Symbol:
Cbln1
Name:
cerebellin 1 precursor protein
RGD ID:
1557010
MGI Page
MGI
Description:
Enables identical protein binding activity. Involved in several processes, including cerebellar granule cell differentiation; heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules; and regulation of synapse assembly. Acts upstream of or within establishment of localization in cell; positive regulation of synapse assembly; and protein secretion. Located in extracellular region and postsynaptic membrane. Is active in glutamatergic synapse; parallel fiber to Purkinje cell synapse; and synaptic cleft. Is expressed in several structures, including central nervous system; limb; oral region epithelium; reproductive system; and sensory organ. Orthologous to human CBLN1 (cerebellin 1 precursor).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AI323299; brain protein D3; cerebellin-1; precerebellin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CBLN1 (cerebellin 1 precursor) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Cbln1 (cerebellin 1 precursor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cbln1 (cerebellin 1 precursor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CBLN1 (cerebellin 1 precursor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CBLN1 (cerebellin 1 precursor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cbln1 (cerebellin 1 precursor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CBLN1 (cerebellin 1 precursor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CBLN1 (cerebellin 1 precursor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cbln1 (cerebellin 1 precursor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CBLN2 (cerebellin 2 precursor) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
CBLN1 (cerebellin 1 precursor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Cbln1 (cerebellin 1 precursor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cbln1 (cerebellin 1 precursor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cbln1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 88,195,481 - 88,199,220 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 88,195,033 - 88,199,237 (-) Ensembl GRCm39 Ensembl GRCm38 8 87,468,853 - 87,472,592 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 87,468,405 - 87,472,609 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 89,992,752 - 89,996,491 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 90,358,972 - 90,362,401 (-) NCBI MGSCv36 mm8 Celera 8 91,733,788 - 91,737,188 (-) NCBI Celera Cytogenetic Map 8 C3 NCBI cM Map 8 42.16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cbln1 Mouse (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of CBLN1 mRNA CTD PMID:21955143 Cbln1 Mouse 17beta-estradiol increases expression ISO RGD:1348062 6480464 Estradiol results in increased expression of CBLN1 mRNA CTD PMID:36828454 Cbln1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:1348062 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of CBLN1 mRNA CTD PMID:31326446 Cbln1 Mouse 3,3',5,5'-tetrabromobisphenol A increases expression ISO RGD:1348062 6480464 tetrabromobisphenol A results in increased expression of CBLN1 mRNA CTD PMID:31326446 Cbln1 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of CBLN1 mRNA CTD PMID:30951980 Cbln1 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of CBLN1 gene CTD PMID:31683443 Cbln1 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of CBLN1 mRNA CTD PMID:28973697 Cbln1 Mouse 6-propyl-2-thiouracil increases expression ISO RGD:1562813 6480464 Propylthiouracil results in increased expression of CBLN1 mRNA CTD PMID:24780913 Cbln1 Mouse acrylamide increases expression ISO RGD:1562813 6480464 Acrylamide results in increased expression of CBLN1 mRNA CTD PMID:28959563 Cbln1 Mouse aflatoxin B1 decreases methylation ISO RGD:1348062 6480464 Aflatoxin B1 results in decreased methylation of CBLN1 gene CTD PMID:27153756 Cbln1 Mouse all-trans-retinoic acid decreases expression ISO RGD:1562813 6480464 Tretinoin results in decreased expression of CBLN1 mRNA CTD PMID:20488242 Cbln1 Mouse