Symbol:
Sars1
Name:
seryl-tRNA synthetase 1
RGD ID:
1552505
MGI Page
MGI
Description:
Predicted to enable several functions, including aminoacyl-tRNA ligase activity; protein homodimerization activity; and tRNA binding activity. Predicted to be involved in several processes, including negative regulation of angiogenesis; negative regulation of macromolecule biosynthetic process; and translation. Located in mitochondrion. Is expressed in several structures, including alimentary system; central nervous system; early conceptus; exocrine system; and genitourinary system. Human ortholog(s) of this gene implicated in intellectual disability. Orthologous to human SARS1 (seryl-tRNA synthetase 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
C78314; S; Sars; serine--tRNA ligase; serine--tRNA ligase, cytoplasmic; serRS; seryl-aminoacyl-tRNA synthetase 1; seryl-tRNA synthetase, cytoplasmic; seryl-tRNA(Ser/Sec) synthetase; Strs
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SARS1 (seryl-tRNA synthetase 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Sars1 (seryl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sars1 (seryl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SARS1 (seryl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SARS1 (seryl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sars1 (seryl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SARS1 (seryl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103225885 (seryl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sars1 (seryl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Sars1 (seryl-tRNA synthetase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SARS1 (seryl-tRNA synthetase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sars (seryl-tRNA synthetase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
sars-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SES1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
SerRS
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sars1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 108,332,180 - 108,352,575 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 108,332,181 - 108,352,525 (-) Ensembl GRCm39 Ensembl GRCm38 3 108,424,864 - 108,445,259 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 108,424,865 - 108,445,209 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 108,229,530 - 108,248,087 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 108,554,668 - 108,573,225 (-) NCBI MGSCv36 mm8 Celera 3 110,760,829 - 110,779,384 (-) NCBI Celera Cytogenetic Map 3 F3 NCBI cM Map 3 47.08 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sars1 Mouse (+)-schisandrin B multiple interactions ISO RGD:628813 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of SARS1 mRNA] CTD PMID:31150632 Sars1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SARS1 mRNA CTD PMID:36331819 Sars1 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SARS1 mRNA CTD PMID:22206623 Sars1 Mouse 17alpha-ethynylestradiol affects expression ISO RGD:1348583 6480464 Ethinyl Estradiol affects the expression of SARS1 mRNA CTD PMID:20170705|PMID:26865667 Sars1 Mouse 17alpha-ethynylestradiol affects expression ISO RGD:628813 6480464 Ethinyl Estradiol affects the expression of SARS1 mRNA CTD PMID:20170705|PMID:26865667 Sars1 Mouse 17beta-estradiol multiple interactions ISO RGD:628813 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SARS1 mRNA CTD PMID:26496021 Sars1 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of SARS1 mRNA CTD PMID:39298647 Sars1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:1348583 6480464 2,2',4,4'-tetrabromodiphenyl ether analog results in increased expression of SARS1 mRNA CTD PMID:19095052 Sars1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions EXP 6480464 [Flame Retardants results in increased abundance of 2,2',4,4'-tetrabromodiphenyl ether] which results in increased expression of more ... CTD PMID:38995820 Sars1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:628813 6480464 Tetrachlorodibenzodioxin results in increased expression of SARS1 mRNA CTD PMID:33387578 Sars1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SARS1 mRNA CTD PMID:21570461 Sars1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:628813 6480464 Tetrachlorodibenzodioxin affects the expression of SARS1 mRNA CTD PMID:22298810 Sars1 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO RGD:1348583 6480464 2,2',4,4',5-brominated diphenyl ether results in increased expression of SARS1 mRNA CTD PMID:26705709 Sars1 Mouse 3-chloropropane-1,2-diol increases expression ISO RGD:628813 6480464 alpha-Chlorohydrin results in increased expression of SARS1 protein CTD PMID:34915118 Sars1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of SARS1 mRNA CTD PMID:39298647 Sars1 Mouse 4,4'-sulfonyldiphenol increases expression ISO RGD:1348583 6480464 bisphenol S results in increased expression of SARS1 protein CTD PMID:34186270 Sars1 Mouse aconitine decreases expression ISO RGD:628813 6480464 Aconitine results in decreased expression of SARS1 protein CTD PMID:33236894 Sars1 Mouse actinomycin D multiple interactions ISO RGD:1348583 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of SARS1 protein CTD PMID:38460933 Sars1 Mouse aflatoxin B1 decreases methylation ISO RGD:1348583 6480464 Aflatoxin B1 results in decreased methylation of SARS1 gene CTD PMID:27153756 Sars1 Mouse all-trans-retinoic acid decreases expression ISO RGD:1348583 6480464 Tretinoin results in decreased expression of SARS1 mRNA CTD PMID:33167477 Sars1 Mouse AM-251 increases expression ISO RGD:1348583 6480464 AM 251 results in increased expression of SARS1 mRNA CTD PMID:16500647 Sars1 Mouse ammonium chloride affects expression ISO RGD:628813 6480464 Ammonium Chloride affects the expression of SARS1 mRNA CTD PMID:16483693 Sars1 Mouse benzatropine decreases expression ISO RGD:1348583 6480464 Benztropine results in decreased expression of SARS1 protein CTD PMID:34122009 Sars1 Mouse benzo[a]pyrene increases methylation ISO RGD:1348583 6480464 Benzo(a)pyrene results in increased methylation of SARS1 promoter CTD PMID:27901495 Sars1 Mouse bisphenol A affects expression ISO RGD:1348583 6480464 bisphenol A affects the expression of SARS1 mRNA CTD PMID:20170705|PMID:30903817 Sars1 Mouse bisphenol A decreases expression ISO RGD:1348583 6480464 bisphenol A results in decreased expression of SARS1 protein CTD PMID:34186270 Sars1 Mouse bisphenol A decreases expression ISO RGD:628813 6480464 bisphenol A results in decreased expression of SARS1 mRNA CTD PMID:33296240 Sars1 Mouse bisphenol A increases expression ISO RGD:1348583 6480464 bisphenol A results in increased expression of SARS1 mRNA; bisphenol A results in increased expression more ... CTD PMID:29275510|PMID:33670352|PMID:37567409 Sars1 Mouse bisphenol A increases methylation ISO RGD:628813 6480464 bisphenol A results in increased methylation of SARS1 gene CTD PMID:28505145 Sars1 Mouse bisphenol A affects expression ISO RGD:628813 6480464 bisphenol A affects the expression of SARS1 mRNA CTD PMID:25181051 Sars1 Mouse bisphenol A multiple interactions ISO RGD:628813 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SARS1 mRNA CTD PMID:26496021 Sars1 Mouse bisphenol AF increases expression ISO RGD:1348583 6480464 bisphenol AF results in increased expression of SARS1 protein CTD PMID:34186270 Sars1 Mouse Bisphenol B increases expression ISO RGD:1348583 6480464 bisphenol B results in increased expression of SARS1 protein CTD PMID:34186270 Sars1 Mouse bisphenol F increases expression ISO RGD:1348583 6480464 bisphenol F results in increased expression of SARS1 protein CTD PMID:34186270 Sars1 Mouse cadmium dichloride affects localization ISO RGD:1348583 6480464 Cadmium Chloride affects the localization of SARS1 protein CTD PMID:18261755 Sars1 Mouse cadmium dichloride decreases expression ISO RGD:1348583 6480464 Cadmium Chloride results in decreased expression of SARS1 mRNA CTD PMID:25596134 Sars1 Mouse cannabidiol increases expression EXP 6480464 Cannabidiol results in increased expression of SARS1 mRNA CTD PMID:21542829 Sars1 Mouse carbamazepine affects expression ISO RGD:1348583 6480464 Carbamazepine affects the expression of SARS1 mRNA CTD PMID:24752500|PMID:25979313 Sars1 Mouse CGP 52608 multiple interactions ISO RGD:1348583 6480464 CGP 52608 promotes the reaction [RORA protein binds to SARS1 gene] CTD PMID:28238834 Sars1 Mouse chloropicrin decreases expression ISO RGD:1348583 6480464 chloropicrin results in decreased expression of SARS1 mRNA CTD PMID:26352163 Sars1 Mouse cidofovir anhydrous increases expression ISO RGD:1348583 6480464 Cidofovir results in increased expression of SARS1 mRNA CTD PMID:25596134 Sars1 Mouse cisplatin multiple interactions ISO RGD:1348583 6480464 Cisplatin inhibits the reaction [Piroxicam results in decreased expression of SARS1 mRNA] CTD PMID:21858171 Sars1 Mouse cisplatin increases expression ISO RGD:1348583 6480464 Cisplatin results in increased expression of SARS1 mRNA CTD PMID:25596134 Sars1 Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of SARS1 mRNA CTD PMID:23811191 Sars1 Mouse clozapine decreases expression ISO RGD:1348583 6480464 Clozapine results in decreased expression of SARS1 protein CTD PMID:34122009 Sars1 Mouse cobalt dichloride increases expression ISO RGD:628813 6480464 cobaltous chloride results in increased expression of SARS1 mRNA CTD PMID:24386269 Sars1 Mouse copper(II) sulfate increases expression ISO RGD:1348583 6480464 Copper Sulfate results in increased expression of SARS1 mRNA CTD PMID:19549813 Sars1 Mouse cyclosporin A increases expression ISO RGD:1348583 6480464 Cyclosporine results in increased expression of SARS1 mRNA CTD PMID:20106945|PMID:21632981|PMID:25562108|PMID:25596134|PMID:27989131 Sars1 Mouse cyclosporin A increases expression ISO RGD:628813 6480464 Cyclosporine results in increased expression of SARS1 mRNA CTD PMID:25596134 Sars1 Mouse dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of SARS1 mRNA CTD PMID:22733784 Sars1 Mouse diclofenac affects expression ISO RGD:1348583 6480464 Diclofenac affects the expression of SARS1 mRNA CTD PMID:24752500 Sars1 Mouse dioxygen increases expression ISO RGD:1348583 6480464 Oxygen deficiency results in increased expression of SARS1 mRNA CTD PMID:25596134 Sars1 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of SARS1 mRNA CTD PMID:30529165 Sars1 Mouse dorsomorphin multiple interactions ISO RGD:1348583 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Sars1 Mouse doxorubicin increases expression ISO RGD:1348583 6480464 Doxorubicin results in increased expression of SARS1 mRNA CTD PMID:29803840 Sars1 Mouse endosulfan increases expression ISO RGD:628813 6480464 Endosulfan results in increased expression of SARS1 mRNA CTD PMID:29391264 Sars1 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of SARS1 mRNA CTD PMID:30319688 Sars1 Mouse ethyl methanesulfonate increases expression ISO RGD:1348583 6480464 Ethyl Methanesulfonate results in increased expression of SARS1 mRNA CTD PMID:23649840 Sars1 Mouse fenofibrate increases expression ISO RGD:628813 6480464 Fenofibrate results in increased expression of SARS1 mRNA CTD PMID:25596134 Sars1 Mouse flutamide increases expression ISO RGD:628813 6480464 Flutamide results in increased expression of SARS1 mRNA CTD PMID:24136188 Sars1 Mouse folic acid increases expression EXP 6480464 Folic Acid results in increased expression of SARS1 mRNA CTD PMID:25629700 Sars1 Mouse folic acid multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SARS1 mRNA CTD PMID:22206623 Sars1 Mouse formaldehyde increases expression ISO RGD:1348583 6480464 Formaldehyde results in increased expression of SARS1 mRNA CTD PMID:23649840 Sars1 Mouse genistein increases expression ISO RGD:1348583 6480464 Genistein results in increased expression of SARS1 mRNA CTD PMID:26865667 Sars1 Mouse gentamycin increases expression ISO RGD:628813 6480464 Gentamicins results in increased expression of SARS1 mRNA; Gentamicins results in increased expression of SARS1 more ... CTD PMID:22061828|PMID:33387578 Sars1 Mouse haloperidol decreases expression ISO RGD:1348583 6480464 Haloperidol results in decreased expression of SARS1 protein CTD PMID:34122009 Sars1 Mouse ibuprofen decreases expression ISO RGD:628813 6480464 Ibuprofen results in decreased expression of SARS1 mRNA CTD PMID:25596134 Sars1 Mouse ifosfamide increases expression ISO RGD:1348583 6480464 Ifosfamide results in increased expression of SARS1 mRNA CTD PMID:25596134 Sars1 Mouse indometacin increases expression ISO RGD:1348583 6480464 Indomethacin results in increased expression of SARS1 mRNA CTD PMID:17401462 Sars1 Mouse ivermectin decreases expression ISO RGD:1348583 6480464 Ivermectin results in decreased expression of SARS1 protein CTD PMID:32959892 Sars1 Mouse lead(0) decreases expression ISO RGD:1348583 6480464 Lead results in decreased expression of SARS1 mRNA CTD PMID:33194959 Sars1 Mouse leflunomide increases expression ISO RGD:628813 6480464 Leflunomide results in increased expression of SARS1 mRNA CTD PMID:24136188 Sars1 Mouse leflunomide increases expression ISO RGD:1348583 6480464 Leflunomide results in increased expression of SARS1 mRNA CTD PMID:28988120 Sars1 Mouse mercury dichloride increases expression ISO RGD:628813 6480464 Mercuric Chloride results in increased expression of SARS1 mRNA CTD PMID:16507785 Sars1 Mouse metformin increases expression ISO RGD:628813 6480464 Metformin results in increased expression of SARS1 mRNA CTD PMID:25596134 Sars1 Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of SARS1 mRNA CTD PMID:34813904 Sars1 Mouse methyl methanesulfonate increases expression ISO RGD:1348583 6480464 Methyl Methanesulfonate results in increased expression of SARS1 mRNA CTD PMID:23649840 Sars1 Mouse methylmercury chloride increases expression ISO RGD:1348583 6480464 methylmercuric chloride results in increased expression of SARS1 mRNA CTD PMID:28001369 Sars1 Mouse N(4)-hydroxycytidine decreases expression EXP 6480464 N(4)-hydroxycytidine results in decreased expression of SARS mRNA CTD PMID:37748715 Sars1 Mouse N-methyl-4-phenylpyridinium increases expression ISO RGD:1348583 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SARS1 mRNA CTD PMID:24810058 Sars1 Mouse N-methyl-4-phenylpyridinium increases expression ISO RGD:628813 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SARS1 mRNA CTD PMID:28801915 Sars1 Mouse N-methyl-4-phenylpyridinium increases methylation ISO RGD:628813 6480464 1-Methyl-4-phenylpyridinium results in increased methylation of SARS1 gene CTD PMID:28801915 Sars1 Mouse nefazodone increases expression ISO RGD:628813 6480464 nefazodone results in increased expression of SARS1 mRNA CTD PMID:24136188 Sars1 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SARS1 more ... CTD PMID:35964746 Sars1 Mouse Nutlin-3 multiple interactions ISO RGD:1348583 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of SARS1 protein CTD PMID:38460933 Sars1 Mouse ochratoxin A decreases expression ISO RGD:1348583 6480464 ochratoxin A results in decreased expression of SARS1 mRNA CTD PMID:30559759 Sars1 Mouse p-chloromercuribenzoic acid multiple interactions ISO RGD:1348583 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Sars1 Mouse paracetamol increases expression ISO RGD:628813 6480464 Acetaminophen results in increased expression of SARS1 mRNA CTD PMID:33387578 Sars1 Mouse paracetamol increases expression ISO RGD:1348583 6480464 Acetaminophen results in increased expression of SARS1 mRNA CTD PMID:29067470 Sars1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of SARS1 mRNA CTD PMID:17562736 Sars1 Mouse paraquat increases expression ISO RGD:628813 6480464 Paraquat results in increased expression of SARS1 mRNA CTD PMID:32680482 Sars1 Mouse pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of SARS1 mRNA CTD PMID:23892564 Sars1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SARS1 mRNA CTD PMID:36331819 Sars1 Mouse perfluorooctanoic acid increases expression ISO RGD:1348583 6480464 perfluorooctanoic acid results in increased expression of SARS1 mRNA; perfluorooctanoic acid results in increased expression more ... CTD PMID:25868421|PMID:26879310 Sars1 Mouse phenobarbital affects expression ISO RGD:1348583 6480464 Phenobarbital affects the expression of SARS1 mRNA CTD PMID:19159669 Sars1 Mouse phosgene affects expression EXP 6480464 Phosgene affects the expression of SARS1 mRNA CTD PMID:16300373 Sars1 Mouse piroxicam decreases expression ISO RGD:1348583 6480464 Piroxicam results in decreased expression of SARS1 mRNA CTD PMID:21858171 Sars1 Mouse piroxicam multiple interactions ISO RGD:1348583 6480464 Cisplatin inhibits the reaction [Piroxicam results in decreased expression of SARS1 mRNA] CTD PMID:21858171 Sars1 Mouse progesterone increases expression ISO RGD:1348583 6480464 Progesterone results in increased expression of SARS1 mRNA CTD PMID:18037150 Sars1 Mouse pterostilbene increases expression ISO RGD:1348583 6480464 pterostilbene results in increased expression of SARS1 mRNA CTD PMID:22450950 Sars1 Mouse pyrogallol increases expression EXP 6480464 Pyrogallol results in increased expression of SARS1 mRNA CTD PMID:20362636 Sars1 Mouse resveratrol increases expression ISO RGD:1348583 6480464 Resveratrol results in increased expression of SARS1 mRNA CTD PMID:12569576 Sars1 Mouse rotenone increases expression ISO RGD:628813 6480464 Rotenone results in increased expression of SARS1 mRNA CTD PMID:28374803 Sars1 Mouse S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO RGD:1348583 6480464 S-(1,2-dichlorovinyl)cysteine results in increased expression of SARS1 mRNA CTD PMID:33725128 Sars1 Mouse SB 431542 multiple interactions ISO RGD:1348583 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Sars1 Mouse sodium arsenite decreases expression ISO RGD:1348583 6480464 sodium arsenite results in decreased expression of SARS1 mRNA CTD PMID:28595984|PMID:34032870 Sars1 Mouse sodium arsenite increases expression ISO RGD:1348583 6480464 sodium arsenite results in increased expression of SARS1 mRNA CTD PMID:38568856 Sars1 Mouse sodium dichromate increases expression ISO RGD:628813 6480464 sodium bichromate results in increased expression of SARS1 mRNA CTD PMID:22561333 Sars1 Mouse sunitinib increases expression ISO RGD:1348583 6480464 Sunitinib results in increased expression of SARS1 mRNA CTD PMID:31533062 Sars1 Mouse tetrachloroethene increases expression EXP 6480464 Tetrachloroethylene results in increased expression of SARS1 mRNA CTD PMID:28973375 Sars1 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SARS1 mRNA CTD PMID:27339419|PMID:31919559 Sars1 Mouse tetrachloromethane multiple interactions ISO RGD:628813 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of SARS1 mRNA] CTD PMID:31150632 Sars1 Mouse tetrachloromethane increases expression ISO RGD:628813 6480464 Carbon Tetrachloride results in increased expression of SARS1 mRNA CTD PMID:31150632 Sars1 Mouse thapsigargin increases expression ISO RGD:1348583 6480464 Thapsigargin results in increased expression of SARS1 mRNA; Thapsigargin results in increased expression of SARS1 more ... CTD PMID:22378314|PMID:29453283 Sars1 Mouse thapsigargin increases expression ISO RGD:628813 6480464 Thapsigargin results in increased expression of SARS1 protein CTD PMID:35544339 Sars1 Mouse thiram increases expression ISO RGD:1348583 6480464 Thiram results in increased expression of SARS1 mRNA CTD PMID:38568856 Sars1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of SARS gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Sars1 Mouse trichloroethene increases expression ISO RGD:628813 6480464 Trichloroethylene results in increased expression of SARS1 mRNA CTD PMID:33387578 Sars1 Mouse tunicamycin increases expression ISO RGD:1348583 6480464 Tunicamycin results in increased expression of SARS1 mRNA; Tunicamycin results in increased expression of SARS1 more ... CTD PMID:22378314|PMID:29453283 Sars1 Mouse valproic acid increases expression ISO RGD:1348583 6480464 Valproic Acid results in increased expression of SARS1 mRNA CTD PMID:23179753|PMID:29154799 Sars1 Mouse valproic acid affects expression ISO RGD:1348583 6480464 Valproic Acid affects the expression of SARS1 mRNA CTD PMID:25979313 Sars1 Mouse vinclozolin decreases expression ISO RGD:628813 6480464 vinclozolin results in decreased expression of SARS1 mRNA CTD PMID:23034163 Sars1 Mouse vorinostat decreases expression ISO RGD:1348583 6480464 Vorinostat results in decreased expression of SARS1 mRNA CTD PMID:27188386
Imported Annotations - SMPDB
(+)-schisandrin B (ISO) (1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3-chloropropane-1,2-diol (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) aconitine (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) AM-251 (ISO) ammonium chloride (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) bisphenol A (ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium dichloride (ISO) cannabidiol (EXP) carbamazepine (ISO) CGP 52608 (ISO) chloropicrin (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clofibrate (EXP) clozapine (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dexamethasone (EXP) diclofenac (ISO) dioxygen (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (ISO) ethanol (EXP) ethyl methanesulfonate (ISO) fenofibrate (ISO) flutamide (ISO) folic acid (EXP) formaldehyde (ISO) genistein (ISO) gentamycin (ISO) haloperidol (ISO) ibuprofen (ISO) ifosfamide (ISO) indometacin (ISO) ivermectin (ISO) lead(0) (ISO) leflunomide (ISO) mercury dichloride (ISO) metformin (ISO) methidathion (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N(4)-hydroxycytidine (EXP) N-methyl-4-phenylpyridinium (ISO) nefazodone (ISO) nitrates (EXP) Nutlin-3 (ISO) ochratoxin A (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) paraquat (ISO) pentachlorophenol (EXP) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (ISO) phenobarbital (ISO) phosgene (EXP) piroxicam (ISO) progesterone (ISO) pterostilbene (ISO) pyrogallol (EXP) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sunitinib (ISO) tetrachloroethene (EXP) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thiram (ISO) titanium dioxide (EXP) trichloroethene (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (ISO) vorinostat (ISO)
1.
Genetic mapping of 262 loci derived from expressed sequences in a murine interspecific cross using single-strand conformational polymorphism analysis.
