Symbol:
Prkd1
Name:
protein kinase D1
RGD ID:
1551913
MGI Page
MGI
Description:
Enables protein serine/threonine kinase activity. Involved in several processes, including positive regulation of NLRP3 inflammasome complex assembly; positive regulation of osteoblast differentiation; and positive regulation of protein import into nucleus. Acts upstream of or within regulation of release of sequestered calcium ion into cytosol. Located in several cellular components, including cell cortex; cell-cell junction; and trans-Golgi network. Is expressed in several structures, including alimentary system; brain; early embryo; genitourinary system; and sensory organ. Human ortholog(s) of this gene implicated in congenital heart disease. Orthologous to human PRKD1 (protein kinase D1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
nPKC-D1; nPKC-mu; Pkc; Pkcm; PKD; PKD1; Prk; Prkcm; protein kinase C mu type; protein kinase C, mu; protein kinase D; serine/threonine-protein kinase D1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKD1 (protein kinase D1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Prkd1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkd1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKD1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKD1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prkd1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKD1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkd1 (protein kinase D1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRKD2 (protein kinase D2) HGNC
OrthoMCL
Homo sapiens (human):
PRKD3 (protein kinase D3) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Prkd1 (protein kinase D1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PRKD1 (protein kinase D1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkd1 (protein kinase D1)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
PKD
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
dkf-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prkd1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 50,388,009 - 50,696,075 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 50,388,014 - 50,695,881 (-) Ensembl GRCm39 Ensembl GRCm38 12 50,341,226 - 50,649,271 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 50,341,231 - 50,649,098 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 51,442,218 - 51,750,210 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 51,217,854 - 51,571,105 (-) NCBI MGSCv36 mm8 Celera 12 51,654,217 - 51,955,593 (-) NCBI Celera Cytogenetic Map 12 B3 NCBI cM Map 12 21.78 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkd1 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PRKD1 mRNA CTD PMID:22079256 Prkd1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRKD1 mRNA CTD PMID:36331819 Prkd1 Mouse (R)-noradrenaline multiple interactions ISO Prkd1 (Rattus norvegicus) 6480464 CRT 0066101 inhibits the reaction [Norepinephrine results in increased phosphorylation of PRKD1 protein] CTD PMID:37963515 Prkd1 Mouse (R)-noradrenaline increases phosphorylation ISO Prkd1 (Rattus norvegicus) 6480464 Norepinephrine results in increased phosphorylation of PRKD1 protein CTD PMID:37963515 Prkd1 Mouse (R)-noradrenaline multiple interactions ISO PRKD1 (Homo sapiens) 6480464 PRKD1 protein affects the reaction [Norepinephrine results in increased phosphorylation of MYL1 protein] and PRKD1 protein affects the reaction [Norepinephrine results in increased phosphorylation of PPP1R12A protein] CTD PMID:37963515 Prkd1 Mouse 1,1-dichloroethene decreases expression EXP 6480464 vinylidene chloride results in decreased expression of PRKD1 mRNA CTD PMID:26682919 Prkd1 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of PRKD1 mRNA CTD PMID:22206623 Prkd1 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PRKD1 mRNA CTD PMID:19484750 Prkd1 Mouse 17beta-estradiol decreases expression ISO PRKD1 (Homo sapiens) 6480464 Estradiol results in