Symbol:
Ssu72
Name:
Ssu72 RNA polymerase II CTD phosphatase homolog (yeast)
RGD ID:
1552892
MGI Page
MGI
Description:
Predicted to enable RNA polymerase II CTD heptapeptide repeat phosphatase activity. Predicted to be involved in co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway and termination of RNA polymerase II transcription. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of mRNA cleavage and polyadenylation specificity factor complex. Is expressed in facial ganglion; trigeminal ganglion; and vestibulo-cochlear ganglion. Used to study liver disease. Orthologous to human SSU72 (SSU72 homolog, RNA polymerase II CTD phosphatase).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1190002E22Rik; 1500011L16Rik; 2610101M12Rik; CTD phosphatase SSU72; RNA polymerase II subunit A C-terminal domain phosphatase SSU72
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SSU72 (SSU72 homolog, RNA polymerase II CTD phosphatase) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ssu72 (SSU72 homolog, RNA polymerase II CTD phosphatase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ssu72 (SSU72 homolog, RNA polymerase II CTD phosphatase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SSU72 (SSU72 homolog, RNA polymerase II CTD phosphatase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SSU72 (SSU72 homolog, RNA polymerase II CTD phosphatase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ssu72 (SSU72 homolog, RNA polymerase II CTD phosphatase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SSU72 (SSU72 homolog, RNA polymerase II CTD phosphatase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SSU72 (SSU72 homolog, RNA polymerase II CTD phosphatase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ssu72 (SSU72 homolog, RNA polymerase II CTD phosphatase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ssu72 (SSU72 homolog, RNA polymerase II CTD phosphatase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SSU72 (SSU72 homolog, RNA polymerase II CTD phosphatase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ssu72 (SSU72 homolog, RNA polymerase II CTD phosphatase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Ssu72
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SSU72
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ssup-72
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ssu72
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Gm14885
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 155,789,272 - 155,818,336 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 155,789,257 - 155,818,336 (+) Ensembl GRCm39 Ensembl GRCm38 4 155,704,815 - 155,733,879 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 155,704,800 - 155,733,879 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 155,078,924 - 155,107,988 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 154,548,924 - 154,577,582 (+) NCBI MGSCv36 mm8 Celera 4 157,976,790 - 158,005,579 (+) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 87.07 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ssu72 Mouse (+)-catechin multiple interactions ISO SSU72 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of SSU72 mRNA CTD PMID:24763279 Ssu72 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SSU72 mRNA CTD PMID:22206623 Ssu72 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of SSU72 mRNA CTD PMID:17555576 Ssu72 Mouse 17beta-estradiol affects expression ISO Ssu72 (Rattus norvegicus) 6480464 Estradiol affects the expression of SSU72 mRNA CTD PMID:32145629 Ssu72 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ssu72 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of SSU72 mRNA CTD PMID:22298810 Ssu72 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ssu72 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SSU72 mRNA CTD PMID:33387578 Ssu72 Mouse 2,4,6-trinitrotoluene affects expression ISO Ssu72 (Rattus norvegicus) 6480464 Trinitrotoluene affects the expression of SSU72 mRNA CTD PMID:21346803 Ssu72 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SSU72 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SSU72 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SSU72 mRNA CTD PMID:28628672 Ssu72 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of SSU72 mRNA CTD PMID:39298647 Ssu72 Mouse 6-propyl-2-thiouracil increases expression ISO Ssu72 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of SSU72 mRNA CTD PMID:30047161 Ssu72 Mouse amitrole increases expression ISO Ssu72 (Rattus norvegicus) 6480464 Amitrole results in increased expression of SSU72 mRNA CTD PMID:30047161 Ssu72 Mouse arsane affects methylation ISO SSU72 (Homo sapiens) 6480464 Arsenic affects the methylation of SSU72 gene CTD PMID:25304211 Ssu72 Mouse arsane affects expression ISO SSU72 (Homo sapiens) 6480464 Arsenic affects the expression of SSU72 mRNA CTD PMID:25304211 Ssu72 Mouse arsenic atom affects methylation ISO SSU72 (Homo sapiens) 6480464 Arsenic affects the methylation of SSU72 gene CTD PMID:25304211 Ssu72 Mouse arsenic atom affects expression ISO SSU72 (Homo sapiens) 6480464 Arsenic affects the expression of SSU72 mRNA CTD PMID:25304211 Ssu72 Mouse bisphenol A increases expression ISO Ssu72 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of SSU72 mRNA CTD PMID:25181051 and PMID:32145629 Ssu72 Mouse bisphenol A increases methylation ISO SSU72 (Homo sapiens) 6480464 bisphenol A results in increased methylation of SSU72 gene CTD PMID:31601247 Ssu72 Mouse bisphenol A decreases expression ISO Ssu72 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SSU72 mRNA CTD PMID:34947998 Ssu72 Mouse bisphenol A increases methylation ISO Ssu72 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of SSU72 gene CTD PMID:28505145 Ssu72 Mouse bisphenol A multiple interactions ISO SSU72 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SSU72 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SSU72 mRNA CTD PMID:28628672 and PMID:31601247 Ssu72 Mouse bisphenol F multiple interactions ISO SSU72 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SSU72 mRNA CTD PMID:28628672 Ssu72 Mouse calyculin a decreases expression EXP 6480464 calyculin A results in decreased expression of SSU72 mRNA CTD PMID:25270620 Ssu72 Mouse clofibric acid affects expression ISO Ssu72 (Rattus norvegicus) 6480464 Clofibric Acid affects the expression of SSU72 mRNA CTD PMID:17602206 Ssu72 Mouse copper(II) sulfate decreases expression ISO SSU72 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SSU72 mRNA CTD PMID:19549813 Ssu72 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of SSU72 mRNA CTD PMID:29279043 Ssu72 Mouse cyclosporin A decreases expression ISO SSU72 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SSU72 mRNA CTD PMID:25562108 Ssu72 Mouse dexamethasone multiple interactions ISO SSU72 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SSU72 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SSU72 mRNA CTD PMID:28628672 Ssu72 Mouse dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SSU72 mRNA CTD PMID:21266533 Ssu72 Mouse diquat decreases expression EXP 6480464 Diquat results in decreased expression of SSU72 protein CTD PMID:36851058 Ssu72 Mouse disodium selenite increases expression ISO SSU72 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of SSU72 mRNA CTD PMID:18175754 Ssu72 Mouse dorsomorphin multiple interactions ISO SSU72 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SSU72 mRNA CTD PMID:27188386 Ssu72 Mouse doxorubicin increases expression ISO SSU72 (Homo sapiens) 6480464 Doxorubicin results in increased expression of SSU72 mRNA CTD PMID:29803840 Ssu72 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of SSU72 mRNA CTD PMID:30319688 Ssu72 Mouse finasteride increases expression ISO Ssu72 (Rattus norvegicus) 6480464 Finasteride results in increased expression of SSU72 mRNA CTD PMID:24136188 Ssu72 Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SSU72 mRNA CTD PMID:22206623 Ssu72 Mouse fulvestrant multiple interactions ISO SSU72 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SSU72 gene CTD PMID:31601247 Ssu72 Mouse gentamycin increases expression ISO Ssu72 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of SSU72 mRNA CTD PMID:33387578 Ssu72 Mouse glafenine increases expression ISO Ssu72 (Rattus norvegicus) 6480464 Glafenine results in increased expression of SSU72 mRNA CTD PMID:24136188 Ssu72 Mouse glyphosate affects methylation ISO Ssu72 (Rattus norvegicus) 6480464 Glyphosate affects the methylation of SSU72 gene CTD PMID:35440735 Ssu72 Mouse indometacin multiple interactions ISO SSU72 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of SSU72 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SSU72 mRNA CTD PMID:28628672 Ssu72 Mouse ivermectin decreases expression ISO SSU72 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SSU72 protein CTD PMID:32959892 Ssu72 Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of SSU72 mRNA CTD PMID:34813904 Ssu72 Mouse methimazole increases expression ISO Ssu72 (Rattus norvegicus) 6480464 Methimazole results in increased expression of SSU72 mRNA CTD PMID:30047161 Ssu72 Mouse methyl methanesulfonate decreases expression ISO SSU72 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SSU72 mRNA CTD PMID:23649840 Ssu72 Mouse ochratoxin A increases expression ISO Ssu72 (Rattus norvegicus) 6480464 ochratoxin A results in increased expression of SSU72 mRNA CTD PMID:22124623 Ssu72 Mouse p-toluidine increases expression ISO Ssu72 (Rattus norvegicus) 6480464 4-toluidine results in increased expression of SSU72 mRNA CTD PMID:27638505 Ssu72 Mouse paracetamol increases expression ISO SSU72 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SSU72 mRNA CTD PMID:22230336 Ssu72 Mouse paracetamol increases expression ISO Ssu72 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of SSU72 mRNA CTD PMID:33387578 Ssu72 Mouse SB 431542 multiple interactions ISO SSU72 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SSU72 mRNA CTD PMID:27188386 Ssu72 Mouse sodium arsenite decreases expression ISO SSU72 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SSU72 mRNA CTD PMID:38568856 Ssu72 Mouse sulfadimethoxine increases expression ISO Ssu72 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of SSU72 mRNA CTD PMID:30047161 Ssu72 Mouse sulindac decreases expression ISO Ssu72 (Rattus norvegicus) 6480464 Sulindac results in decreased expression of SSU72 mRNA CTD PMID:24136188 Ssu72 Mouse sunitinib increases expression ISO SSU72 (Homo sapiens) 6480464 Sunitinib results in increased expression of SSU72 mRNA CTD PMID:31533062 Ssu72 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of SSU72 mRNA CTD PMID:17555576 Ssu72 Mouse tetrachloromethane increases expression ISO Ssu72 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of SSU72 mRNA CTD PMID:30723492 Ssu72 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of SSU72 gene CTD PMID:35295148 Ssu72 Mouse triadimefon increases expression ISO Ssu72 (Rattus norvegicus) 6480464 triadimefon results in increased expression of SSU72 mRNA CTD PMID:30047161 Ssu72 Mouse trichloroethene increases expression ISO Ssu72 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of SSU72 mRNA CTD PMID:33387578 Ssu72 Mouse triphenyl phosphate affects expression ISO SSU72 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SSU72 mRNA CTD PMID:37042841 Ssu72 Mouse valproic acid increases methylation ISO SSU72 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SSU72 gene CTD PMID:29154799 Ssu72 Mouse valproic acid multiple interactions ISO SSU72 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SSU72 mRNA CTD PMID:27188386 Ssu72 Mouse valproic acid increases expression ISO SSU72 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SSU72 mRNA CTD PMID:23179753 more ... Ssu72 Mouse vinclozolin increases expression ISO Ssu72 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of SSU72 mRNA CTD PMID:22570695 Ssu72 Mouse zearalenone decreases expression EXP 6480464 Zearalenone results in decreased expression of SSU72 protein CTD PMID:36252740
1.
Updating the RNA polymerase CTD code: adding gene-specific layers.
Egloff S, etal., Trends Genet. 2012 Jul;28(7):333-41. doi: 10.1016/j.tig.2012.03.007. Epub 2012 May 21.
2.
The writers, readers, and functions of the RNA polymerase II C-terminal domain code.
Jeronimo C, etal., Chem Rev. 2013 Nov 13;113(11):8491-522. doi: 10.1021/cr4001397. Epub 2013 Jul 10.
3.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Ssu72 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 155,789,272 - 155,818,336 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 155,789,257 - 155,818,336 (+) Ensembl GRCm39 Ensembl GRCm38 4 155,704,815 - 155,733,879 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 155,704,800 - 155,733,879 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 155,078,924 - 155,107,988 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 154,548,924 - 154,577,582 (+) NCBI MGSCv36 mm8 Celera 4 157,976,790 - 158,005,579 (+) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 87.07 NCBI
SSU72 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 1,541,673 - 1,574,863 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 1,541,673 - 1,574,863 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 1,477,053 - 1,510,243 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 1,466,916 - 1,500,125 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 1,068,953 - 1,103,100 (+) NCBI Celera Cytogenetic Map 1 p36.33 NCBI HuRef 1 750,686 - 783,938 (-) NCBI HuRef CHM1_1 1 1,464,275 - 1,497,415 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 976,177 - 1,009,369 (-) NCBI T2T-CHM13v2.0
Ssu72 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 171,595,919 - 171,625,675 (+) NCBI GRCr8 mRatBN7.2 5 166,312,267 - 166,343,432 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 166,313,650 - 166,343,429 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 169,018,554 - 169,048,411 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 170,839,980 - 170,869,837 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 170,802,519 - 170,832,376 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 173,152,964 - 173,182,720 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 173,152,964 - 173,182,719 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 176,628,574 - 176,658,330 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 172,560,734 - 172,591,202 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 172,571,228 - 172,601,697 (+) NCBI Celera 5 164,514,304 - 164,543,917 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
Ssu72 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 9,317,078 - 9,338,414 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 9,317,078 - 9,338,414 (+) NCBI ChiLan1.0 ChiLan1.0
SSU72 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 226,645,902 - 226,679,582 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 225,302,969 - 225,336,524 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 301,984 - 335,634 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 1,463,184 - 1,494,797 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 1,463,184 - 1,494,797 (-) Ensembl panpan1.1 panPan2
SSU72 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 56,620,803 - 56,650,131 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 56,620,805 - 56,650,131 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 56,696,786 - 56,726,143 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 56,822,938 - 56,852,452 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 56,822,943 - 56,852,735 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 56,813,500 - 56,842,860 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 56,705,870 - 56,735,201 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 57,096,118 - 57,125,568 (-) NCBI UU_Cfam_GSD_1.0
Ssu72 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 27,760,381 - 27,787,481 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936737 1,678,425 - 1,705,609 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936737 1,678,425 - 1,705,569 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SSU72 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 63,728,325 - 63,755,163 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 63,728,318 - 63,757,460 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 58,158,519 - 58,185,391 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SSU72 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 129,922,992 - 129,958,551 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 129,923,091 - 129,958,712 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 34,388,314 - 34,422,273 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ssu72
.
Predicted Target Of
Count of predictions: 198 Count of miRNA genes: 180 Interacting mature miRNAs: 190 Transcripts: ENSMUST00000030905, ENSMUST00000105595, ENSMUST00000140322 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 4142077 Ignpq2_m IgA nephropathy QTL 2 (mouse) Not determined 4 133676733 156860686 Mouse 4142139 Adip12_m adiposity 12 (mouse) Not determined 4 124621281 156860686 Mouse 10043996 Gct5_m granulosa cell tumorigenesis 5 (mouse) Not determined 4 127784226 156860686 Mouse 1301108 Scon2_m sucrose consumption 2 (mouse) Not determined 4 134654451 156860686 Mouse 1300858 Tafat_m tally ho associated mesenteric fat pad weight (mouse) Not determined 4 124621281 156860686 Mouse 1300537 Ap3q_m alcohol preference 3 QTL (mouse) Not determined 4 134654451 156860686 Mouse 1301982 Pltiq1_m phospholipid transfer protein inducibility QTL 1 (mouse) Not determined 4 124621281 156860686 Mouse 10045620 Heal22_m wound healing/regeneration 22 (mouse) Not determined 4 125230872 156860686 Mouse 4142481 Gct1_m granulosa cell tumorigenesis 1 (mouse) Not determined 4 127784226 156860686 Mouse 10755531 Lymph3_m lymphocyte differential 3 (mouse) 4 124553483 156860686 Mouse 11533916 Mts1_m mammary tumor susceptibility 1 (mouse) 4 125289325 156860686 Mouse 1300933 Cdcs9_m cytokine deficiency colitis susceptibility 9 (mouse) Not determined 4 125230872 156860686 Mouse 1300874 Gasa2_m gastritis type A susceptibility locus 2 (mouse) Not determined 4 133010494 156860686 Mouse 1300621 Tpnr1_m thermal pain response 1 (mouse) Not determined 4 125230872 156860686 Mouse 1300780 Cocrb16_m cocaine related behavior 16 (mouse) Not determined 4 138943725 156860686 Mouse
D10Mit157.2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 D1 UniSTS Cytogenetic Map 16 B4 UniSTS Cytogenetic Map 18 E2 UniSTS Cytogenetic Map 4 C3 UniSTS Cytogenetic Map 7 B2 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 14 E2.2 UniSTS Cytogenetic Map 4 C7 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 1 F UniSTS Cytogenetic Map 6 C3 UniSTS Cytogenetic Map 11 D UniSTS Cytogenetic Map 3 G2 UniSTS Cytogenetic Map 17 A1 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 3 B UniSTS Cytogenetic Map 8 C1 UniSTS Cytogenetic Map 18 A2 UniSTS Cytogenetic Map 3 F2 UniSTS Cytogenetic Map 14 C3 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 8 E2 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 18 B1 UniSTS Cytogenetic Map 9 C UniSTS Cytogenetic Map 14 C2 UniSTS Cytogenetic Map 6 A1 UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 13 D2.1 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 11 B1.3 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 17 E3 UniSTS Cytogenetic Map 11 B3 UniSTS Cytogenetic Map 1 H4 UniSTS Cytogenetic Map 6 A3 UniSTS Cytogenetic Map 5 E4-E5 UniSTS Cytogenetic Map 15 E1 UniSTS Cytogenetic Map 13 D UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 14 D1 UniSTS Cytogenetic Map 7 B4 UniSTS Cytogenetic Map 8 D3 UniSTS Cytogenetic Map X D UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 7 E2 UniSTS Cytogenetic Map 1 H2.3 UniSTS Cytogenetic Map 7 A2 UniSTS Cytogenetic Map 7 F3 UniSTS Cytogenetic Map 9 F1 UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 15 D2 UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 16 B2 UniSTS Cytogenetic