Symbol:
Bpnt1
Name:
3'(2'), 5'-bisphosphate nucleotidase 1
RGD ID:
1552696
MGI Page
MGI
Description:
Enables 3'(2'),5'-bisphosphate nucleotidase activity. Predicted to be involved in phosphatidylinositol phosphate biosynthetic process. Is expressed in apical ectodermal ridge and limb. Orthologous to human BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
3'(2'),5'-bisphosphate nucleotidase 1; 3'-phosphoadenosine 5'-phosphate phosphatase; bisphosphate 3'-nucleotidase 1; BPn; BPntase; BPntase 1; inositol-polyphosphate 1-phosphatase; PAP phosphatase; PAP-inositol 1,4-phosphatase; PAP-inositol-1,4-phosphatase; PIP
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Bpnt1 (3'(2'), 5'-bisphosphate nucleotidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bpnt1 (3'(2'), 5'-bisphosphate nucleotidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bpnt1 (3'(2'), 5'-bisphosphate nucleotidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bpnt1 (3'(2'), 5'-bisphosphate nucleotidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
BPNT2 (3'(2'), 5'-bisphosphate nucleotidase 2) HGNC
Inparanoid
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Bpnt1 (3'(2'), 5'-bisphosphate nucleotidase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bpnt1 (bisphosphate nucleotidase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG7789
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
bpnt-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bpnt1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 185,061,619 - 185,089,974 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 185,064,346 - 185,089,974 (+) Ensembl GRCm39 Ensembl GRCm38 1 185,329,428 - 185,357,777 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 185,332,149 - 185,357,777 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 187,156,038 - 187,181,648 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 187,032,947 - 187,058,557 (+) NCBI MGSCv36 mm8 Celera 1 192,281,814 - 192,307,391 (+) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 89.49 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bpnt1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BPNT1 mRNA CTD PMID:36331819 Bpnt1 Mouse 1,1-dichloroethene decreases expression EXP 6480464 vinylidene chloride results in decreased expression of BPNT1 mRNA CTD PMID:26682919 Bpnt1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of BPNT1 mRNA CTD PMID:22206623 Bpnt1 Mouse 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of BPNT1 mRNA CTD PMID:39298647 Bpnt1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Bpnt1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BPNT1 mRNA CTD PMID:16054898 more ... Bpnt1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of BPNT1 mRNA CTD PMID:21570461 Bpnt1 Mouse 2,4-dinitrotoluene affects expression ISO Bpnt1 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of BPNT1 mRNA CTD PMID:21346803 Bpnt1 Mouse 2,6-dinitrotoluene affects expression ISO Bpnt1 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of BPNT1 mRNA CTD PMID:21346803 Bpnt1 Mouse 2-hydroxypropanoic acid decreases expression ISO BPNT1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BPNT1 mRNA CTD PMID:30851411 Bpnt1 Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of BPNT1 mRNA CTD PMID:26251327 Bpnt1 Mouse 3,4-methylenedioxymethamphetamine increases methylation EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of BPNT1 promoter CTD PMID:26251327 Bpnt1 Mouse 3H-1,2-dithiole-3-thione decreases expression ISO Bpnt1 (Rattus norvegicus) 6480464 1 and 2-dithiol-3-thione results in decreased expression of BPNT1 mRNA CTD PMID:19162173 Bpnt1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of BPNT1 mRNA CTD PMID:39298647 Bpnt1 Mouse 4-amino-2,6-dinitrotoluene affects expression ISO Bpnt1 (Rattus norvegicus) 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of BPNT1 mRNA CTD PMID:21346803 Bpnt1 Mouse ammonium chloride affects expression ISO Bpnt1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of BPNT1 mRNA CTD PMID:16483693 Bpnt1 Mouse aristolochic acid A increases expression ISO BPNT1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of BPNT1 mRNA CTD PMID:33212167 Bpnt1 Mouse arsane affects methylation ISO BPNT1 (Homo sapiens) 6480464 Arsenic affects the methylation of BPNT1 gene CTD PMID:25304211 Bpnt1 Mouse arsane multiple interactions ISO BPNT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BPNT1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of