Brady KP, etal., Genome Res 1997 Nov;7(11):1085-93.
2.
Functional Epigenetic Analysis of Prostate Carcinoma: A Role for Seryl-tRNA Synthetase?
Ikromov O, etal., J Biomark. 2014;2014:362164. doi: 10.1155/2014/362164. Epub 2014 Mar 27.
3.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.
Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development.
Ko MS, etal., Development 2000 Apr;127(8):1737-49.
5.
MGDs mouse GO annotations
MGD data from the GO Consortium
6.
Mammalian seryl-tRNA synthetase associates with mRNA in vivo and has homology to elongation factor 1 alpha.
Miseta A, etal., J Biol Chem 1991 Oct 15;266(29):19158-61.
7.
Mutations of the aminoacyl-tRNA-synthetases SARS and WARS2 are implicated in the etiology of autosomal recessive intellectual disability.
Musante L, etal., Hum Mutat. 2017 Jun;38(6):621-636. doi: 10.1002/humu.23205. Epub 2017 Mar 23.
8.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
9.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Sars1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 108,332,180 - 108,352,575 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 108,332,181 - 108,352,525 (-) Ensembl GRCm39 Ensembl GRCm38 3 108,424,864 - 108,445,259 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 108,424,865 - 108,445,209 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 108,229,530 - 108,248,087 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 108,554,668 - 108,573,225 (-) NCBI MGSCv36 mm8 Celera 3 110,760,829 - 110,779,384 (-) NCBI Celera Cytogenetic Map 3 F3 NCBI cM Map 3 47.08 NCBI
SARS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 109,213,893 - 109,238,182 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 109,213,918 - 109,238,182 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 109,756,515 - 109,780,804 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 109,558,063 - 109,582,308 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 109,468,581 - 109,492,827 NCBI Celera 1 108,025,871 - 108,050,163 (+) NCBI Celera Cytogenetic Map 1 p13.3 NCBI HuRef 1 107,649,736 - 107,674,024 (+) NCBI HuRef CHM1_1 1 109,871,309 - 109,895,637 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 109,246,703 - 109,270,991 (+) NCBI T2T-CHM13v2.0
Sars1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 198,753,673 - 198,769,411 (-) NCBI GRCr8 mRatBN7.2 2 196,065,543 - 196,081,240 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 196,065,430 - 196,081,277 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 203,708,691 - 203,726,182 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 201,590,809 - 201,608,303 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 196,407,774 - 196,425,268 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 211,219,743 - 211,235,475 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 211,219,750 - 211,235,467 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 230,689,709 - 230,705,638 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 203,995,537 - 204,011,262 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 203,960,370 - 203,964,749 (-) NCBI Celera 2 188,711,760 - 188,728,010 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
Sars1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955435 12,641,776 - 12,660,682 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955435 12,642,485 - 12,659,833 (+) NCBI ChiLan1.0 ChiLan1.0
SARS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 118,065,900 - 118,091,212 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 117,225,766 - 117,251,171 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 111,590,850 - 111,615,068 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 110,755,241 - 110,779,616 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 110,755,054 - 110,779,704 (+) Ensembl panpan1.1 panPan2
SARS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 42,584,792 - 42,605,201 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 42,584,798 - 42,605,136 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 45,359,499 - 45,379,900 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 42,916,110 - 42,936,514 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 42,915,405 - 42,936,515 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 42,647,449 - 42,667,829 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 42,605,509 - 42,625,891 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 43,040,831 - 43,061,242 (-) NCBI UU_Cfam_GSD_1.0
Sars1
SARS1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 110,857,089 - 110,874,815 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 110,857,067 - 110,874,712 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 121,350,908 - 121,368,532 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103225885
Sars1
.