Map 7 C UniSTS Cytogenetic Map 3 F2.1 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 1 C4 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 9 F3 UniSTS Cytogenetic Map 2 B UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 9 A4 UniSTS Cytogenetic Map 5 A3 UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 16 B1 UniSTS Cytogenetic Map 1 A5 UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 9 E1 UniSTS Cytogenetic Map 6 G1 UniSTS Cytogenetic Map X A2 UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 5 E2 UniSTS Cytogenetic Map 12 C1 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 10 C2 UniSTS Cytogenetic Map 9 B UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 10 A4 UniSTS Cytogenetic Map 8 A2 UniSTS Cytogenetic Map 18 A1 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 1 C2 UniSTS Cytogenetic Map 11 B2 UniSTS Cytogenetic Map 6 E3 UniSTS Cytogenetic Map 5 C3.3 UniSTS Cytogenetic Map 1 B UniSTS Cytogenetic Map 17 A3.1 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 4 B1 UniSTS Cytogenetic Map 15 A2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 5 G3 UniSTS Cytogenetic Map 4 A3 UniSTS Cytogenetic Map 2 H3 UniSTS Cytogenetic Map 8 A1 UniSTS Cytogenetic Map 8 A1.1 UniSTS Cytogenetic Map 16 A3 UniSTS Cytogenetic Map 10 B1 UniSTS Cytogenetic Map 19 A UniSTS Cytogenetic Map 10 A1 UniSTS Cytogenetic Map 13 D1 UniSTS Cytogenetic Map 4 A1 UniSTS Cytogenetic Map 9 A3 UniSTS Cytogenetic Map 17 C UniSTS Cytogenetic Map 1 D UniSTS Cytogenetic Map 5 E3 UniSTS Cytogenetic Map 15 D3 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 7 D3 UniSTS Cytogenetic Map 2 A1 UniSTS Cytogenetic Map 14 C1 UniSTS Cytogenetic Map 14 E5 UniSTS Cytogenetic Map 10 C UniSTS Cytogenetic Map 18 B2 UniSTS Cytogenetic Map 2 F1 UniSTS Cytogenetic Map 10 D3 UniSTS Cytogenetic Map 17 A2 UniSTS Cytogenetic Map 2 C3 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 17 B2 UniSTS Cytogenetic Map 5 B2 UniSTS Cytogenetic Map 5 G1 UniSTS Cytogenetic Map 4 C6 UniSTS Cytogenetic Map 13 C3 UniSTS Cytogenetic Map 2 E1 UniSTS Cytogenetic Map 17 A3.2-A3.3 UniSTS Cytogenetic Map 19 C3 UniSTS Cytogenetic Map 7 E3 UniSTS Cytogenetic Map 13 C1 UniSTS Cytogenetic Map 9 E3.1 UniSTS Cytogenetic Map 15 E3 UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X E3 UniSTS Cytogenetic Map 4 C4 UniSTS Cytogenetic Map 3 E3 UniSTS Cytogenetic Map 11 A4 UniSTS Cytogenetic Map 4 C5 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 9 A2 UniSTS Cytogenetic Map 7 E1 UniSTS Cytogenetic Map 5 D-E1 UniSTS Cytogenetic Map 5 B3 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 5 A2 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 1 E4 UniSTS Cytogenetic Map 17 E4 UniSTS Cytogenetic Map 1 G2 UniSTS Cytogenetic Map 15 B3.1 UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 6 A3.3 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 6 F2 UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 4 D2.1 UniSTS Cytogenetic Map 4 A5 UniSTS Cytogenetic Map 3 F2.2 UniSTS Cytogenetic Map 1 E3-E4 UniSTS Cytogenetic Map 9 F1-F3 UniSTS Cytogenetic Map 1 C1.1 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 12 A2 UniSTS Cytogenetic Map 17 A3-B UniSTS Cytogenetic Map 7 F5 UniSTS Cytogenetic Map 14 A3 UniSTS Cytogenetic Map 5 G1.1 UniSTS Cytogenetic Map X F2-F4 