BPNT1 mRNA CTD PMID:39836092 Bpnt1 Mouse arsenic atom affects methylation ISO BPNT1 (Homo sapiens) 6480464 Arsenic affects the methylation of BPNT1 gene CTD PMID:25304211 Bpnt1 Mouse arsenic atom multiple interactions ISO BPNT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BPNT1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of BPNT1 mRNA CTD PMID:39836092 Bpnt1 Mouse atrazine decreases expression ISO BPNT1 (Homo sapiens) 6480464 Atrazine results in decreased expression of BPNT1 mRNA CTD PMID:22378314 Bpnt1 Mouse Benzo[ghi]perylene increases expression EXP 6480464 1 and 12-benzoperylene results in increased expression of BPNT1 mRNA CTD PMID:26377693 Bpnt1 Mouse beta-lapachone decreases expression ISO BPNT1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of BPNT1 mRNA CTD PMID:38218311 Bpnt1 Mouse beta-lapachone increases expression ISO BPNT1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of BPNT1 mRNA CTD PMID:38218311 Bpnt1 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BPNT1 mRNA CTD PMID:26063408 Bpnt1 Mouse bisphenol A increases expression ISO BPNT1 (Homo sapiens) 6480464 bisphenol A results in increased expression of BPNT1 protein CTD PMID:37567409 Bpnt1 Mouse bisphenol A increases methylation ISO Bpnt1 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of BPNT1 gene CTD PMID:28505145 Bpnt1 Mouse bisphenol A affects expression ISO Bpnt1 (Rattus norvegicus) 6480464 bisphenol A affects the expression of BPNT1 mRNA CTD PMID:25181051 Bpnt1 Mouse bisphenol AF increases expression ISO BPNT1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of BPNT1 protein CTD PMID:34186270 Bpnt1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of BPNT1 mRNA CTD PMID:38685157 Bpnt1 Mouse captan increases expression EXP 6480464 Captan results in increased expression of BPNT1 mRNA CTD PMID:31558096 Bpnt1 Mouse cisplatin increases expression ISO BPNT1 (Homo sapiens) 6480464 Cisplatin results in increased expression of BPNT1 mRNA CTD PMID:27392435 Bpnt1 Mouse cyclosporin A decreases expression ISO BPNT1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of BPNT1 mRNA CTD PMID:20106945 and PMID:25562108 Bpnt1 Mouse Dibutyl phosphate affects expression ISO BPNT1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of BPNT1 mRNA CTD PMID:37042841 Bpnt1 Mouse dicrotophos decreases expression ISO BPNT1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of BPNT1 mRNA CTD PMID:28302478 Bpnt1 Mouse enzyme inhibitor multiple interactions ISO BPNT1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of BPNT1 protein CTD PMID:23301498 Bpnt1 Mouse flutamide increases expression ISO Bpnt1 (Rattus norvegicus) 6480464 Flutamide results in increased expression of BPNT1 mRNA CTD PMID:24136188 Bpnt1 Mouse folic acid affects expression ISO Bpnt1 (Rattus norvegicus) 6480464 Folic Acid affects the expression of BPNT1 protein CTD PMID:16251605 Bpnt1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of BPNT1 mRNA CTD PMID:25629700 Bpnt1 Mouse folpet increases expression EXP 6480464 folpet results in increased expression of BPNT1 mRNA CTD PMID:31558096 Bpnt1 Mouse gentamycin increases expression ISO Bpnt1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of BPNT1 mRNA CTD PMID:33387578 Bpnt1 Mouse hydroxyurea increases mutagenesis EXP 6480464 Hydroxyurea results in increased mutagenesis of BPNT1 gene CTD PMID:16868089 Bpnt1 Mouse ivermectin decreases expression ISO BPNT1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of BPNT1 protein CTD PMID:32959892 Bpnt1 Mouse leflunomide increases expression ISO Bpnt1 (Rattus norvegicus) 6480464 leflunomide results in increased expression of BPNT1 mRNA CTD PMID:24136188 Bpnt1 Mouse manganese atom multiple interactions ISO BPNT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BPNT1 mRNA CTD PMID:39836092 Bpnt1 Mouse manganese(0) multiple interactions ISO BPNT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BPNT1 mRNA CTD PMID:39836092 Bpnt1 Mouse manganese(II) chloride multiple interactions ISO BPNT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BPNT1 mRNA CTD PMID:39836092 Bpnt1 Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of BPNT1 mRNA CTD PMID:34813904 Bpnt1 Mouse methylmercury chloride decreases expression ISO BPNT1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of BPNT1 mRNA CTD PMID:28001369 Bpnt1 Mouse N-methyl-N-nitrosourea increases mutagenesis EXP 6480464 Methylnitrosourea results in increased mutagenesis of BPNT1 gene CTD PMID:16868089 Bpnt1 Mouse nefazodone increases expression ISO Bpnt1 (Rattus norvegicus) 6480464 nefazodone results in increased expression of BPNT1 mRNA CTD PMID:24136188 Bpnt1 Mouse nickel atom decreases expression ISO BPNT1 (Homo sapiens) 6480464 Nickel results in decreased expression of BPNT1 mRNA CTD PMID:23195993 Bpnt1 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of BPNT1 mRNA CTD PMID:35964746 Bpnt1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of BPNT1 mRNA CTD PMID:17562736 Bpnt1 Mouse paracetamol increases expression ISO Bpnt1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of BPNT1 mRNA CTD PMID:33387578 Bpnt1 Mouse paracetamol decreases expression ISO BPNT1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of BPNT1 mRNA CTD PMID:21420995 more ... Bpnt1 Mouse pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of BPNT1 mRNA CTD PMID:23892564 Bpnt1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BPNT1 mRNA CTD PMID:36331819 Bpnt1 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of BPNT1 mRNA CTD PMID:23811191 Bpnt1 Mouse propiconazole increases expression EXP 6480464 propiconazole results in increased expression of BPNT1 mRNA CTD PMID:21278054 Bpnt1 Mouse rac-lactic acid decreases expression ISO BPNT1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BPNT1 mRNA CTD PMID:30851411 Bpnt1 Mouse silicon dioxide decreases expression ISO BPNT1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of BPNT1 mRNA CTD PMID:23806026 Bpnt1 Mouse sodium arsenate decreases expression EXP 6480464 sodium arsenate results in decreased expression of BPNT1 mRNA CTD PMID:30953684 Bpnt1 Mouse sodium arsenite decreases expression ISO BPNT1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BPNT1 mRNA CTD PMID:38568856 Bpnt1 Mouse sodium arsenite multiple interactions ISO BPNT1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BPNT1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of BPNT1 mRNA CTD PMID:39836092 Bpnt1 Mouse sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of BPNT1 mRNA CTD PMID:31558096 Bpnt1 Mouse sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of BPNT1 protein CTD PMID:28918527 Bpnt1 Mouse sunitinib decreases expression ISO BPNT1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of BPNT1 mRNA CTD PMID:31533062 Bpnt1 Mouse T-2 toxin affects expression ISO Bpnt1 (Rattus norvegicus) 6480464 T-2 Toxin affects the expression of BPNT1 protein CTD PMID:26141394 Bpnt1 Mouse tetrachloromethane decreases expression ISO Bpnt1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of BPNT1 mRNA CTD PMID:31150632 Bpnt1 Mouse triphenyl phosphate affects expression ISO BPNT1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BPNT1 mRNA CTD PMID:37042841 Bpnt1 Mouse trovafloxacin decreases expression ISO Bpnt1 (Rattus norvegicus) 6480464 trovafloxacin results in decreased expression of BPNT1 mRNA CTD PMID:24136188 Bpnt1 Mouse valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of BPNT1 mRNA CTD PMID:21427059 Bpnt1 Mouse valproic acid increases expression ISO BPNT1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of BPNT1 mRNA CTD PMID:23179753 and PMID:27188386 Bpnt1 Mouse vancomycin increases expression EXP 6480464 Vancomycin results in increased expression of BPNT1 mRNA CTD PMID:18930951 Bpnt1 Mouse vorinostat increases expression ISO BPNT1 (Homo sapiens) 6480464 vorinostat results in increased expression of BPNT1 mRNA CTD PMID:27188386
Imported Annotations - SMPDB
(1->4)-beta-D-glucan (EXP) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (EXP) 4-amino-2,6-dinitrotoluene (ISO) ammonium chloride (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) Benzo[ghi]perylene (EXP) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP) captan (EXP) cisplatin (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) enzyme inhibitor (ISO) flutamide (ISO) folic acid (EXP,ISO) folpet (EXP) gentamycin (ISO) hydroxyurea (EXP) ivermectin (ISO) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methidathion (EXP) methylmercury chloride (ISO) N-methyl-N-nitrosourea (EXP) nefazodone (ISO) nickel atom (ISO) nitrates (EXP) paracetamol (EXP,ISO) pentachlorophenol (EXP) perfluorooctane-1-sulfonic acid (EXP) pirinixic acid (EXP) propiconazole (EXP) rac-lactic acid (ISO) silicon dioxide (ISO) sodium arsenate (EXP) sodium arsenite (ISO) sodium dichromate (EXP) sodium fluoride (EXP) sunitinib (ISO) T-2 toxin (ISO) tetrachloromethane (ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) valproic acid (EXP,ISO) vancomycin (EXP) vorinostat (ISO)
