Pfam	Actin	UniProtKB/Swiss-Prot
PhenoGen	Actrt2	PhenoGen
PRINTS	ACTIN	UniProtKB/Swiss-Prot
PROSITE	ACTINS_ACT_LIKE	UniProtKB/Swiss-Prot
SMART	ACTIN	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF53067	UniProtKB/Swiss-Prot
UniProt	ACTT2_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD