Symbol:
Als2cl
Name:
ALS2 C-terminal like
RGD ID:
1553626
MGI Page
MGI
Description:
Enables small GTPase binding activity. Acts upstream of or within protein localization. Located in cytoplasmic vesicle. Orthologous to human ALS2CL (ALS2 C-terminal like).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
79H19D; 79H19E; ALS2 C-terminal-like protein; BC022645; D930044G19Rik; mFLJ00189 protein; mRn.490; mRn.49018
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ALS2CL (ALS2 C-terminal like) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Als2cl (ALS2 C-terminal like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Als2cl (ALS2 C-terminal like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ALS2CL (ALS2 C-terminal like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ALS2CL (ALS2 C-terminal like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Als2cl (ALS2 C-terminal like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ALS2CL (ALS2 C-terminal like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ALS2CL (ALS2 C-terminal like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Als2cl (ALS2 C-terminal like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Als2cl (ALS2 C-terminal like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ALS2CL (ALS2 C-terminal like)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Als2
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
als2cl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gal.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 110,709,203 - 110,729,598 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 110,708,938 - 110,729,598 (+) Ensembl GRCm39 Ensembl GRCm38 9 110,880,120 - 110,900,530 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 110,879,870 - 110,900,530 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 110,782,678 - 110,803,034 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 110,724,990 - 110,745,340 (+) NCBI MGSCv36 mm8 Celera 9 110,606,134 - 110,626,473 (+) NCBI Celera Cytogenetic Map 9 F2 NCBI cM Map 9 60.79 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Als2cl Mouse 1,2-dichloroethane increases expression EXP 6480464 ethylene dichloride results in increased expression of ALS2CL mRNA CTD PMID:28189721 and PMID:28960355 Als2cl Mouse 1,2-dimethylhydrazine affects expression EXP 6480464 1 and 2-Dimethylhydrazine affects the expression of ALS2CL mRNA CTD PMID:22206623 Als2cl Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ALS2CL mRNA CTD PMID:39298647 Als2cl Mouse 17beta-estradiol increases expression ISO ALS2CL (Homo sapiens) 6480464 Estradiol results in increased expression of ALS2CL mRNA CTD PMID:31614463 Als2cl Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO Als2cl (Rattus norvegicus) 6480464 2 more ... CTD PMID:27291303 Als2cl Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ALS2CL (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ALS2CL mRNA CTD PMID:22903824 Als2cl Mouse 2-hydroxypropanoic acid increases expression ISO ALS2CL (Homo sapiens) 6480464 Lactic Acid results in increased expression of ALS2CL mRNA CTD PMID:30851411 Als2cl Mouse 2-palmitoylglycerol increases expression ISO ALS2CL (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of ALS2CL mRNA CTD PMID:37199045 Als2cl Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ALS2CL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ALS2CL mRNA CTD PMID:28628672 Als2cl Mouse 4,4'-sulfonyldiphenol multiple interactions ISO ALS2CL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ALS2CL mRNA CTD PMID:28628672 Als2cl Mouse 4,4'-sulfonyldiphenol affects expression EXP 6480464 bisphenol S affects the expression of ALS2CL mRNA CTD PMID:39298647 Als2cl Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of ALS2CL mRNA CTD PMID:30951980 Als2cl Mouse actinomycin D increases expression ISO ALS2CL (Homo sapiens) 6480464 Dactinomycin results in increased expression of ALS2CL mRNA CTD PMID:38460933 Als2cl Mouse actinomycin D multiple interactions ISO ALS2CL (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of ALS2CL mRNA CTD PMID:38460933 Als2cl Mouse adefovir pivoxil increases expression ISO ALS2CL (Homo sapiens) 6480464 adefovir dipivoxil results in increased expression of ALS2CL mRNA CTD PMID:25596134 Als2cl Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ALS2CL mRNA CTD PMID:19770486 Als2cl Mouse benzo[a]pyrene decreases methylation ISO ALS2CL (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ALS2CL 5' UTR CTD PMID:27901495 Als2cl Mouse benzo[a]pyrene affects methylation ISO ALS2CL (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ALS2CL promoter CTD PMID:27901495 Als2cl Mouse beta-lapachone decreases expression ISO ALS2CL (Homo sapiens) 6480464 beta-lapachone results in decreased expression of ALS2CL mRNA CTD PMID:38218311 Als2cl Mouse beta-lapachone increases expression ISO ALS2CL (Homo sapiens) 6480464 beta-lapachone results in increased expression of ALS2CL mRNA CTD PMID:38218311 Als2cl Mouse bisphenol A decreases expression ISO Als2cl (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of ALS2CL mRNA CTD PMID:25181051 more ... Als2cl Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ALS2CL mRNA CTD PMID:33221593 Als2cl Mouse bisphenol A affects expression ISO Als2cl (Rattus norvegicus) 6480464 bisphenol A affects the expression of ALS2CL mRNA CTD PMID:30816183 Als2cl Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of ALS2CL mRNA CTD PMID:38685157 Als2cl Mouse bromobenzene increases expression ISO Als2cl (Rattus norvegicus) 6480464 bromobenzene results in increased expression of ALS2CL mRNA CTD PMID:32479839 Als2cl Mouse C60 fullerene increases expression ISO Als2cl (Rattus norvegicus) 6480464 fullerene C60 results in increased expression of ALS2CL mRNA CTD PMID:19167457 Als2cl Mouse cadmium dichloride increases expression ISO ALS2CL (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ALS2CL mRNA CTD PMID:38568856 Als2cl Mouse calcitriol multiple interactions ISO ALS2CL (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of ALS2CL mRNA CTD PMID:21592394 Als2cl Mouse calcitriol increases expression ISO ALS2CL (Homo sapiens) 6480464 Calcitriol results in increased expression of ALS2CL mRNA CTD PMID:21592394 and PMID:26485663 Als2cl Mouse camptothecin increases expression ISO ALS2CL (Homo sapiens) 6480464 Camptothecin results in increased expression of ALS2CL mRNA CTD PMID:38460933 Als2cl Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of ALS2CL mRNA CTD PMID:25620056 Als2cl Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Als2cl Mouse chloroacetaldehyde affects expression ISO ALS2CL (Homo sapiens) 6480464 chloroacetaldehyde affects the expression of ALS2CL mRNA CTD PMID:25596134 Als2cl Mouse chrysene increases expression EXP 6480464 chrysene results in increased expression of ALS2CL mRNA CTD PMID:26377693 Als2cl Mouse cidofovir anhydrous affects expression ISO ALS2CL (Homo sapiens) 6480464 Cidofovir affects the expression of ALS2CL mRNA CTD PMID:25596134 Als2cl Mouse cisplatin affects expression ISO ALS2CL (Homo sapiens) 6480464 Cisplatin affects the expression of ALS2CL mRNA CTD PMID:25596134 Als2cl Mouse cisplatin increases expression ISO ALS2CL (Homo sapiens) 6480464 Cisplatin results in increased expression of ALS2CL mRNA CTD PMID:27392435 Als2cl Mouse cisplatin multiple interactions ISO ALS2CL (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ALS2CL mRNA CTD PMID:27392435 Als2cl Mouse clodronic acid affects expression ISO ALS2CL (Homo sapiens) 6480464 Clodronic Acid affects the expression of ALS2CL mRNA CTD PMID:25596134 Als2cl Mouse cobalt dichloride increases expression ISO Als2cl (Rattus norvegicus) 6480464 cobaltous chloride results in increased expression of ALS2CL mRNA CTD PMID:24386269 Als2cl Mouse copper(II) sulfate increases expression ISO ALS2CL (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ALS2CL mRNA CTD PMID:19549813 Als2cl Mouse cyclosporin A increases expression ISO ALS2CL (Homo sapiens) 6480464 Cyclosporine results in increased expression of ALS2CL mRNA CTD PMID:25596134 and PMID:27989131 Als2cl Mouse dexamethasone multiple interactions ISO ALS2CL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ALS2CL mRNA CTD PMID:28628672 Als2cl Mouse dioxygen decreases expression ISO ALS2CL (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of ALS2CL mRNA CTD PMID:25596134 Als2cl Mouse doxorubicin decreases expression ISO ALS2CL (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ALS2CL mRNA CTD PMID:29803840 Als2cl Mouse elemental selenium increases expression ISO ALS2CL (Homo sapiens) 6480464 Selenium results in increased expression of ALS2CL mRNA CTD PMID:19244175 Als2cl Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of ALS2CL mRNA CTD PMID:30319688 Als2cl Mouse ethylparaben increases expression ISO ALS2CL (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of ALS2CL mRNA CTD PMID:37690743 Als2cl Mouse flutamide increases expression ISO Als2cl (Rattus norvegicus) 6480464 Flutamide results in increased expression of ALS2CL mRNA CTD PMID:24136188 Als2cl Mouse ifosfamide affects expression ISO ALS2CL (Homo sapiens) 6480464 Ifosfamide affects the expression of ALS2CL mRNA CTD PMID:25596134 Als2cl Mouse indometacin multiple interactions ISO ALS2CL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ALS2CL mRNA CTD PMID:28628672 Als2cl Mouse leflunomide increases expression ISO Als2cl (Rattus norvegicus) 6480464 leflunomide results in increased expression of ALS2CL mRNA CTD PMID:24136188 Als2cl Mouse methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of ALS2CL mRNA CTD PMID:26307267 Als2cl Mouse methapyrilene decreases expression ISO Als2cl (Rattus norvegicus) 6480464 Methapyrilene results in decreased expression of ALS2CL mRNA CTD PMID:30467583 Als2cl Mouse Nutlin-3 multiple interactions ISO ALS2CL (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of ALS2CL mRNA CTD PMID:38460933 Als2cl Mouse orphenadrine affects expression ISO Als2cl (Rattus norvegicus) 6480464 Orphenadrine affects the expression of ALS2CL mRNA CTD PMID:23665939 Als2cl Mouse oxaliplatin decreases expression ISO Als2cl (Rattus norvegicus) 6480464 oxaliplatin results in decreased expression of ALS2CL mRNA CTD PMID:25729387 Als2cl Mouse oxaliplatin multiple interactions ISO Als2cl (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ALS2CL mRNA CTD PMID:25729387 Als2cl Mouse perfluorooctanoic acid increases expression ISO ALS2CL (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of ALS2CL mRNA CTD PMID:36326898 Als2cl Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of ALS2CL mRNA CTD PMID:18301758 and PMID:18445702 Als2cl Mouse rac-lactic acid increases expression ISO ALS2CL (Homo sapiens) 6480464 Lactic Acid results in increased expression of ALS2CL mRNA CTD PMID:30851411 Als2cl Mouse selenium atom increases expression ISO ALS2CL (Homo sapiens) 6480464 Selenium results in increased expression of ALS2CL mRNA CTD PMID:19244175 Als2cl Mouse sodium arsenite increases expression ISO ALS2CL (Homo sapiens) 6480464 sodium arsenite results in increased expression of ALS2CL mRNA CTD PMID:38568856 Als2cl Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ALS2CL mRNA CTD PMID:36209798 Als2cl Mouse sodium arsenite decreases expression ISO ALS2CL (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ALS2CL mRNA CTD PMID:34032870 Als2cl Mouse testosterone multiple interactions ISO ALS2CL (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of ALS2CL mRNA CTD PMID:21592394 Als2cl Mouse testosterone increases expression ISO ALS2CL (Homo sapiens) 6480464 Testosterone results in increased expression of ALS2CL mRNA CTD PMID:21592394 Als2cl Mouse tetraphene affects expression EXP 6480464 benz(a)anthracene affects the expression of ALS2CL mRNA CTD PMID:26377693 Als2cl Mouse thioacetamide increases expression ISO Als2cl (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of ALS2CL mRNA CTD PMID:34492290 Als2cl Mouse thiram increases expression ISO ALS2CL (Homo sapiens) 6480464 Thiram results in increased expression of ALS2CL mRNA CTD PMID:38568856 Als2cl Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of ALS2CL promoter CTD PMID:35295148 Als2cl Mouse topotecan decreases expression ISO Als2cl (Rattus norvegicus) 6480464 Topotecan results in decreased expression of ALS2CL mRNA CTD PMID:25729387 Als2cl Mouse topotecan multiple interactions ISO Als2cl (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ALS2CL mRNA CTD PMID:25729387 Als2cl Mouse triptonide affects expression EXP 6480464 triptonide affects the expression of ALS2CL mRNA CTD PMID:33045310 Als2cl Mouse valdecoxib increases expression ISO Als2cl (Rattus norvegicus) 6480464 valdecoxib results in increased expression of ALS2CL mRNA CTD PMID:24136188 Als2cl Mouse valproic acid increases methylation ISO ALS2CL (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ALS2CL gene CTD PMID:29154799 Als2cl Mouse zoledronic acid increases expression ISO ALS2CL (Homo sapiens) 6480464 zoledronic acid results in increased expression of ALS2CL mRNA CTD PMID:24714768 and PMID:25596134
1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-hydroxypropanoic acid (ISO) 2-palmitoylglycerol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) actinomycin D (ISO) adefovir pivoxil (ISO) aflatoxin B1 (EXP) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) bromobenzene (ISO) C60 fullerene (ISO) cadmium dichloride (ISO) calcitriol (ISO) camptothecin (ISO) carbon nanotube (EXP) chloroacetaldehyde (ISO) chrysene (EXP) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dexamethasone (ISO) dioxygen (ISO) doxorubicin (ISO) elemental selenium (ISO) ethanol (EXP) ethylparaben (ISO) flutamide (ISO) ifosfamide (ISO) indometacin (ISO) leflunomide (ISO) methamphetamine (EXP) methapyrilene (ISO) Nutlin-3 (ISO) orphenadrine (ISO) oxaliplatin (ISO) perfluorooctanoic acid (ISO) pirinixic acid (EXP) rac-lactic acid (ISO) selenium atom (ISO) sodium arsenite (EXP,ISO) testosterone (ISO) tetraphene (EXP) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) topotecan (ISO) triptonide (EXP) valdecoxib (ISO) valproic acid (ISO) zoledronic acid (ISO)
Als2cl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 110,709,203 - 110,729,598 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 110,708,938 - 110,729,598 (+) Ensembl GRCm39 Ensembl GRCm38 9 110,880,120 - 110,900,530 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 110,879,870 - 110,900,530 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 110,782,678 - 110,803,034 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 110,724,990 - 110,745,340 (+) NCBI MGSCv36 mm8 Celera 9 110,606,134 - 110,626,473 (+) NCBI Celera Cytogenetic Map 9 F2 NCBI cM Map 9 60.79 NCBI
ALS2CL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 46,668,995 - 46,693,679 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 46,668,995 - 46,693,704 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 46,710,485 - 46,735,169 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 46,685,683 - 46,710,175 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 46,648,229 - 46,672,945 (-) NCBI Celera Cytogenetic Map 3 p21.31 NCBI HuRef 3 46,753,355 - 46,778,070 (-) NCBI HuRef CHM1_1 3 46,660,601 - 46,685,310 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 46,685,103 - 46,709,793 (-) NCBI T2T-CHM13v2.0
Als2cl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 119,746,498 - 119,762,824 (+) NCBI GRCr8 mRatBN7.2 8 110,863,753 - 110,884,434 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 110,864,975 - 110,884,419 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 8 119,156,081 - 119,176,680 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 119,160,731 - 119,174,830 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 118,494,443 - 118,515,055 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 115,269,448 - 115,287,976 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 115,288,197 - 115,306,337 (+) NCBI Celera 8 110,146,276 - 110,166,876 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
Als2cl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955420 25,440,641 - 25,455,872 (+) NCBI ChiLan1.0 ChiLan1.0
ALS2CL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 46,626,013 - 46,649,108 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 46,630,748 - 46,653,872 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 46,568,200 - 46,591,331 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 47,671,265 - 47,695,772 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 47,671,286 - 47,695,772 (-) Ensembl panpan1.1 panPan2
ALS2CL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 42,067,018 - 42,091,125 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 42,066,833 - 42,088,321 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 41,982,917 - 42,007,069 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 42,549,320 - 42,573,473 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 42,541,177 - 42,570,324 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 41,790,574 - 41,811,579 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 42,191,649 - 42,212,661 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 42,472,701 - 42,493,718 (+) NCBI UU_Cfam_GSD_1.0
Als2cl
ALS2CL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 29,596,700 - 29,618,919 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 29,596,696 - 29,618,915 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 32,829,891 - 32,901,030 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ALS2CL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 8,093,439 - 8,116,940 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 8,091,528 - 8,110,881 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 159,033,261 - 159,058,130 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Als2cl
.
Predicted Target Of
Count of predictions: 2752 Count of miRNA genes: 698 Interacting mature miRNAs: 878 Transcripts: ENSMUST00000084926, ENSMUST00000123389, ENSMUST00000130386, ENSMUST00000141845, ENSMUST00000143416, ENSMUST00000155014, ENSMUST00000156673 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10401247 Bglu14_m blood glucose level 14 (mouse) Not determined 9 79279863 113279941 Mouse 1357461 Idd2_m insulin dependent diabetes susceptibility 2 (mouse) Not determined 9 82792386 116792481 Mouse 18182932 Metl3_m metabolite locus 3, N-acetylglutamate (mouse) 9 89440541 123440541 Mouse 1301649 Psl1_m promotion susceptibility QTL 1 (mouse) Not determined 9 89289476 123289595 Mouse 1302103 Dob2_m dietary obesity 2 (mouse) Not determined 9 86121898 120118690 Mouse 1357648 Obq18_m obesity QTL 18 (mouse) Not determined 9 101829255 124359700 Mouse 10054492 El7_m epilepsy 7 (mouse) Not determined 9 75682646 114303447 Mouse 12904961 Gmmq7_m gastrocnemius muscle mass QTL 7 (mouse) 9 91560372 124359700 Mouse 1300884 Sluc11_m susceptibility to lung cancer 11 (mouse) Not determined 9 82792386 116792481 Mouse 10412242 Alpq8_m alcohol preference QTL 8 (mouse) Not determined 9 89162124 123162124 Mouse 1357657 Pymr_m Plasmodium yoelli malaria resistance (mouse) Not determined 9 89859058 118767089 Mouse 1301789 Pbwg4_m postnatal body weight growth 4 (mouse) Not determined 9 103118511 124359700 Mouse 14746992 Manh67_m mandible shape 67 (mouse) 9 93865836 124359700 Mouse 10766454 Char10_m P. chabaudi malaria resistance QTL 10 (mouse) 9 82792386 116792481 Mouse 4141545 Tailaq2_m tail length adjusted QTL 2 (mouse) Not determined 63239711 120191934 Mouse 1300549 Bbaa17_m B. burgdorferi-associated arthritis 17 (mouse) Not determined 9 86107600 120107729 Mouse 1357635 Splq4_m spleen weight QTL 4 (mouse) Not determined 9 63239711 120191934 Mouse 1301192 Skts6_m skin tumor susceptibility 6 (mouse) Not determined 9 78522698 112522808 Mouse 10412290 Pvacm1l_m plasma vascular cell adhesion molecule 1 levels (mouse) Not determined 9 103118511 124359700 Mouse 12879896 Berr3_m berghei resistance locus 3 (mouse) 9 103118511 124359700 Mouse 1302065 El1_m epilepsy 1 (mouse) Not determined 9 75682646 114303447 Mouse 12880422 V25Dq6_m vitamin D inactive form serum level QTL 6 (mouse) 9 87677199 121677199 Mouse 1302001 Bdln5_m body length 5 (mouse) Not determined 9 93591658 124359700 Mouse 1301297 Lcho1_m liver cholesterol 1 (mouse) Not determined 9 100889929 124359700 Mouse 11537364 Cnes5_m C. neoformans susceptibility locus 5 (mouse) 9 96746658 124359700 Mouse 11081166 Psl5_m promotion susceptibility QTL 5 (mouse) 9 94863354 112701997 Mouse 12904937 Edlmmq9_m extensor digitorum longus muscle mass QTL 9 (mouse) 9 91560372 124359700 Mouse 11251716 Siim2_m stress induced immobility 2 (mouse) 9 86625682 120625682 Mouse 1357627 Tgq2_m triglyceride QTL 2 (mouse) Not determined 9 101829255 124359700 Mouse 12910773 Splic3_m spleen iron content 3 (mouse) 9 91291078 124359700 Mouse 12910772 Lvic6_m liver iron content 6 (mouse) 9 91291078 124359700 Mouse 13463480 Mchcq2_m mean corpuscular hemoglobin concentration QTL 2 (mouse) 9 91518283 124359700 Mouse 4141833 W10q13_m weight 10 weeks QTL 13 (mouse) Not determined 63239711 120191934 Mouse 1301732 Char1_m P. chabaudi malaria resistance QTL 1 (mouse) Not determined 9 81680321 115680445 Mouse 12910770 Splic1_m spleen iron content 1 (mouse) 9 91291078 124359700 Mouse 12904947 Tammq7_m tibialis anterior muscle mass QTL 7 (mouse) 9 91560372 124359700 Mouse 1558767 Skmw11_m skeletal muscle weight 11 (mouse) Not determined 9 91518283 124359700 Mouse 13463477 Rbc9_m red blood cell count 9 (mouse) 9 91518283 124359700 Mouse 13463478 Mchq18_m mean corpuscular hemoglobin QTL 18 (mouse) 9 91518283 124359700 Mouse 1301487 Nociq1_m nociceptive sensitivity inflammatory QTL 1 (mouse) Not determined 9 84406017 118406120 Mouse 13515058 Adip20d_m adiposity 20d (mouse) 9 108744078 118744078 Mouse 13463475 Hctq7_m hematocrit QTL 7 (mouse) 9 91518283 124359700 Mouse 13463474 Hbbcq5_m hemoglobin concentration QTL 5 (mouse) 9 91518283 124359700 Mouse 1301484 Bwq6_m body weight (mouse) Not determined 9 93591658 124359700 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000084926 ⟹ ENSMUSP00000081989
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 9 110,709,242 - 110,729,592 (+) Ensembl GRCm38.p6 Ensembl 9 110,880,174 - 110,900,524 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000123389 ⟹ ENSMUSP00000142853
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 9 110,709,301 - 110,713,948 (+) Ensembl GRCm38.p6 Ensembl 9 110,880,233 - 110,884,880 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000130386 ⟹ ENSMUSP00000123304
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 9 110,709,274 - 110,729,598 (+) Ensembl GRCm38.p6 Ensembl 9 110,880,206 - 110,900,530 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000141845
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 9 110,715,357 - 110,719,218 (+) Ensembl GRCm38.p6 Ensembl 9 110,886,289 - 110,890,150 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000143416
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 9 110,708,938 - 110,711,790 (+) Ensembl GRCm38.p6 Ensembl 9 110,879,870 - 110,882,722 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000155014 ⟹ ENSMUSP00000115718
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 9 110,709,405 - 110,729,595 (+) Ensembl GRCm38.p6 Ensembl 9 110,880,337 - 110,900,527 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000156673
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 9 110,717,063 - 110,729,596 (+) Ensembl GRCm38.p6 Ensembl 9 110,887,995 - 110,900,528 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000200613
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 9 110,714,816 - 110,716,390 (+) Ensembl GRCm38.p6 Ensembl 9 110,885,748 - 110,887,322 (+) Ensembl
RefSeq Acc Id:
NM_001146059 ⟹ NP_001139531
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,242 - 110,729,598 (+) NCBI GRCm38 9 110,880,174 - 110,900,530 (+) NCBI MGSCv37 9 110,782,678 - 110,803,034 (+) RGD Celera 9 110,606,134 - 110,626,473 (+) RGD cM Map 9 ENTREZGENE
Sequence:
GGGCGGCCCGGCGCGGAGCTGCGCGGCCACTCGGGGCACCGCGGCGCAAAGCGCAGGTTTGTCTTGCTGAGTCTGATGTGTGATCTCCTGTTCCCTCGTTCTGAAGCTCTGCATGATCTTCAGGGTTG
hide sequence
RefSeq Acc Id:
NM_001146060 ⟹ NP_001139532
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,390 - 110,729,598 (+) NCBI GRCm38 9 110,880,322 - 110,900,530 (+) NCBI MGSCv37 9 110,782,678 - 110,803,034 (+) RGD Celera 9 110,606,134 - 110,626,473 (+) RGD cM Map 9 ENTREZGENE
Sequence:
CCCTCCATCTTCGGTCTCAGCTTCCTCCTCCCGGTCCCGTGGCCGCCCGGCTCCGGTTTAAACGCAGCGCGGGGTCCAACCCCTAGCAGCAGTGCGGAGCGCGAGCACCGTGCCCTGCGTCCAGGCCA
hide sequence
RefSeq Acc Id:
NM_146228 ⟹ NP_666340
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,242 - 110,729,598 (+) NCBI GRCm38 9 110,880,174 - 110,900,530 (+) NCBI MGSCv37 9 110,782,678 - 110,803,034 (+) RGD Celera 9 110,606,134 - 110,626,473 (+) RGD cM Map 9 ENTREZGENE
Sequence:
GGGCGGCCCGGCGCGGAGCTGCGCGGCCACTCGGGGCACCGCGGCGCAAAGCGCAGGTTTGTCTTGCTGAGTCTGATGTGTGATCTCCTGTTCCCTCGTTCTGAAGCTCTGCATGATCTTCAGGGTTG
hide sequence
RefSeq Acc Id:
NR_153354
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,242 - 110,729,598 (+) NCBI GRCm38 9 110,880,174 - 110,900,530 (+) NCBI
Sequence:
GGGCGGCCCGGCGCGGAGCTGCGCGGCCACTCGGGGCACCGCGGCGCAAAGCGCAGGTTTGTCTTGCTGAGTCTGATGTGTGATCTCCTGTTCCCTCGTTCTGAAGCTCTGCATGATCTTCAGGGTTG
hide sequence
RefSeq Acc Id:
XM_006512103 ⟹ XP_006512166
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,231 - 110,729,598 (+) NCBI GRCm38 9 110,880,143 - 110,900,530 (+) NCBI
Sequence:
GCGGAGAGGAAGGGCGGCCCGGCGCGGAGCTGCGCGGCCACTCGGGGCACCGCGGCGCAAAGCG
hide sequence
RefSeq Acc Id:
XM_017313354 ⟹ XP_017168843
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,206 - 110,729,598 (+) NCBI GRCm38 9 110,880,125 - 110,900,530 (+) NCBI
Sequence:
CGCGAACAACACCTCGGGGCGGGGCGCGGAGAGGAAGGGCGGCCCGGCGCGGAGCTGCGCGGCC
hide sequence
RefSeq Acc Id:
XM_017313355 ⟹ XP_017168844
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,328 - 110,729,598 (+) NCBI GRCm38 9 110,880,236 - 110,900,530 (+) NCBI
Sequence:
CTGCCCCACGAGCTCAGCTGCGGGTGGGGGCTCTCTCCTCCTCCCGCTGCCATGGTCACGAGCC
hide sequence
RefSeq Acc Id:
XM_017313356 ⟹ XP_017168845
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,328 - 110,729,598 (+) NCBI GRCm38 9 110,880,236 - 110,900,530 (+) NCBI
Sequence:
CTGCCCCACGAGCTCAGCTGCGGGTGGGGGCTCTCTCCTCCTCCCGCTGCCATGGTCACGAGCCCTCCATCTTCGGTCTCAGCTTCCTCCTCCCGGTCCCGTGGCCGCCCGGCTCCGGTTTAAACGCA
hide sequence
RefSeq Acc Id:
XM_017313357 ⟹ XP_017168846
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,328 - 110,729,598 (+) NCBI GRCm38 9 110,880,236 - 110,900,530 (+) NCBI
Sequence:
CTGCCCCACGAGCTCAGCTGCGGGTGGGGGCTCTCTCCTCCTCCCGCTGCCATGGTCACGAGCC
hide sequence
RefSeq Acc Id:
XM_017313358 ⟹ XP_017168847
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,212 - 110,729,598 (+) NCBI GRCm38 9 110,880,120 - 110,900,530 (+) NCBI
Sequence:
CAACACCTCGGGGCGGGGCGCGGAGAGGAAGGGCGGCCCGGCGCGGAGCTGCGCGGCCACTCGG
hide sequence
RefSeq Acc Id:
XM_030244350 ⟹ XP_030100210
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,714,466 - 110,729,598 (+) NCBI GRCm38 9 110,885,398 - 110,900,530 (+) NCBI
Sequence:
TCCTACACTGATTGCGTGGTGGCGCAAGCTTTTCAGAAGGTCTCAAAGAAGAGGAGAGCCACCCGGCCCAGGAGCTGGTGATGCATGCTATCACCCTGTTTGGAAACCTGCAGTCCTTCATGGGACAG
hide sequence
RefSeq Acc Id:
XR_001778896
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,327 - 110,729,598 (+) NCBI GRCm38 9 110,880,236 - 110,900,530 (+) NCBI
Sequence:
GCTGCCCCACGAGCTCAGCTGCGGGTGGGGGCTCTCTCCTCCTCCCGCTGCCATGGTCACGAGC
hide sequence
RefSeq Acc Id:
XR_003947890
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,327 - 110,726,860 (+) NCBI GRCm38 9 110,880,236 - 110,894,074 (+) NCBI
Sequence:
GCTGCCCCACGAGCTCAGCTGCGGGTGGGGGCTCTCTCCTCCTCCCGCTGCCATGGTCACGAGC
hide sequence
RefSeq Acc Id:
XR_003947891
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,327 - 110,726,860 (+) NCBI GRCm38 9 110,880,236 - 110,894,074 (+) NCBI
Sequence:
GCTGCCCCACGAGCTCAGCTGCGGGTGGGGGCTCTCTCCTCCTCCCGCTGCCATGGTCACGAGC
hide sequence
RefSeq Acc Id:
XR_003947892
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,203 - 110,729,598 (+) NCBI GRCm38 9 110,880,125 - 110,900,530 (+) NCBI
Sequence:
CCGCGCGAACAACACCTCGGGGCGGGGCGCGGAGAGGAAGGGCGGCCCGGCGCGGAGCTGCGCGGCCACTCGGGGCACCGCGGCGCAAAGCGCAGGTTTGTCTTGCTGAGTCTGATGTGTGATCTCCT
hide sequence
RefSeq Acc Id:
XR_003947893
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,327 - 110,729,598 (+) NCBI GRCm38 9 110,880,236 - 110,900,530 (+) NCBI
Sequence:
GCTGCCCCACGAGCTCAGCTGCGGGTGGGGGCTCTCTCCTCCTCCCGCTGCCATGGTCACGAGC
hide sequence
RefSeq Acc Id:
XR_004935433
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 9 110,709,279 - 110,729,598 (+) NCBI
Sequence:
ACCGCGGCGCAAAGCGCAGGTAAGAGCGCGCGTCGGTGGGCGGGGTCCGCTGCCCCACGAGCTC
hide sequence
RefSeq Acc Id:
NP_666340 ⟸ NM_146228
- UniProtKB:
Q8R222 (UniProtKB/Swiss-Prot), Q8K468 (UniProtKB/Swiss-Prot), Q8C0K7 (UniProtKB/Swiss-Prot), Q6KAQ8 (UniProtKB/Swiss-Prot), Q60I26 (UniProtKB/Swiss-Prot), A0A0R4J1X4 (UniProtKB/TrEMBL)
- Sequence:
MSSSEEADLLRLEEVFSTTLARTISLILQPLLLADPEPSDPCGKECLRLLQQLHESAQRLWYVTEQSLLSLRQRLYHPPSKGLEAVLLLSNADHVLQAHMEYIKSYTDCVVAQAFQKVSKKRSEFWRS
hide sequence
RefSeq Acc Id:
NP_001139531 ⟸ NM_001146059
- UniProtKB:
Q8R222 (UniProtKB/Swiss-Prot), Q8K468 (UniProtKB/Swiss-Prot), Q8C0K7 (UniProtKB/Swiss-Prot), Q6KAQ8 (UniProtKB/Swiss-Prot), Q60I26 (UniProtKB/Swiss-Prot), A0A0R4J1X4 (UniProtKB/TrEMBL)
- Sequence:
MSSSEEADLLRLEEVFSTTLARTISLILQPLLLADPEPSDPCGKECLRLLQQLHESAQRLWYVT
hide sequence
RefSeq Acc Id:
NP_001139532 ⟸ NM_001146060
- UniProtKB:
Q8R222 (UniProtKB/Swiss-Prot), Q8K468 (UniProtKB/Swiss-Prot), Q8C0K7 (UniProtKB/Swiss-Prot), Q6KAQ8 (UniProtKB/Swiss-Prot), Q60I26 (UniProtKB/Swiss-Prot), A0A0R4J1X4 (UniProtKB/TrEMBL)
- Sequence:
MSSSEEADLLRLEEVFSTTLARTISLILQPLLLADPEPSDPCGKECLRLLQQLHESAQRLWYVTEQSLLSLRQRLYHPPSKGLEAVLLLSNADHVLQAHMEYIKSYTDCVVAQAFQKVSKKRSEFWRS
hide sequence
RefSeq Acc Id:
XP_006512166 ⟸ XM_006512103
- Peptide Label:
isoform X1
- UniProtKB:
Q8R222 (UniProtKB/Swiss-Prot), Q8K468 (UniProtKB/Swiss-Prot), Q8C0K7 (UniProtKB/Swiss-Prot), Q6KAQ8 (UniProtKB/Swiss-Prot), Q60I26 (UniProtKB/Swiss-Prot), A0A0R4J1X4 (UniProtKB/TrEMBL)
- Sequence:
MSSSEEADLLRLEEVFSTTLARTISLILQPLLLADPEPSDPCGKECLRLLQQLHESAQRLWYVT
hide sequence
RefSeq Acc Id:
XP_017168843 ⟸ XM_017313354
- Peptide Label:
isoform X1
- UniProtKB:
Q8R222 (UniProtKB/Swiss-Prot), Q8K468 (UniProtKB/Swiss-Prot), Q8C0K7 (UniProtKB/Swiss-Prot), Q6KAQ8 (UniProtKB/Swiss-Prot), Q60I26 (UniProtKB/Swiss-Prot), A0A0R4J1X4 (UniProtKB/TrEMBL)
- Sequence:
MSSSEEADLLRLEEVFSTTLARTISLILQPLLLADPEPSDPCGKECLRLLQQLHESAQRLWYVTEQSLLSLRQRLYHPPSKGLEAVLLLSNADHVLQAHMEYIKSYTDCVVAQAFQKVSKKRSEFWRS
hide sequence
RefSeq Acc Id:
XP_017168847 ⟸ XM_017313358
- Peptide Label:
isoform X1
- UniProtKB:
Q8R222 (UniProtKB/Swiss-Prot), Q8K468 (UniProtKB/Swiss-Prot), Q8C0K7 (UniProtKB/Swiss-Prot), Q6KAQ8 (UniProtKB/Swiss-Prot), Q60I26 (UniProtKB/Swiss-Prot), A0A0R4J1X4 (UniProtKB/TrEMBL)
- Sequence:
MSSSEEADLLRLEEVFSTTLARTISLILQPLLLADPEPSDPCGKECLRLLQQLHESAQRLWYVT
hide sequence
RefSeq Acc Id:
XP_017168845 ⟸ XM_017313356
- Peptide Label:
isoform X1
- UniProtKB:
Q8R222 (UniProtKB/Swiss-Prot), Q8K468 (UniProtKB/Swiss-Prot), Q8C0K7 (UniProtKB/Swiss-Prot), Q6KAQ8 (UniProtKB/Swiss-Prot), Q60I26 (UniProtKB/Swiss-Prot), A0A0R4J1X4 (UniProtKB/TrEMBL)
- Sequence:
MSSSEEADLLRLEEVFSTTLARTISLILQPLLLADPEPSDPCGKECLRLLQQLHESAQRLWYVTEQSLLSLRQRLYHPPSKGLEAVLLLSNADHVLQAHMEYIKSYTDCVVAQAFQKVSKKRSEFWRS
hide sequence
RefSeq Acc Id:
XP_017168844 ⟸ XM_017313355
- Peptide Label:
isoform X1
- UniProtKB:
Q8R222 (UniProtKB/Swiss-Prot), Q8K468 (UniProtKB/Swiss-Prot), Q8C0K7 (UniProtKB/Swiss-Prot), Q6KAQ8 (UniProtKB/Swiss-Prot), Q60I26 (UniProtKB/Swiss-Prot), A0A0R4J1X4 (UniProtKB/TrEMBL)
- Sequence:
MSSSEEADLLRLEEVFSTTLARTISLILQPLLLADPEPSDPCGKECLRLLQQLHESAQRLWYVT
hide sequence
RefSeq Acc Id:
XP_017168846 ⟸ XM_017313357
- Peptide Label:
isoform X1
- UniProtKB:
Q8R222 (UniProtKB/Swiss-Prot), Q8K468 (UniProtKB/Swiss-Prot), Q8C0K7 (UniProtKB/Swiss-Prot), Q6KAQ8 (UniProtKB/Swiss-Prot), Q60I26 (UniProtKB/Swiss-Prot), A0A0R4J1X4 (UniProtKB/TrEMBL)
- Sequence:
MSSSEEADLLRLEEVFSTTLARTISLILQPLLLADPEPSDPCGKECLRLLQQLHESAQRLWYVTEQSLLSLRQRLYHPPSKGLEAVLLLSNADHVLQAHMEYIKSYTDCVVAQAFQKVSKKRSEFWRS
hide sequence
RefSeq Acc Id:
XP_030100210 ⟸ XM_030244350
- Peptide Label:
isoform X2
- UniProtKB:
Q8R222 (UniProtKB/Swiss-Prot), Q8K468 (UniProtKB/Swiss-Prot), Q8C0K7 (UniProtKB/Swiss-Prot), Q6KAQ8 (UniProtKB/Swiss-Prot), Q60I26 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000123304 ⟸ ENSMUST00000130386
Ensembl Acc Id:
ENSMUSP00000081989 ⟸ ENSMUST00000084926
Ensembl Acc Id:
ENSMUSP00000142853 ⟸ ENSMUST00000123389
Ensembl Acc Id:
ENSMUSP00000115718 ⟸ ENSMUST00000155014
RGD ID: 6844139 Promoter ID: MM_KWN:58945 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Liver, Lung, MEF_B6 Transcripts: ENSMUST00000084927, NM_001146060, NM_146228, OTTMUST00000064141, OTTMUST00000064145, OTTMUST00000064146, UC009RVE.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 9 110,782,444 - 110,782,944 (+) MPROMDB
RGD ID: 6844141 Promoter ID: MM_KWN:58946 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lung Transcripts: OTTMUST00000064148 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 9 110,788,756 - 110,789,256 (+) MPROMDB
RGD ID: 8671036 Promoter ID: EPDNEW_M13549 Type: initiation region Name: Als2cl_2 Description: Mus musculus ALS2 C-terminal like , transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M13550 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 9 110,880,172 - 110,880,232 EPDNEW
RGD ID: 8671038 Promoter ID: EPDNEW_M13550 Type: initiation region Name: Als2cl_1 Description: Mus musculus ALS2 C-terminal like , transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M13549 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 9 110,880,296 - 110,880,356 EPDNEW