Bpnt1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 185,061,619 - 185,089,974 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 185,064,346 - 185,089,974 (+) Ensembl GRCm39 Ensembl GRCm38 1 185,329,428 - 185,357,777 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 185,332,149 - 185,357,777 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 187,156,038 - 187,181,648 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 187,032,947 - 187,058,557 (+) NCBI MGSCv36 mm8 Celera 1 192,281,814 - 192,307,391 (+) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 89.49 NCBI
BPNT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 220,057,482 - 220,089,788 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 220,057,482 - 220,090,462 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 220,230,824 - 220,263,130 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 218,297,447 - 218,329,814 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 216,619,220 - 216,651,579 NCBI Celera 1 193,450,034 - 193,482,399 (-) NCBI Celera Cytogenetic Map 1 q41 NCBI HuRef 1 190,905,457 - 190,937,542 (-) NCBI HuRef CHM1_1 1 221,503,635 - 221,536,002 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 219,296,762 - 219,329,190 (-) NCBI T2T-CHM13v2.0
Bpnt1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 99,397,127 - 99,425,056 (+) NCBI GRCr8 mRatBN7.2 13 96,865,634 - 96,893,506 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 96,868,580 - 96,893,503 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 99,367,724 - 99,392,688 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 100,773,702 - 100,798,609 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 97,949,983 - 97,974,947 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 103,268,045 - 103,292,848 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 103,268,068 - 103,292,854 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 107,941,070 - 107,965,562 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 101,340,544 - 101,367,549 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 101,540,167 - 101,556,592 (+) NCBI Celera 13 96,381,982 - 96,406,864 (+) NCBI Celera Cytogenetic Map 13 q26 NCBI
Bpnt1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955520 3,524,684 - 3,544,666 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955520 3,521,096 - 3,543,255 (+) NCBI ChiLan1.0 ChiLan1.0
BPNT1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 29,322,727 - 29,356,750 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 29,285,102 - 29,319,100 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 195,629,262 - 195,663,144 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 200,667,016 - 200,699,790 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 200,667,016 - 200,699,790 (-) Ensembl panpan1.1 panPan2
BPNT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 14,834,642 - 14,857,242 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 14,834,643 - 14,857,227 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 14,877,148 - 14,899,802 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 14,869,796 - 14,892,460 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 14,867,722 - 14,892,448 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 14,880,647 - 14,903,284 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 15,225,675 - 15,248,728 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 15,515,028 - 15,537,177 (-) NCBI UU_Cfam_GSD_1.0
Bpnt1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 56,865,682 - 56,890,277 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936650 2,113,649 - 2,138,934 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936650 2,113,933 - 2,138,487 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BPNT1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 9,659,487 - 9,683,912 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 9,659,876 - 9,684,115 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 11,741,839 - 11,765,917 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BPNT1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 9,489,479 - 9,518,936 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 9,490,763 - 9,519,721 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 9,794,651 - 9,825,120 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bpnt1
.