UniSTS Cytogenetic Map 7 D2 UniSTS Cytogenetic Map 2 F3 UniSTS Cytogenetic Map 10 A3 UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 9 F1-F2 UniSTS Cytogenetic Map 13 A3.2 UniSTS Cytogenetic Map 10 A2 UniSTS Cytogenetic Map 1 C1 UniSTS Cytogenetic Map 1 A1 UniSTS Cytogenetic Map 12 D3 UniSTS Cytogenetic Map 1 A3-A5 UniSTS Cytogenetic Map 2 A2 UniSTS Cytogenetic Map 3 A1 UniSTS Cytogenetic Map X A3.3 UniSTS Cytogenetic Map 16 A-B1 UniSTS Cytogenetic Map 1 D2.3 UniSTS Cytogenetic Map 6 B2.3 UniSTS Cytogenetic Map 2 G3 UniSTS Cytogenetic Map X A2-A3.1 UniSTS Cytogenetic Map 9 A5.3 UniSTS Cytogenetic Map 14 A2-B UniSTS Cytogenetic Map 8 E1-E2 UniSTS Cytogenetic Map 8 A3 UniSTS Cytogenetic Map 1 G3-H1 UniSTS Cytogenetic Map 8 B3-C1 UniSTS Cytogenetic Map 19 C1 UniSTS Cytogenetic Map 8 C5 UniSTS Cytogenetic Map 8 A4 UniSTS Cytogenetic Map 15 F3 UniSTS Cytogenetic Map 14 E4 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map X F5 UniSTS cM Map 10 40.0 UniSTS Whitehead Genetic 10 33.9 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000030905 ⟹ ENSMUSP00000030905
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 155,789,257 - 155,818,336 (+) Ensembl GRCm38.p6 Ensembl 4 155,704,800 - 155,733,879 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000105595 ⟹ ENSMUSP00000101220
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 155,789,592 - 155,816,646 (+) Ensembl GRCm38.p6 Ensembl 4 155,705,135 - 155,732,189 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000140322
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 155,789,581 - 155,801,135 (+) Ensembl GRCm38.p6 Ensembl 4 155,705,124 - 155,716,678 (+) Ensembl
RefSeq Acc Id:
NM_026899 ⟹ NP_081175
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 155,789,272 - 155,818,336 (+) NCBI GRCm38 4 155,704,815 - 155,733,879 (+) NCBI MGSCv37 4 155,078,924 - 155,107,988 (+) RGD Celera 4 157,976,790 - 158,005,579 (+) RGD cM Map 4 ENTREZGENE
Sequence:
CTAGAAGTCCAGTGACTCTGAGGAAGGTACTCGTGATAGAGATAGGGCACAAACCAAGTGCTGGAGCCCAGTGCATCTATGAAATTGGCAGAGTGACCACCTGGAGGAAACCGGAATGAAAAACGTCC
hide sequence
RefSeq Acc Id:
NP_081175 ⟸ NM_026899
- UniProtKB:
Q91YL1 (UniProtKB/Swiss-Prot), Q3UF99 (UniProtKB/Swiss-Prot), Q9DB51 (UniProtKB/Swiss-Prot), Q9CY97 (UniProtKB/Swiss-Prot)
- Sequence:
MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCTDLFDLILTCEERVYDQVVEDLNSREQ
hide sequence
Ensembl Acc Id:
ENSMUSP00000101220 ⟸ ENSMUST00000105595
Ensembl Acc Id:
ENSMUSP00000030905 ⟸ ENSMUST00000030905
RGD ID: 6836464 Promoter ID: MM_KWN:41173 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000025370, OTTMUST00000025372, UC008WEK.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 155,078,666 - 155,079,527 (+) MPROMDB
RGD ID: 6885802 Promoter ID: EPDNEW_M6352 Type: initiation region Name: Ssu72_2 Description: Mus musculus Ssu72 RNA polymerase II CTD phosphatase homolog, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M6353 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 155,704,828 - 155,704,888 EPDNEW
RGD ID: 6885804 Promoter ID: EPDNEW_M6353 Type: initiation region Name: Ssu72_1 Description: Mus musculus Ssu72 RNA polymerase II CTD phosphatase homolog, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M6352 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 155,705,336 - 155,705,396 EPDNEW