Predicted Target Of
Count of predictions: 1392 Count of miRNA genes: 652 Interacting mature miRNAs: 814 Transcripts: ENSMUST00000090553, ENSMUST00000102625, ENSMUST00000132467, ENSMUST00000153499 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301392 Eae3_m susceptibility to experimental allergic encephalomyelitis 3 (mouse) Not determined 3 79548730 113548837 Mouse 1301904 Iba2_m induction of brown adipocytes 2 (mouse) Not determined 3 82147043 116147184 Mouse 1300752 Ap6q_m alcohol preference 6 QTL (mouse) Not determined 3 100372912 147045722 Mouse 26884382 Bzwq1_m bi-zygomatic width QTL 1, 5 week (mouse) 3 52207421 137205761 Mouse 11041900 Lmr11a_m leishmaniasis resistance 11a (mouse) 3 83463991 117464137 Mouse 14746984 Manh54_m mandible shape 54 (mouse) 3 85289152 119289152 Mouse 12738440 Twq3_m testis weight QTL 3 (mouse) 3 87228015 121228015 Mouse 25314313 Syncl1_m synaptonemal complex length 1 (mouse) 3 67907333 128393649 Mouse 1301272 Cfsw1_m cystic fibrosis survival to weaning 1 (mouse) Not determined 3 83882912 117883044 Mouse 1357599 msrvh1_m modifier of susceptibility to renal vascular hypertrophy/hyperplasia 1 (mouse) Not determined 3 107376936 115624197 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 11533920 Mvb3_m modifier of vibrator 3 (mouse) 3 98635284 132635383 Mouse 26884427 Cvht4_m cranial vault height 4, 10 week (mouse) 3 16054164 109707316 Mouse 10766455 Sle22_m systematic lupus erythematosus susceptibility 22 (mouse) 3 90376936 124377072 Mouse 14747001 Mancz4_m mandible centroid size 4 (mouse) 3 90378017 124378017 Mouse 26884419 Bzwq6_m bi-zygomatic width QTL 6, 10 week (mouse) 3 100607316 137205761 Mouse 1301705 Sles3_m systemic lupus erythmatosus suppressor 3 (mouse) Not determined 3 37174862 143353183 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 1357583 Sle18_m systematic lupus erythematosus susceptibility 18 (mouse) Not determined 3 87208904 125316236 Mouse 12792984 Modn1_m modifier of Dstn neovascularization 1 (mouse) 3 98635284 132635383 Mouse 26884422 Cvht7_m cranial vault height 7, 16 week (mouse) 3 28954149 118893649 Mouse 4142178 Ctrq2_m C. trachomatis resistance QTL 2 (mouse) Not determined 3 89139967 137453008 Mouse 1302093 Orgwq5_m organ weight QTL 5 (mouse) Not determined 3 107376936 147304689 Mouse 1300595 Tmevd2_m Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 2 (mouse) Not determined 3 75463302 109463549 Mouse 1301947 Pcfm3_m periosteal circumference and femur length 3 (mouse) Not determined 3 81084652 115084797 Mouse 10043955 Wt10q4_m body weight, 10 weeks, QTL 4 (mouse) Not determined 3 98624041 132624197 Mouse 8655599 Cia5c_m collagen induced arthritis QTL 5c (mouse) Not determined 3 107376936 125316237 Mouse 4142099 Cq3_m cholesterol QTL 3 (mouse) Not determined 3 84888918 118889067 Mouse 11039512 Ltpr3b_m Leishmania tropica response 3b (mouse) 3 83463991 117464137 Mouse 1302114 Tbs1_m tuberculosis severity 1 (mouse) Not determined 3 98924105 132924250 Mouse 27226733 Tibmd6_m tibia midshaft diameter 6, 16 week (mouse) 3 101307316 149805637 Mouse 27226732 Tibmd3_m tibia midshaft diameter 3, 10 week (mouse) 3 96607316 147805636 Mouse 1301349 Pgia26_m proteoglycan induced arthritis 26 (mouse) Not determined 3 92251533 126251650 Mouse 1302052 Etohcta4_m ethanol conditioned taste aversion 4 (mouse) Not determined 3 91000105 125008748 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 11039507 Ltpr3g_m Leishmania tropica response 3g (mouse) 3 83463991 117464137 Mouse 11039508 Ltpr3f_m Leishmania tropica response 3f (mouse) 3 83463991 117464137 Mouse 11039509 Ltpr3e_m Leishmania tropica response 3e (mouse) 3 83463991 117464137 Mouse 11039510 Ltpr3d_m Leishmania tropica response 3d (mouse) 3 83463991 117464137 Mouse 1301805 Mors2_m modifier of obesity related sterility 2 (mouse) Not determined 3 103482659 137482783 Mouse 13208566 Bmiq5_m body mass index QTL 5 (mouse) 3 40954435 115793649 Mouse 11039511 Ltpr3c_m Leishmania tropica response 3c (mouse) 3 83463991 117464137 Mouse
MDB0358