Predicted Target Of
Count of predictions: 1070 Count of miRNA genes: 591 Interacting mature miRNAs: 683 Transcripts: ENSMUST00000027916, ENSMUST00000110965, ENSMUST00000137757, ENSMUST00000151769 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 4142389 Scfr1_m stem cell frequency regulator 1 (mouse) Not determined 171632048 189303617 Mouse 1300888 Berr1_m berghei resistance locus 1 (mouse) Not determined 1 164143227 190534272 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1302023 Orch4_m autoimmune orchitis resistance 4 (mouse) Not determined 1 175211318 195154279 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357620 Aaj1_m anxiety in A/J 1 (mouse) Not determined 1 180832317 191851043 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1301309 Emo1_m emotionality 1 (mouse) Not determined 1 162977097 185994196 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 11532690 Sluc37_m susceptibility to lung cancer 37 (mouse) 1 175468817 194111528 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1301333 Mop3_m morphine preference 3 (mouse) Not determined 1 167756737 189303617 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 12792983 Liq1_m limb inflammation QTL 1 (mouse) 1 167586086 191225397 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 1357692 Axtq1_m anxiety QTL 1 (mouse) Not determined 1 180832317 191851043 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse
D10Mit157.2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 D1 UniSTS Cytogenetic Map 16 B4 UniSTS Cytogenetic Map 18 E2 UniSTS Cytogenetic Map 4 C3 UniSTS Cytogenetic Map 7 B2 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 14 E2.2 UniSTS Cytogenetic Map 4 C7 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 1 F UniSTS Cytogenetic Map 6 C3 UniSTS Cytogenetic Map 11 D UniSTS Cytogenetic Map 3 G2 UniSTS Cytogenetic Map 17 A1 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 3 B UniSTS Cytogenetic Map 8 C1 UniSTS Cytogenetic Map 18 A2 UniSTS Cytogenetic Map 3 F2 UniSTS Cytogenetic Map 14 C3 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 8 E2 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 18 B1 UniSTS Cytogenetic Map 9 C UniSTS Cytogenetic Map 14 C2 UniSTS Cytogenetic Map 6 A1 UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 13 D2.1 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 11 B1.3 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 17 E3 UniSTS Cytogenetic Map 11 B3 UniSTS Cytogenetic Map 1 H4 UniSTS Cytogenetic Map 6 A3 UniSTS Cytogenetic Map 5 E4-E5 UniSTS Cytogenetic Map 15 E1 UniSTS Cytogenetic Map 13 D UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 14 D1 UniSTS Cytogenetic Map 7 B4 UniSTS Cytogenetic Map 8 D3 UniSTS Cytogenetic Map X D UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 7 E2 UniSTS Cytogenetic Map 1 H2.3 UniSTS Cytogenetic Map 7 A2 UniSTS Cytogenetic Map 7 F3 UniSTS Cytogenetic Map 9 F1 UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 15 D2 UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 16 B2 UniSTS Cytogenetic Map 7 C UniSTS Cytogenetic Map 3 F2.1 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 1 C4 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 9 F3 UniSTS Cytogenetic Map 2 B UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 9 A4 UniSTS Cytogenetic Map 5 A3 UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 16 B1 UniSTS Cytogenetic Map 1 A5 UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 9 E1 UniSTS Cytogenetic Map 6 G1 UniSTS Cytogenetic Map X A2 UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 5 E2 UniSTS Cytogenetic Map 12 C1 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 10 C2 UniSTS Cytogenetic Map 9 B UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 10 A4 UniSTS Cytogenetic Map 8 A2 UniSTS Cytogenetic Map 18 A1 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 1 C2 UniSTS Cytogenetic Map 11 B2 UniSTS Cytogenetic Map 6 E3 UniSTS Cytogenetic Map 5 C3.3 UniSTS Cytogenetic Map 1 B UniSTS Cytogenetic Map 17 A3.1 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 4 B1 UniSTS Cytogenetic Map 15 A2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 5 G3 UniSTS Cytogenetic Map 4 A3 UniSTS Cytogenetic Map 2 H3 UniSTS Cytogenetic Map 8 A1 UniSTS Cytogenetic Map 8 A1.1 UniSTS Cytogenetic Map 16 A3 UniSTS Cytogenetic Map 10 B1 UniSTS Cytogenetic Map 19 A UniSTS Cytogenetic Map 10 A1 UniSTS Cytogenetic Map 13 D1 UniSTS Cytogenetic Map 4 A1 UniSTS Cytogenetic Map 9 A3 UniSTS Cytogenetic Map 17 C UniSTS Cytogenetic Map 1 D UniSTS Cytogenetic Map 5 E3 UniSTS Cytogenetic Map 15 D3 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 7 D3 UniSTS Cytogenetic Map 2 A1 UniSTS Cytogenetic Map 14 C1 UniSTS Cytogenetic Map 14 E5 UniSTS Cytogenetic Map 10 C UniSTS Cytogenetic Map 18 B2 UniSTS Cytogenetic Map 2 F1 UniSTS Cytogenetic Map 10 D3 UniSTS Cytogenetic Map 17 A2 UniSTS Cytogenetic Map 2 C3 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 17 B2 UniSTS Cytogenetic Map 5 B2 UniSTS Cytogenetic Map 5 G1 UniSTS Cytogenetic Map 4 C6 UniSTS Cytogenetic Map 13 C3 UniSTS Cytogenetic Map 2 E1 UniSTS Cytogenetic Map 17 A3.2-A3.3 UniSTS Cytogenetic Map 19 C3 UniSTS Cytogenetic Map 7 E3 UniSTS Cytogenetic Map 13 C1 UniSTS Cytogenetic Map 9 E3.1 UniSTS Cytogenetic Map 15 E3 UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X E3 UniSTS Cytogenetic Map 4 C4 UniSTS Cytogenetic Map 3 E3 UniSTS Cytogenetic Map 11 A4 UniSTS Cytogenetic Map 4 C5 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 9 A2 UniSTS Cytogenetic Map 7 E1 UniSTS Cytogenetic Map 5 D-E1 UniSTS Cytogenetic Map 5 B3 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 5 A2 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 1 E4 UniSTS Cytogenetic Map 17 E4 UniSTS Cytogenetic Map 1 G2 UniSTS Cytogenetic Map 15 B3.1 UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 6 A3.3 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 6 F2 UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 4 D2.1 UniSTS Cytogenetic Map 4 A5 UniSTS Cytogenetic Map 3 F2.2 UniSTS Cytogenetic Map 1 E3-E4 UniSTS Cytogenetic Map 9 F1-F3 UniSTS Cytogenetic Map 1 C1.1 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 12 A2 UniSTS Cytogenetic Map 17 A3-B UniSTS Cytogenetic Map 7 F5 UniSTS Cytogenetic Map 14 A3 UniSTS Cytogenetic Map 5 G1.1 UniSTS Cytogenetic Map X F2-F4 UniSTS Cytogenetic Map 7 D2 UniSTS Cytogenetic Map 2 F3 UniSTS Cytogenetic Map 10 A3 UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 9 F1-F2 UniSTS Cytogenetic Map 13 A3.2 UniSTS Cytogenetic Map 10 A2 UniSTS Cytogenetic Map 1 C1 UniSTS Cytogenetic Map 1 A1 UniSTS Cytogenetic Map 12 D3 UniSTS Cytogenetic Map 1 A3-A5 UniSTS Cytogenetic Map 2 A2 UniSTS Cytogenetic Map 3 A1 UniSTS Cytogenetic Map X A3.3 UniSTS Cytogenetic Map 16 A-B1 UniSTS Cytogenetic Map 1 D2.3 UniSTS Cytogenetic Map 6 B2.3 UniSTS Cytogenetic Map 2 G3 UniSTS Cytogenetic Map X A2-A3.1 UniSTS Cytogenetic Map 9 A5.3 UniSTS Cytogenetic Map 14 A2-B UniSTS Cytogenetic Map 8 E1-E2 UniSTS Cytogenetic Map 8 A3 UniSTS Cytogenetic Map 1 G3-H1 UniSTS Cytogenetic Map 8 B3-C1 UniSTS Cytogenetic Map 19 C1 UniSTS Cytogenetic Map 8 C5 UniSTS Cytogenetic Map 8 A4 UniSTS Cytogenetic Map 15 F3 UniSTS Cytogenetic Map 14 E4 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map X F5 UniSTS cM Map 10 40.0 UniSTS Whitehead Genetic 10 33.9 UniSTS