decreased expression of PRKD1 mRNA CTD PMID:31614463 Prkd1 Mouse 2,3',4,4',5-Pentachlorobiphenyl increases phosphorylation ISO Prkd1 (Rattus norvegicus) 6480464 2 more ... CTD PMID:31020377 Prkd1 Mouse 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Prkd1 (Rattus norvegicus) 6480464 2 more ... CTD PMID:31020377 Prkd1 Mouse 2,3',4,4',5-Pentachlorobiphenyl affects expression ISO Prkd1 (Rattus norvegicus) 6480464 2 more ... CTD PMID:31020377 Prkd1 Mouse 2,3',4,4',5-Pentachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:31388691 Prkd1 Mouse 2,3',4,4',5-Pentachlorobiphenyl multiple interactions ISO Prkd1 (Rattus norvegicus) 6480464 DAPK2 protein affects the reaction [2 more ... CTD PMID:31020377 Prkd1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Prkd1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of PRKD1 mRNA CTD PMID:22298810 Prkd1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Prkd1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKD1 mRNA CTD PMID:32109520 Prkd1 Mouse 2-methoxyethanol increases expression ISO Prkd1 (Rattus norvegicus) 6480464 methyl cellosolve metabolite results in increased expression of PRKD1 protein CTD PMID:11794376 Prkd1 Mouse 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO PRKD1 (Homo sapiens) 6480464 bisindolylmaleimide I affects the reaction [Tetradecanoylphorbol Acetate affects the phosphorylation of PRKD1 protein] CTD PMID:15380616 Prkd1 Mouse 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PRKD1 mRNA CTD PMID:18648102 Prkd1 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of PRKD1 gene CTD PMID:31683443 Prkd1 Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of PRKD1 mRNA CTD PMID:28973697 Prkd1 Mouse aflatoxin B1 affects methylation ISO PRKD1 (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of PRKD1 intron CTD PMID:30157460 Prkd1 Mouse Aflatoxin B2 alpha decreases methylation ISO PRKD1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of PRKD1 intron CTD PMID:30157460 Prkd1 Mouse aldrin increases expression EXP 6480464 Aldrin results in increased expression of PRKD1 mRNA CTD PMID:18579281 Prkd1 Mouse all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of PRKD1 mRNA CTD PMID:16604517 Prkd1 Mouse all-trans-retinoic acid increases expression ISO PRKD1 (Homo sapiens) 6480464 Tretinoin results in increased expression of PRKD1 mRNA CTD PMID:21934132 Prkd1 Mouse ammonium chloride affects expression ISO Prkd1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of PRKD1 mRNA CTD PMID:16483693 Prkd1 Mouse angiotensin II affects localization ISO Prkd1 (Rattus norvegicus) 288084581 Angiotensin II affects localization of Prkd1 protein in cardiomyocytes RGD Prkd1 Mouse antirheumatic drug increases expression ISO PRKD1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PRKD1 mRNA CTD PMID:24449571 Prkd1 Mouse aristolochic acid A decreases expression ISO PRKD1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PRKD1 mRNA CTD PMID:33212167 Prkd1 Mouse arsane affects methylation ISO PRKD1 (Homo sapiens) 6480464 Arsenic affects the methylation of PRKD1 gene CTD PMID:25304211 Prkd1 Mouse arsenic atom affects methylation ISO PRKD1 (Homo sapiens) 6480464 Arsenic affects the methylation of PRKD1 gene CTD PMID:25304211 Prkd1 Mouse arsenite(3-) multiple interactions EXP 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of PRKD1 mRNA CTD PMID:15894712 Prkd1 Mouse arsenite(3-) decreases expression EXP 6480464 arsenite results in decreased expression of PRKD1 mRNA CTD PMID:15894712 Prkd1 Mouse atrazine affects methylation ISO Prkd1 (Rattus norvegicus) 6480464 Atrazine affects the methylation of PRKD1 gene CTD PMID:35440735 Prkd1 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of PRKD1 mRNA CTD PMID:15894712 Prkd1 Mouse benzo[a]pyrene increases methylation ISO PRKD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PRKD1 exon and Benzo(a)pyrene results in increased methylation of PRKD1 promoter CTD PMID:27901495 Prkd1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of PRKD1 mRNA CTD PMID:22228805 Prkd1 Mouse benzo[a]pyrene decreases expression ISO PRKD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PRKD1 mRNA CTD PMID:20106945 and PMID:21632981 Prkd1 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of PRKD1 mRNA CTD PMID:15894712 Prkd1 Mouse benzo[e]pyrene increases methylation ISO PRKD1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of PRKD1 intron CTD PMID:30157460 Prkd1 Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate] affects the expression of PRKD1 protein CTD PMID:38995844 Prkd1 Mouse bisphenol A increases expression ISO PRKD1 (Homo sapiens) 6480464 bisphenol A results in increased expression of PRKD1 mRNA CTD PMID:36232920 Prkd1 Mouse bisphenol A decreases methylation ISO PRKD1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PRKD1 gene CTD PMID:31601247 Prkd1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of PRKD1 mRNA CTD PMID:30951980 Prkd1 Mouse butanal decreases expression ISO PRKD1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PRKD1 mRNA CTD PMID:26079696 Prkd1 Mouse Butylbenzyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate] affects the expression of PRKD1 protein CTD PMID:38995844 Prkd1 Mouse cadmium dichloride decreases expression ISO PRKD1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PRKD1 mRNA CTD PMID:38568856 Prkd1 Mouse calcitriol multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PRKD1 mRNA CTD PMID:21592394 Prkd1 Mouse calcitriol decreases expression ISO PRKD1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of PRKD1 mRNA CTD PMID:21592394 Prkd1 Mouse calcium atom multiple interactions ISO PRKD1 (Homo sapiens) 6480464 PRKD1 promotes the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Mouse calcium atom multiple interactions ISO Prkd1 (Rattus norvegicus) 6480464 PRKD1 mutant form inhibits the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Mouse calcium(0) multiple interactions ISO PRKD1 (Homo sapiens) 6480464 PRKD1 promotes the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Mouse calcium(0) multiple interactions ISO Prkd1 (Rattus norvegicus) 6480464 PRKD1 mutant form inhibits the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Mouse capsaicin multiple interactions ISO Prkd1 (Rattus norvegicus) 6480464 PRKD1 mutant form inhibits the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Mouse capsaicin multiple interactions ISO PRKD1 (Homo sapiens) 6480464 PRKD1 promotes the reaction [Capsaicin results in increased uptake of Calcium] CTD PMID:15471852 Prkd1 Mouse chlorpyrifos decreases expression ISO Prkd1 (Rattus norvegicus) 6480464 Chlorpyrifos results in decreased expression of PRKD1 mRNA CTD PMID:19368821 Prkd1 Mouse cisplatin decreases expression ISO PRKD1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of PRKD1 mRNA CTD PMID:27392435 Prkd1 Mouse cisplatin multiple interactions ISO PRKD1 (Homo sapiens) 6480464 Cisplatin promotes the reaction [jinfukang results in decreased expression of PRKD1 mRNA] and jinfukang promotes the reaction [Cisplatin results in decreased expression of PRKD1 mRNA] CTD PMID:27392435 Prkd1 Mouse dapsone multiple interactions EXP 6480464 Dapsone inhibits the reaction [Paraquat results in increased phosphorylation of PRKD1 protein] CTD PMID:21765237 Prkd1 Mouse DDT decreases methylation ISO Prkd1 (Rattus norvegicus) 6480464 DDT results in decreased methylation of PRKD1 gene CTD PMID:31682807 Prkd1 Mouse dibutyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate] affects the expression of PRKD1 protein CTD PMID:38995844 Prkd1 Mouse dibutylstannane increases phosphorylation ISO PRKD1 (Homo sapiens) 6480464 di-n-butyltin results in increased phosphorylation of PRKD1 protein CTD PMID:26228090 Prkd1 Mouse dioxygen increases expression ISO PRKD1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PRKD1 mRNA CTD PMID:17175027 Prkd1 Mouse dorsomorphin multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRKD1 mRNA CTD PMID:27188386 Prkd1 Mouse doxorubicin decreases expression ISO PRKD1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PRKD1 mRNA CTD PMID:29803840 Prkd1 Mouse Endothelin-1 affects localization ISO Prkd1 (Rattus norvegicus) 288084581 Endothelin-1 affects localization of Prkd1 protein in cardiomyocytes RGD Prkd1 Mouse entinostat decreases expression ISO PRKD1 (Homo sapiens) 6480464 entinostat results in decreased expression of PRKD1 mRNA CTD PMID:26272509 Prkd1 Mouse entinostat multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRKD1 mRNA CTD PMID:27188386 Prkd1 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of PRKD1 mRNA CTD PMID:30319688 Prkd1 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of PRKD1 mRNA CTD PMID:30319688 Prkd1 Mouse fenamidone increases expression EXP 6480464 fenamidone results in increased expression of PRKD1 mRNA CTD PMID:27029645 Prkd1 Mouse fenvalerate increases expression ISO Prkd1 (Rattus norvegicus) 6480464 fenvalerate results in increased expression of PRKD1 mRNA CTD PMID:30307764 Prkd1 Mouse FR900359 affects phosphorylation ISO PRKD1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PRKD1 protein CTD PMID:37730182 Prkd1 Mouse gentamycin increases expression ISO Prkd1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of PRKD1 mRNA CTD PMID:33387578 Prkd1 Mouse Goe 6976 multiple interactions EXP 6480464 Go 6976 inhibits the reaction [[Tetradecanoylphorbol Acetate results in increased activity of PRKD1 protein] which affects the localization of HDAC5 protein] CTD PMID:19124542 Prkd1 Mouse Ingenol 3,20-dibenzoate increases activity ISO PRKD1 (Homo sapiens) 6480464 ingenol dibenzoate results in increased activity of PRKD1 protein CTD PMID:15707588 Prkd1 Mouse lipopolysaccharide multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [IL4 protein co-treated with IL13 protein] inhibits the reaction [Lipopolysaccharides results in decreased expression of PRKD1 protein] CTD PMID:37182445 Prkd1 Mouse lipopolysaccharide decreases expression ISO PRKD1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of PRKD1 protein CTD PMID:37182445 Prkd1 Mouse lysophosphatidic acid increases phosphorylation ISO Prkd1 (Rattus norvegicus) 243065275 LPA increases phosphorylation of Prkd1 protein in neonatal ventricular myocytes RGD Prkd1 Mouse malathion increases expression ISO PRKD1 (Homo sapiens) 6480464 Malathion results in increased expression of PRKD1 mRNA CTD PMID:32069766 Prkd1 Mouse manganese atom increases expression ISO PRKD1 (Homo sapiens) 6480464 Manganese results in increased expression of PRKD1 mRNA CTD PMID:17175027 Prkd1 Mouse manganese(0) increases expression ISO PRKD1 (Homo sapiens) 6480464 Manganese results in increased expression of PRKD1 mRNA CTD PMID:17175027 Prkd1 Mouse manganese(II) chloride increases expression ISO PRKD1 (Homo sapiens) 6480464 manganese chloride results in increased expression of PRKD1 mRNA CTD PMID:17175027 Prkd1 Mouse methapyrilene increases methylation ISO PRKD1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of PRKD1 intron CTD PMID:30157460 Prkd1 Mouse methoxyacetic acid increases expression ISO Prkd1 (Rattus norvegicus) 6480464 methoxyacetic acid results in increased expression of PRKD1 protein CTD PMID:11794376 Prkd1 Mouse methoxychlor affects methylation ISO Prkd1 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of PRKD1 gene CTD PMID:35440735 Prkd1 Mouse methylmercury chloride decreases expression ISO PRKD1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PRKD1 mRNA CTD PMID:28001369 Prkd1 Mouse N-methyl-N'-nitro-N-nitrosoguanidine increases expression ISO PRKD1 (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in increased expression of PRKD1 mRNA CTD PMID:12634122 Prkd1 Mouse noradrenaline affects localization ISO Prkd1 (Rattus norvegicus) 288084581 [Norepinephrine cotreated with propranolol] affects localization of Prkd1 protein in cardiomyocytes RGD Prkd1 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PRKD1 mRNA CTD PMID:34911549 Prkd1 Mouse paracetamol increases expression ISO Prkd1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of PRKD1 mRNA CTD PMID:33387578 Prkd1 Mouse paraquat multiple interactions EXP 6480464 2-(1-(3-dimethylaminopropyl)-5-methoxyindol-3-yl)-3-(1H-indol-3-yl)maleimide inhibits the reaction [Paraquat results in increased phosphorylation of PRKD1 protein] and Dapsone inhibits the reaction [Paraquat results in increased phosphorylation of PRKD1 protein] CTD PMID:21765237 Prkd1 Mouse paraquat increases phosphorylation EXP 6480464 Paraquat results in increased phosphorylation of PRKD1 protein CTD PMID:21765237 Prkd1 Mouse perfluorooctane-1-sulfonic acid affects expression EXP 6480464 perfluorooctane sulfonic acid affects the expression of PRKD1 mRNA CTD PMID:19429403 Prkd1 Mouse perfluorooctane-1-sulfonic acid increases phosphorylation ISO PRKD1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased phosphorylation of PRKD1 protein CTD PMID:36106993 Prkd1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRKD1 mRNA CTD PMID:36331819 Prkd1 Mouse perfluorooctanoic acid affects expression EXP 6480464 perfluorooctanoic acid affects the expression of PRKD1 mRNA CTD PMID:19429403 Prkd1 Mouse phenylephrine affects localization EXP 6480464 Phenylephrine affects the localization of PRKD1 protein CTD PMID:19124542 Prkd1 Mouse phenylephrine increases phosphorylation ISO Prkd1 (Rattus norvegicus) 243065275 Phenylephrine increases phosphorylation of Prkd1 protein in neonatal ventricular myocytes RGD Prkd1 Mouse phenylephrine multiple interactions EXP 6480464 [Phenylephrine results in increased activity of PRKD1 protein] which affects the localization of HDAC5 protein CTD PMID:19124542 Prkd1 Mouse phenylephrine increases activity EXP 6480464 Phenylephrine results in increased activity of PRKD1 protein CTD PMID:19124542 Prkd1 Mouse phorbol 13-acetate 12-myristate increases expression ISO PRKD1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of PRKD1 protein modified form CTD PMID:16532021 Prkd1 Mouse phorbol 13-acetate 12-myristate increases phosphorylation ISO PRKD1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased phosphorylation of PRKD1 protein CTD PMID:37562720 Prkd1 Mouse phorbol 13-acetate 12-myristate increases phosphorylation ISO Prkd1 (Rattus norvegicus) 243065275 PMA increases phosphorylation of Prkd1 protein in neonatal ventricular myocytes RGD Prkd1 Mouse phorbol 13-acetate 12-myristate affects localization ISO Prkd1 (Rattus norvegicus) 288084581 TPA affects localization of Prkd1 protein in cardiomyocytes RGD Prkd1 Mouse phorbol 13-acetate 12-myristate affects localization ISO PRKD1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKD1 protein CTD PMID:21705328 and PMID:9852137 Prkd1 Mouse phorbol 13-acetate 12-myristate increases phosphorylation EXP 6480464 Tetradecanoylphorbol Acetate results in increased phosphorylation of PRKD1 protein CTD PMID:21047949 Prkd1 Mouse phorbol 13-acetate 12-myristate affects localization EXP 6480464 Tetradecanoylphorbol Acetate affects the localization of PRKD1 protein CTD PMID:19124542 Prkd1 Mouse phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 [Tetradecanoylphorbol Acetate results in increased activity of PRKD1 protein] which affects the localization of HDAC5 protein more ... CTD PMID:19124542 and PMID:21047949 Prkd1 Mouse phorbol 13-acetate 12-myristate affects phosphorylation ISO PRKD1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate affects the phosphorylation of PRKD1 protein CTD PMID:15380616 Prkd1 Mouse phorbol 13-acetate 12-myristate multiple interactions ISO PRKD1 (Homo sapiens) 6480464 2-(1-(3-dimethylaminopropyl)-5-methoxyindol-3-yl)-3-(1H-indol-3-yl)maleimide affects the reaction [Tetradecanoylphorbol Acetate affects the phosphorylation of PRKD1 protein] more ... CTD PMID:15380616 more ... Prkd1 