all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of CBLN1 mRNA CTD PMID:36189433 Cbln1 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of CBLN1 mRNA CTD PMID:36189433 Cbln1 Mouse alpha-Zearalanol multiple interactions ISO RGD:1562813 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CBLN1 mRNA CTD PMID:35163327 Cbln1 Mouse arsenite(3-) increases methylation ISO RGD:1348062 6480464 arsenite results in increased methylation of CBLN1 promoter CTD PMID:23974009 Cbln1 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of CBLN1 mRNA CTD PMID:27195522 Cbln1 Mouse benzo[a]pyrene increases methylation ISO RGD:1348062 6480464 Benzo(a)pyrene results in increased methylation of CBLN1 5' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Cbln1 Mouse bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1348062 6480464 Diethylhexyl Phthalate results in decreased expression of CBLN1 mRNA CTD PMID:31163220 Cbln1 Mouse bisphenol A decreases expression ISO RGD:1562813 6480464 bisphenol A results in decreased expression of CBLN1 mRNA CTD PMID:25181051 Cbln1 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CBLN1 mRNA CTD PMID:32156529 Cbln1 Mouse bisphenol A increases expression ISO RGD:1348062 6480464 bisphenol A results in increased expression of CBLN1 mRNA CTD PMID:32028606|PMID:36828454 Cbln1 Mouse bisphenol A multiple interactions ISO RGD:1562813 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of CBLN1 mRNA CTD PMID:31129395 Cbln1 Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of CBLN1 mRNA CTD PMID:30951980 Cbln1 Mouse bisphenol F increases methylation ISO RGD:1348062 6480464 bisphenol F results in increased methylation of CBLN1 gene CTD PMID:31601247 Cbln1 Mouse carbamazepine affects expression ISO RGD:1348062 6480464 Carbamazepine affects the expression of CBLN1 mRNA CTD PMID:25979313 Cbln1 Mouse CGP 52608 multiple interactions ISO RGD:1348062 6480464 CGP 52608 promotes the reaction [RORA protein binds to CBLN1 gene] CTD PMID:28238834 Cbln1 Mouse cocaine multiple interactions EXP 6480464 [Cocaine co-treated with FOS protein mutant form] results in increased expression of CBLN1 mRNA CTD PMID:18355967 Cbln1 Mouse copper atom decreases expression ISO RGD:1562813 6480464 Copper results in decreased expression of CBLN1 mRNA CTD PMID:30556269 Cbln1 Mouse copper(0) decreases expression ISO RGD:1562813 6480464 Copper results in decreased expression of CBLN1 mRNA CTD PMID:30556269 Cbln1 Mouse Cuprizon affects expression ISO RGD:1562813 6480464 Cuprizone affects the expression of CBLN1 mRNA CTD PMID:26577399 Cbln1 Mouse DDT decreases expression ISO RGD:1562813 6480464 DDT results in decreased expression of CBLN1 mRNA CTD PMID:30207508 Cbln1 Mouse decabromodiphenyl ether increases expression ISO RGD:1348062 6480464 decabromobiphenyl ether results in increased expression of CBLN1 mRNA CTD PMID:31326446 Cbln1 Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of CBLN1 mRNA CTD PMID:17361019|PMID:21266533 Cbln1 Mouse dicyclanil increases expression EXP 6480464 dicyclanil results in increased expression of CBLN1 mRNA CTD PMID:15664270 Cbln1 Mouse dorsomorphin multiple interactions ISO RGD:1348062 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Cbln1 Mouse entinostat multiple interactions ISO RGD:1348062 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Cbln1 Mouse entinostat increases expression ISO RGD:1348062 6480464 entinostat results in increased expression of CBLN1 mRNA CTD PMID:26272509 Cbln1 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of CBLN1 mRNA CTD PMID:21955143 Cbln1 Mouse fenvalerate increases expression ISO RGD:1562813 6480464 fenvalerate results in increased expression of CBLN1 mRNA CTD PMID:30307764 Cbln1 Mouse flusilazole decreases expression ISO RGD:1562813 6480464 flusilazole results in decreased expression of CBLN1 mRNA CTD PMID:28263823 Cbln1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of CBLN1 mRNA CTD PMID:25629700 Cbln1 Mouse fulvestrant increases methylation ISO RGD:1348062 6480464 Fulvestrant results in increased methylation of CBLN1 gene CTD PMID:31601247 Cbln1 Mouse leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of CBLN1 mRNA CTD PMID:19751817 Cbln1 Mouse mono(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of CBLN1 mRNA CTD PMID:36189433 Cbln1 Mouse morphine decreases expression EXP 6480464 Morphine results in decreased expression of CBLN1 mRNA CTD PMID:21955143 Cbln1 Mouse nicotine increases expression EXP 6480464 Nicotine results in increased expression of CBLN1 mRNA CTD PMID:21955143 Cbln1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of CBLN1 mRNA CTD PMID:17562736 Cbln1 Mouse perfluorooctanoic acid multiple interactions ISO RGD:1562813 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CBLN1 mRNA CTD PMID:35163327 Cbln1 Mouse SB 431542 multiple interactions ISO RGD:1348062 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Cbln1 Mouse sodium arsenite affects methylation ISO RGD:1348062 6480464 sodium arsenite affects the methylation of CBLN1 gene CTD PMID:28589171 Cbln1 Mouse Soman increases expression ISO RGD:1562813 6480464 Soman results in increased expression of CBLN1 mRNA CTD PMID:19281266 Cbln1 Mouse sunitinib increases expression ISO RGD:1348062 6480464 Sunitinib results in increased expression of CBLN1 mRNA CTD PMID:31533062 Cbln1 Mouse Tetrachlorobisphenol A increases expression ISO RGD:1348062 6480464 tetrachlorodian results in increased expression of CBLN1 mRNA CTD PMID:31326446 Cbln1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of CBLN1 gene CTD PMID:35295148 Cbln1 Mouse tributylstannane multiple interactions ISO RGD:1562813 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of CBLN1 mRNA CTD PMID:31129395 Cbln1 Mouse trichostatin A increases expression ISO RGD:1348062 6480464 trichostatin A results in increased expression of CBLN1 mRNA CTD PMID:24935251 Cbln1 Mouse triclosan increases expression ISO RGD:1348062 6480464 Triclosan results in increased expression of CBLN1 mRNA CTD PMID:30510588 Cbln1 Mouse valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of CBLN1 mRNA CTD PMID:21427059 Cbln1 Mouse valproic acid affects expression ISO RGD:1348062 6480464 Valproic Acid affects the expression of CBLN1 mRNA CTD PMID:25979313 Cbln1 Mouse valproic acid increases expression ISO RGD:1348062 6480464 Valproic Acid results in increased expression of CBLN1 mRNA CTD PMID:23179753|PMID:24935251|PMID:25192806|PMID:27188386|PMID:28001369 Cbln1 Mouse vinclozolin decreases expression ISO RGD:1562813 6480464 vinclozolin results in decreased expression of CBLN1 mRNA CTD PMID:30207508 Cbln1 Mouse zearalenone increases expression ISO RGD:1348062 6480464 Zearalenone results in increased expression of CBLN1 mRNA CTD PMID:36828454
(S)-nicotine (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (EXP) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) alpha-Zearalanol (ISO) arsenite(3-) (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) carbamazepine (ISO) CGP 52608 (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) Cuprizon (ISO) DDT (ISO) decabromodiphenyl ether (ISO) dibutyl phthalate (EXP) dicyclanil (EXP) dorsomorphin (ISO) entinostat (ISO) ethanol (EXP) fenvalerate (ISO) flusilazole (ISO) folic acid (EXP) fulvestrant (ISO) leflunomide (EXP) mono(2-ethylhexyl) phthalate (EXP) morphine (EXP) nicotine (EXP) paracetamol (EXP) perfluorooctanoic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) Soman (ISO) sunitinib (ISO) Tetrachlorobisphenol A (ISO) titanium dioxide (EXP) tributylstannane (ISO) trichostatin A (ISO) triclosan (ISO) valproic acid (EXP,ISO) vinclozolin (ISO) zearalenone (ISO)
Biological Process
cerebellar granule cell differentiation (IGI) establishment of localization in cell (IMP) heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules (IGI) maintenance of synapse structure (IBA,IMP) negative regulation of excitatory postsynaptic potential (IEA,ISO) negative regulation of inhibitory synapse assembly (IMP) positive regulation of long-term synaptic depression (IEA,ISO) positive regulation of synapse assembly (IDA,IGI) protein secretion (IMP) regulation of postsynaptic density assembly (IDA,IMP) regulation of presynapse assembly (IDA,IMP) synapse assembly (IDA,IGI) synapse organization (IMP) trans-synaptic signaling, modulating synaptic transmission (IDA,IEP,IMP)