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 108,426,553 - 108,426,750 UniSTS GRCm38 MGSCv37 3 108,229,471 - 108,229,668 UniSTS GRCm37 Celera 3 110,760,770 - 110,760,967 UniSTS Cytogenetic Map 3 F3 UniSTS cM Map 3 55.7 UniSTS Whitehead_YAC 3 UniSTS
RH126345
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 108,426,622 - 108,426,824 UniSTS GRCm38 MGSCv37 3 108,229,540 - 108,229,742 UniSTS GRCm37 Celera 3 110,760,839 - 110,761,041 UniSTS Cytogenetic Map 3 F3 UniSTS cM Map 3 55.7 UniSTS
Sars1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 108,426,512 - 108,426,663 UniSTS GRCm38 MGSCv37 3 108,229,430 - 108,229,581 UniSTS GRCm37 Celera 3 110,760,729 - 110,760,880 UniSTS Cytogenetic Map 3 F3 UniSTS cM Map 3 55.7 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000090553 ⟹ ENSMUSP00000088041
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 108,332,181 - 108,352,514 (-) Ensembl GRCm38.p6 Ensembl 3 108,424,865 - 108,445,198 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000102625 ⟹ ENSMUSP00000099685
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 108,333,928 - 108,352,485 (-) Ensembl GRCm38.p6 Ensembl 3 108,426,612 - 108,445,169 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000132467 ⟹ ENSMUSP00000120879
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 108,335,547 - 108,352,459 (-) Ensembl GRCm38.p6 Ensembl 3 108,428,231 - 108,445,143 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000153499 ⟹ ENSMUSP00000118676
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 108,336,666 - 108,352,525 (-) Ensembl GRCm38.p6 Ensembl 3 108,429,350 - 108,445,209 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000197647
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 108,341,713 - 108,352,472 (-) Ensembl GRCm38.p6 Ensembl 3 108,434,397 - 108,445,156 (-) Ensembl
RefSeq Acc Id:
NM_001204979 ⟹ NP_001191908
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 108,332,180 - 108,352,575 (-) NCBI GRCm38 3 108,424,864 - 108,445,259 (-) ENTREZGENE Celera 3 110,759,081 - 110,779,474 (-) ENTREZGENE cM Map 3 ENTREZGENE
Sequence:
GCTAGGCGCCGCCCCCTCCCGGGCTGCCGGGTGCCTGCGCAGTGAGACCAGGTCAGCGCGCAGGCGCAGTGCATCGTCCACCCGCCGCTTACAGTCCTCTCTTAGTGTTAACTGGTGAGGTAGAAGGA
hide sequence
RefSeq Acc Id:
NM_011319 ⟹ NP_035449
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 108,332,180 - 108,352,575 (-) NCBI GRCm38 3 108,424,864 - 108,445,259 (-) ENTREZGENE MGSCv37 3 108,229,530 - 108,248,087 (-) RGD Celera 3 110,759,081 - 110,779,474 (-) ENTREZGENE cM Map 3 ENTREZGENE
Sequence:
GCTAGGCGCCGCCCCCTCCCGGGCTGCCGGGTGCCTGCGCAGTGAGACCAGGTCAGCGCGCAGG
hide sequence
RefSeq Acc Id:
NP_035449 ⟸ NM_011319
- Peptide Label:
isoform 1
- UniProtKB:
Q8C483 (UniProtKB/TrEMBL), Q3U6F6 (UniProtKB/TrEMBL)
- Sequence:
MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEAVGDDESVPENVLNFDDLTADALAALKVSQIKKVRLLIDEAIQKCDGERVKLEAER
hide sequence
RefSeq Acc Id:
NP_001191908 ⟸ NM_001204979
- Peptide Label:
isoform 2
- UniProtKB:
A2AFR8 (UniProtKB/Swiss-Prot), P26638 (UniProtKB/Swiss-Prot), Q3U6F6 (UniProtKB/TrEMBL)
- Sequence:
MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTI
hide sequence
Ensembl Acc Id:
ENSMUSP00000088041 ⟸ ENSMUST00000090553
Ensembl Acc Id:
ENSMUSP00000120879 ⟸ ENSMUST00000132467
Ensembl Acc Id:
ENSMUSP00000118676 ⟸ ENSMUST00000153499
Ensembl Acc Id:
ENSMUSP00000099685 ⟸ ENSMUST00000102625
RGD ID: 6834409 Promoter ID: MM_KWN:35785 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000090552, ENSMUST00000102625, ENSMUST00000106632, OTTMUST00000016763, OTTMUST00000016765, OTTMUST00000016766, UC008QZC.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 108,247,716 - 108,248,317 (-) MPROMDB
RGD ID: 6882078 Promoter ID: EPDNEW_M4490 Type: initiation region Name: Sars_1 Description: Mus musculus seryl-aminoacyl-tRNA synthetase , transcript variant2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 108,445,194 - 108,445,254 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-06-05
Sars1
seryl-tRNA synthetase 1
Sars
seryl-aminoacyl-tRNA synthetase
Symbol and/or name updated
27372883 PROVISIONAL