Mouse potassium chromate decreases expression ISO PRKD1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PRKD1 mRNA CTD PMID:22079256 Prkd1 Mouse potassium chromate multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PRKD1 mRNA CTD PMID:22079256 Prkd1 Mouse progesterone multiple interactions EXP 6480464 PRKD1 protein promotes the reaction [[Tetradecanoylphorbol Acetate results in increased expression of and results in increased phosphorylation of STAR protein] which results in increased abundance of Progesterone] CTD PMID:21047949 Prkd1 Mouse quercetin increases expression ISO PRKD1 (Homo sapiens) 6480464 Quercetin results in increased expression of PRKD1 mRNA CTD PMID:21632981 Prkd1 Mouse resveratrol multiple interactions ISO PRKD1 (Homo sapiens) 6480464 resveratrol results in decreased phosphorylation of and results in decreased activity of PRKD1 protein CTD PMID:11008129 Prkd1 Mouse resveratrol multiple interactions EXP 6480464 resveratrol results in decreased phosphorylation of and results in decreased activity of PRKD1 protein CTD PMID:23514766 Prkd1 Mouse resveratrol multiple interactions ISO Prkd1 (Rattus norvegicus) 6480464 resveratrol results in decreased phosphorylation of and results in decreased activity of PRKD1 protein CTD PMID:23514766 Prkd1 Mouse resveratrol decreases phosphorylation ISO PRKD1 (Homo sapiens) 6480464 resveratrol analog results in decreased phosphorylation of PRKD1 protein CTD PMID:24832111 Prkd1 Mouse SB 431542 multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PRKD1 mRNA CTD PMID:27188386 Prkd1 Mouse serpentine asbestos increases phosphorylation EXP 6480464 Asbestos and Serpentine results in increased phosphorylation of PRKD1 protein CTD PMID:19116364 Prkd1 Mouse serpentine asbestos multiple interactions EXP 6480464 Asbestos more ... CTD PMID:19116364 Prkd1 Mouse silicon dioxide decreases expression ISO PRKD1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PRKD1 mRNA CTD PMID:25895662 Prkd1 Mouse sodium arsenate decreases expression EXP 6480464 sodium arsenate results in decreased expression of PRKD1 mRNA CTD PMID:30953684 Prkd1 Mouse sunitinib decreases expression ISO PRKD1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PRKD1 mRNA CTD PMID:31533062 Prkd1 Mouse testosterone multiple interactions ISO PRKD1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PRKD1 mRNA CTD PMID:21592394 Prkd1 Mouse testosterone decreases expression ISO PRKD1 (Homo sapiens) 6480464 Testosterone results in decreased expression of PRKD1 mRNA CTD PMID:21592394 Prkd1 Mouse tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of PRKD1 mRNA CTD PMID:17484886 Prkd1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of PRKD1 promoter CTD PMID:35295148 Prkd1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of PRKD1 promoter CTD PMID:35295148 Prkd1 Mouse tributylstannane increases phosphorylation ISO PRKD1 (Homo sapiens) 6480464 tributyltin results in increased phosphorylation of PRKD1 protein CTD PMID:26228090 Prkd1 Mouse urethane increases expression ISO PRKD1 (Homo sapiens) 6480464 Urethane results in increased expression of PRKD1 mRNA CTD PMID:28818685 Prkd1 Mouse valproic acid increases expression ISO PRKD1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRKD1 mRNA CTD PMID:29154799 Prkd1 Mouse valproic acid affects expression ISO PRKD1 (Homo sapiens) 6480464 Valproic Acid affects the expression of PRKD1 mRNA CTD PMID:25979313 Prkd1 Mouse vanadium atom decreases expression ISO PRKD1 (Homo sapiens) 6480464 Vanadium results in decreased expression of PRKD1 mRNA CTD PMID:19000753 Prkd1 Mouse vanadium(0) decreases expression ISO PRKD1 (Homo sapiens) 6480464 Vanadium results in decreased expression of PRKD1 mRNA CTD PMID:19000753