Cbln1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 88,195,481 - 88,199,220 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 88,195,033 - 88,199,237 (-) Ensembl GRCm39 Ensembl GRCm38 8 87,468,853 - 87,472,592 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 87,468,405 - 87,472,609 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 89,992,752 - 89,996,491 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 90,358,972 - 90,362,401 (-) NCBI MGSCv36 mm8 Celera 8 91,733,788 - 91,737,188 (-) NCBI Celera Cytogenetic Map 8 C3 NCBI cM Map 8 42.16 NCBI
CBLN1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 49,277,917 - 49,281,838 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 49,277,917 - 49,281,838 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 49,311,828 - 49,315,749 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 47,870,196 - 47,873,193 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 47,870,201 - 47,873,184 NCBI Celera 16 33,823,798 - 33,827,712 (-) NCBI Celera Cytogenetic Map 16 q12.1 NCBI HuRef 16 35,201,971 - 35,205,448 (-) NCBI HuRef CHM1_1 16 50,718,736 - 50,722,650 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 55,075,687 - 55,079,608 (-) NCBI T2T-CHM13v2.0
Cbln1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 35,782,151 - 35,785,960 (+) NCBI GRCr8 mRatBN7.2 19 19,608,763 - 19,612,572 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 19,608,716 - 19,612,572 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 21,288,213 - 21,292,022 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 26,482,719 - 26,486,528 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 29,446,719 - 29,450,528 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 20,607,507 - 20,611,316 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 20,607,507 - 20,611,316 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 31,617,915 - 31,621,724 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 20,941,254 - 20,945,063 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 19 19,489,280 - 19,493,089 (+) NCBI Celera Cytogenetic Map 19 p11 NCBI
Cbln1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 7,516,487 - 7,519,929 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 7,516,487 - 7,519,929 (-) NCBI ChiLan1.0 ChiLan1.0
CBLN1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 58,733,418 - 58,736,757 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 64,638,723 - 64,642,070 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 29,538,723 - 29,542,625 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 48,427,645 - 48,430,508 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 48,427,645 - 48,430,512 (-) Ensembl panpan1.1 panPan2
CBLN1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 65,974,989 - 65,978,464 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 65,974,981 - 65,977,179 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 62,551,600 - 62,555,146 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 66,525,421 - 66,528,966 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 66,525,139 - 66,528,947 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 63,348,394 - 63,352,176 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 64,368,563 - 64,372,103 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 65,256,811 - 65,260,596 (+) NCBI UU_Cfam_GSD_1.0
Cbln1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 57,092,332 - 57,095,795 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 2,494,156 - 2,496,743 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 2,493,280 - 2,496,738 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CBLN1
CBLN1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 35,068,087 - 35,075,215 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 35,071,051 - 35,075,159 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 41,428,097 - 41,431,375 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cbln1
.