D0Nds34
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 1 H4 UniSTS cM Map UN UniSTS cM Map 6 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000027916 ⟹ ENSMUSP00000027916
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 185,064,346 - 185,089,974 (+) Ensembl GRCm38.p6 Ensembl 1 185,332,149 - 185,357,777 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000110965 ⟹ ENSMUSP00000106590
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 185,064,377 - 185,088,978 (+) Ensembl GRCm38.p6 Ensembl 1 185,332,180 - 185,356,781 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000137757
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 185,064,404 - 185,078,901 (+) Ensembl GRCm38.p6 Ensembl 1 185,332,207 - 185,346,704 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000151769 ⟹ ENSMUSP00000117122
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 185,064,370 - 185,077,536 (+) Ensembl GRCm38.p6 Ensembl 1 185,332,173 - 185,345,339 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000210277 ⟹ ENSMUSP00000147674
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 185,064,369 - 185,088,978 (+) Ensembl GRCm38.p6 Ensembl 1 185,332,172 - 185,356,781 (+) Ensembl
RefSeq Acc Id:
NM_001347210 ⟹ NP_001334139
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 185,064,356 - 185,089,974 (+) NCBI GRCm38 1 185,332,159 - 185,357,777 (+) NCBI
Sequence:
AGCCGCTGTCCTTCTCACAGCATTGGACCAGTGGACTTGGAGGCAGCCGGTTCCCGGACAGCGAGCCACCAGGCCGGACAGCGCTTAGGGGACACCAGGCTGAGTGTTTATCATGGCTTCCAGCCACA
hide sequence
RefSeq Acc Id:
NM_001347212 ⟹ NP_001334141
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 185,064,356 - 185,089,974 (+) NCBI GRCm38 1 185,332,159 - 185,357,777 (+) NCBI
Sequence:
AGCCGCTGTCCTTCTCACAGCATTGGACCAGTGGACTTGGAGGCAGCCGGTTCCCGGACAGCGA
hide sequence
RefSeq Acc Id:
NM_011794 ⟹ NP_035924
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 185,064,356 - 185,089,966 (+) NCBI GRCm38 1 185,332,159 - 185,357,769 (+) NCBI MGSCv37 1 187,156,038 - 187,181,648 (+) RGD Celera 1 192,281,814 - 192,307,391 (+) RGD cM Map 1 ENTREZGENE
Sequence:
AGCCGCTGTCCTTCTCACAGCATTGGACCAGTGGACTTGGAGGCAGCCGGTTCCCGGACAGCGAGCCACCAGGCCGGACAGCGCTTAGGGGACACCAGGCTGAGTGTTTATCATGGCTTCCAGCCACA
hide sequence
RefSeq Acc Id:
XM_006497160 ⟹ XP_006497223
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 185,061,619 - 185,089,969 (+) NCBI GRCm38 1 185,329,428 - 185,357,772 (+) NCBI
Sequence:
AAGGGCGGGGTTTTCCGGCTTGGAAGTCTGTATCTCTACAGGTCTTTCATGAGGTCTAGTAGGG
hide sequence
RefSeq Acc Id:
XM_006497161 ⟹ XP_006497224
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 185,061,619 - 185,089,969 (+) NCBI GRCm38 1 185,329,428 - 185,357,772 (+) NCBI
Sequence:
AAGGGCGGGGTTTTCCGGCTTGGAAGTCTGTATCTCTACAGGTCTTTCATGAGGTCTAGTAGGGGTAGAGAGAGGTGTTTACTATCACTCGGCTTTCCCCAATCAGATACATTTAATTAACTTGTCCA
hide sequence
RefSeq Acc Id:
XM_030253921 ⟹ XP_030109781
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 185,061,619 - 185,089,969 (+) NCBI GRCm38 1 185,329,428 - 185,357,772 (+) NCBI
Sequence:
AAGGGCGGGGTTTTCCGGCTTGGAAGTCTGTATCTCTACAGGTCTTTCATGAGGTCTAGTAGGGGTAGAGAGAGGTGTTTACTATCACTCGGCTTTCCCCAATCAGATACATTTAATTAACTTGTCCA
hide sequence
RefSeq Acc Id:
NP_035924 ⟸ NM_011794
- Peptide Label:
isoform 1
- UniProtKB:
Q91XB9 (UniProtKB/Swiss-Prot), Q3U8Z5 (UniProtKB/Swiss-Prot), Q9D7Y0 (UniProtKB/Swiss-Prot), Q9Z0S1 (UniProtKB/Swiss-Prot), Q3UBN8 (UniProtKB/TrEMBL)
- Sequence:
MASSHTVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRLVQMSICSSLARKFPKLTIIGEEDLPPGEVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEG
hide sequence
RefSeq Acc Id:
XP_006497224 ⟸ XM_006497161
- Peptide Label:
isoform X3
- UniProtKB:
Q3UBN8 (UniProtKB/TrEMBL)
- Sequence:
MSICSSLARKFPKLTIIGEEDLPPGEVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPL
hide sequence
RefSeq Acc Id:
XP_006497223 ⟸ XM_006497160
- Peptide Label:
isoform X1
- UniProtKB:
A0A1B0GRV0 (UniProtKB/TrEMBL), Q3UBN8 (UniProtKB/TrEMBL)
- Sequence:
MASSHTVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRLVQMSICSSLARKFPKLTIIGEEDLPPGEVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEG
hide sequence
RefSeq Acc Id:
XP_030109781 ⟸ XM_030253921
- Peptide Label:
isoform X2
- UniProtKB:
Q9Z0S1 (UniProtKB/Swiss-Prot), Q91XB9 (UniProtKB/Swiss-Prot), Q3U8Z5 (UniProtKB/Swiss-Prot), Q9D7Y0 (UniProtKB/Swiss-Prot), Q3UBN8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001334139 ⟸ NM_001347210
- Peptide Label:
isoform 2
- UniProtKB:
A0A1B0GRV0 (UniProtKB/TrEMBL), Q3UBN8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001334141 ⟸ NM_001347212
- Peptide Label:
isoform 3
- UniProtKB:
D3Z0E6 (UniProtKB/TrEMBL), Q3UBN8 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000027916 ⟸ ENSMUST00000027916
Ensembl Acc Id:
ENSMUSP00000106590 ⟸ ENSMUST00000110965
Ensembl Acc Id:
ENSMUSP00000117122 ⟸ ENSMUST00000151769
Ensembl Acc Id:
ENSMUSP00000147674 ⟸ ENSMUST00000210277
RGD ID: 6876026 Promoter ID: EPDNEW_M1464 Type: initiation region Name: Bpnt1_1 Description: Mus musculus bisphosphate 3'-nucleotidase 1 , transcript variant2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 185,332,180 - 185,332,240 EPDNEW
RGD ID: 6817443 Promoter ID: MM_KWN:3225 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000027916, OTTMUST00000050822, OTTMUST00000050823, UC007DZD.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 187,155,646 - 187,156,152 (+) MPROMDB
Ensembl Genes ENSMUSG00000026617 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSMUST00000027916 ENTREZGENE
ENSMUST00000027916.13 UniProtKB/Swiss-Prot
ENSMUST00000110965 ENTREZGENE
ENSMUST00000210277 ENTREZGENE
Gene3D-CATH 3.40.190.80 UniProtKB/Swiss-Prot
Fructose-1,6-Bisphosphatase, subunit A, domain 1 UniProtKB/Swiss-Prot
InterPro CysQ/Inositol_MonoPase UniProtKB/Swiss-Prot
Inositol_monoP_metal-BS UniProtKB/Swiss-Prot
Inositol_monophosphatase-like UniProtKB/Swiss-Prot
Inositol_monophosphatase_CS UniProtKB/Swiss-Prot
KEGG Report mmu:23827 UniProtKB/Swiss-Prot
MGD MGI:1338800 ENTREZGENE
NCBI Gene 23827 ENTREZGENE
PANTHER 3'(2'),5'-BISPHOSPHATE NUCLEOTIDASE 1 UniProtKB/Swiss-Prot
3'(2'),5'-BISPHOSPHATE NUCLEOTIDASE 1 UniProtKB/Swiss-Prot
Pfam Inositol_P UniProtKB/Swiss-Prot
PhenoGen Bpnt1 PhenoGen
PROSITE IMP_1 UniProtKB/Swiss-Prot
IMP_2 UniProtKB/Swiss-Prot
Superfamily-SCOP Carbohydrate phosphatase UniProtKB/Swiss-Prot
UniProt A0A1B0GRV0 ENTREZGENE, UniProtKB/TrEMBL
BPNT1_MOUSE UniProtKB/Swiss-Prot
D3Z0E6 ENTREZGENE, UniProtKB/TrEMBL
D3Z5X0_MOUSE UniProtKB/TrEMBL
Q3U449_MOUSE UniProtKB/TrEMBL
Q3U8Z5 ENTREZGENE
Q3UBN8 ENTREZGENE, UniProtKB/TrEMBL
Q91XB9 ENTREZGENE
Q9D7Y0 ENTREZGENE
Q9Z0S1 ENTREZGENE
UniProt Secondary Q3U8Z5 UniProtKB/Swiss-Prot
Q91XB9 UniProtKB/Swiss-Prot
Q9D7Y0 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2020-04-07
Bpnt1
3'(2'), 5'-bisphosphate nucleotidase 1
Bpnt1
bisphosphate 3'-nucleotidase 1
Symbol and/or name change
5135510 APPROVED