Predicted Target Of
Count of predictions: 971 Count of miRNA genes: 340 Interacting mature miRNAs: 400 Transcripts: ENSMUST00000034076, ENSMUST00000169693 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10043992 Hbnr11_m Heligmosomoides bakeri nematode resistance 11 (mouse) Not determined 8 66326836 100326976 Mouse 1301013 Capsq4_m capsaicin sensitivity related QTL 4 (mouse) Not determined 8 36630154 93455280 Mouse 12904012 Cfq10_m conditioned fear QTL 10 (mouse) 8 80793404 89740987 Mouse 11353828 Gf7_m gonadal fat pad weight 7 (mouse) 8 58928107 92928107 Mouse 1357470 Obq16_m obesity QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 1357787 Vtbt5_m vertebral trabecular bone trait 5 (mouse) Not determined 8 66084397 100084549 Mouse 1301506 Aevm1_m autoimmune extremity vasculitis in MRL mice 1 (mouse) Not determined 8 54740461 88740637 Mouse 1301952 Im3_m immunoregulatory 3 (mouse) Not determined 8 55159258 89159407 Mouse 1301767 Fcsa2_m femoral cross-sectional area 2 (mouse) Not determined 8 71032003 105032123 Mouse 10412234 Nhdlq14_m non-HDL QTL 14 (mouse) Not determined 8 76411976 110412125 Mouse 1301766 Desp1_m despair 1 (mouse) Not determined 8 85486208 119486373 Mouse 1301253 Skmw2_m skeletal muscle weight 2 (mouse) Not determined 8 86443553 120443701 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 1357708 Orq1_m ovulation rate QTL 1 (mouse) Not determined 8 71740461 124622354 Mouse 4141285 Tgq18_m triglyceride QTL 18 (mouse) Not determined 64186736 98186736 Mouse 4141797 Skmw16_m skeletal muscle weight 16 (mouse) Not determined 8 64666176 98666325 Mouse 10755519 Wbc1_m white blood cell count 1 (mouse) 8 82345783 116345783 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 10043975 Obq31_m obesity QTL 31 (mouse) Not determined 8 59136404 93136404 Mouse 1301581 Char2_m P. chabaudi malaria resistance QTL 2 (mouse) Not determined 8 79808806 113809031 Mouse 10412287 Carg3_m Candida albicans resistance gene 3 (mouse) Not determined 8 56298872 90298872 Mouse 1301874 Hdlq16_m HDL QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1301872 Cd4ts3_m CD4 T cell subset 3 (mouse) Not determined 8 72122809 106123021 Mouse 10045619 Heal14_m wound healing/regeneration 14 (mouse) Not determined 8 86443553 120443701 Mouse 1301688 Orch6_m autoimmune orchitis resistance 6 (mouse) Not determined 8 61513479 95513605 Mouse 1558780 Idd22_m insulin dependent diabetes susceptibility 22 (mouse) Not determined 8 71829531 105829637 Mouse 1300920 Pitm3_m prion incubation time 3 (mouse) Not determined 8 73929123 107929226 Mouse 12904744 Carcdq1_m cardiac collagen deposition QTL 1 (mouse) 8 40162297 95416226 Mouse 4141395 Char2a_m P. chabaudi malaria resistance QTL 2a (mouse) Not determined 71589427 90929226 Mouse 10755530 Wbc2_m white blood cell count 2 (mouse) 8 81819296 115819296 Mouse 1302049 Heal1_m wound healing/regeneration 1 (mouse) Not determined 8 86443553 120443701 Mouse 4142283 Imraq2_m immune response to AAV2 QTL 2 (mouse) Not determined 8 71032003 105032123 Mouse 27095912 Pglq14_m pelvic girdle length QTL 14, 16 week (mouse) 8 74126628 126826739 Mouse 4142023 W3q5_m weight 3 weeks QTL 5 (mouse) Not determined 71740461 124622354 Mouse 1301099 Cbm2_m cerebellum weight 2 (mouse) Not determined 8 79245241 113245331 Mouse 1558890 Lith18_m lithogenic gene 18 (mouse) Not determined 8 76402145 110402251 Mouse
Cbln1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 87,469,461 - 87,469,576 UniSTS GRCm38 MGSCv37 8 89,993,360 - 89,993,475 UniSTS GRCm37 Celera 8 91,734,396 - 91,734,511 UniSTS Cytogenetic Map 8 C3 UniSTS cM Map 8 40.0 UniSTS cM Map 8 40.0 UniSTS
AI323299
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 87,469,028 - 87,469,175 UniSTS GRCm38 MGSCv37 8 89,992,927 - 89,993,074 UniSTS GRCm37 Celera 8 91,733,963 - 91,734,110 UniSTS Cytogenetic Map 8 C3 UniSTS cM Map 8 40.0 UniSTS Whitehead/MRC_RH 8 1036.76 UniSTS
RH142530
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 87,470,927 - 87,471,085 UniSTS GRCm38 MGSCv37 8 89,994,826 - 89,994,984 UniSTS GRCm37 Celera 8 91,735,862 - 91,736,020 UniSTS Cytogenetic Map 8 C3 UniSTS cM Map 8 40.0 UniSTS
Cbln1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 87,468,918 - 87,469,106 UniSTS GRCm38 MGSCv37 8 89,992,817 - 89,993,005 UniSTS GRCm37 Celera 8 91,733,853 - 91,734,041 UniSTS Cytogenetic Map 8 C3 UniSTS cM Map 8 40.0 UniSTS
Cbln1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 C3 UniSTS
Cbln1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 87,470,336 - 87,471,780 UniSTS GRCm38 MGSCv37 8 89,994,235 - 89,995,679 UniSTS GRCm37 Celera 8 91,735,271 - 91,736,715 UniSTS Cytogenetic Map 8 C3 UniSTS
Cbln1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 C3 UniSTS
Cbln1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 87,470,230 - 87,470,977 UniSTS GRCm38 MGSCv37 8 89,994,129 - 89,994,876 UniSTS GRCm37 Celera 8 91,735,165 - 91,735,912 UniSTS Cytogenetic Map 8 C3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000034076 ⟹ ENSMUSP00000034076
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 88,195,033 - 88,199,237 (-) Ensembl GRCm38.p6 Ensembl 8 87,468,405 - 87,472,609 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000169693 ⟹ ENSMUSP00000126575
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 88,195,866 - 88,199,014 (-) Ensembl GRCm38.p6 Ensembl 8 87,469,238 - 87,472,386 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000211279
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 88,195,495 - 88,197,696 (-) Ensembl GRCm38.p6 Ensembl 8 87,468,867 - 87,471,068 (-) Ensembl
RefSeq Acc Id:
NM_019626 ⟹ NP_062600
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 88,195,481 - 88,199,220 (-) NCBI GRCm38 8 87,468,853 - 87,472,592 (-) ENTREZGENE MGSCv37 8 89,992,752 - 89,996,491 (-) RGD Celera 8 91,733,788 - 91,737,188 (-) RGD cM Map 8 ENTREZGENE
Sequence:
TCCGCCCGCTCCGGCTGCAGCGCCCGCTGCATCAATAATTCAGAGCGGCGGCGGCAGCAGCAGCGGCGAGTGCGGACAGGAGGCGGCGGCAACAGCGGGGACCAGGCAGCAGAGGCTATGCATCCAAG
hide sequence
RefSeq Acc Id:
NP_062600 ⟸ NM_019626
- Peptide Label:
precursor
- UniProtKB:
P28655 (UniProtKB/Swiss-Prot), Q9QVT5 (UniProtKB/Swiss-Prot), Q9R171 (UniProtKB/Swiss-Prot), Q7TNF5 (UniProtKB/TrEMBL), A2RSI1 (UniProtKB/TrEMBL), Q80W16 (UniProtKB/TrEMBL)
- Sequence:
MLGVVELLLLGTAWLAGPARGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQ
hide sequence
Ensembl Acc Id:
ENSMUSP00000034076 ⟸ ENSMUST00000034076
Ensembl Acc Id:
ENSMUSP00000126575 ⟸ ENSMUST00000169693
RGD ID: 8667791 Promoter ID: EPDNEW_M11927 Type: initiation region Name: Cbln1_1 Description: Mus musculus cerebellin 1 precursor protein , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 87,472,551 - 87,472,611 EPDNEW
RGD ID: 6842897 Promoter ID: MM_KWN:55188 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: NM_019626, UC009MQQ.1, UC009MQS.1, XM_001474448_GM2694 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 89,996,611 - 89,997,262 (-) MPROMDB