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (EXP) (R)-noradrenaline (ISO) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-methoxyethanol (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldrin (EXP) all-trans-retinoic acid (EXP,ISO) ammonium chloride (ISO) angiotensin II (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (EXP) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) bisphenol F (EXP) butanal (ISO) Butylbenzyl phthalate (EXP) cadmium dichloride (ISO) calcitriol (ISO) calcium atom (ISO) calcium(0) (ISO) capsaicin (ISO) chlorpyrifos (ISO) cisplatin (ISO) dapsone (EXP) DDT (ISO) dibutyl phthalate (EXP) dibutylstannane (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) Endothelin-1 (ISO) entinostat (ISO) ethanol (EXP) fenamidone (EXP) fenvalerate (ISO) FR900359 (ISO) gentamycin (ISO) Goe 6976 (EXP) Ingenol 3,20-dibenzoate (ISO) lipopolysaccharide (ISO) lysophosphatidic acid (ISO) malathion (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methoxyacetic acid (ISO) methoxychlor (ISO) methylmercury chloride (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) noradrenaline (ISO) ozone (EXP) paracetamol (ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP) phenylephrine (EXP,ISO) phorbol 13-acetate 12-myristate (EXP,ISO) potassium chromate (ISO) progesterone (EXP) quercetin (ISO) resveratrol (EXP,ISO) SB 431542 (ISO) serpentine asbestos (EXP) silicon dioxide (ISO) sodium arsenate (EXP) sunitinib (ISO) testosterone (ISO) tetrachloromethane (EXP) titanium dioxide (EXP) tributylstannane (ISO) urethane (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO)
Biological Process
angiogenesis (IEA) apoptotic process (IEA) cell differentiation (IEA) cellular response to amino acid starvation (IEA,ISO) cellular response to angiotensin (IEA,ISO) cellular response to endothelin (IEA,ISO) cellular response to hydroperoxide (IEA,ISO) cellular response to norepinephrine stimulus (IEA,ISO) cellular response to oxidative stress (ISO,ISS) cellular response to phorbol 13-acetate 12-myristate (IEA,ISO) cellular response to vascular endothelial growth factor stimulus (ISO,ISS) defense response to Gram-negative bacterium (IMP) Golgi organization (ISO,ISS) Golgi vesicle transport (IMP) inflammatory response (IEA) innate immune response (IEA) intracellular signal transduction (IBA,ISO) nervous system development (IEA) peptidyl-serine phosphorylation (ISO) peptidyl-threonine phosphorylation (IMP,ISO) phospholipase C-activating G protein-coupled receptor signaling pathway (IBA) positive regulation of angiogenesis (ISO,ISS) positive regulation of autophagy (IEA,ISO) positive regulation of blood vessel endothelial cell migration (IEA,ISO) positive regulation of canonical NF-kappaB signal transduction (ISO,ISS) positive regulation of cell size (IEA,ISO) positive regulation of endothelial cell chemotaxis (IEA,ISO) positive regulation of endothelial cell migration (ISO,ISS) positive regulation of endothelial cell proliferation (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of neuron projection development (ISO,ISS) positive regulation of NF-kappaB transcription factor activity (ISO,ISS) positive regulation of NLRP3 inflammasome complex assembly (IDA) positive regulation of osteoblast differentiation (IMP) positive regulation of peptide hormone secretion (IEA,ISO) positive regulation of peptidyl-serine phosphorylation (ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO) positive regulation of protein export from nucleus (IEA,ISO) positive regulation of protein import into nucleus (IMP) positive regulation of sarcomere organization (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) protein autophosphorylation (ISO,ISS) regulation of keratinocyte proliferation (IMP) regulation of release of sequestered calcium ion into cytosol (IDA) regulation of skeletal muscle contraction by modulation of calcium ion sensitivity of myofibril (IEA,ISO) response to norepinephrine (ISO) vascular endothelial growth factor receptor signaling pathway (IEA,ISO)
1.
Protein Kinase D1 Regulates Cardiac Hypertrophy, Potassium Channel Remodeling, and Arrhythmias in Heart Failure.
Bossuyt J, etal., J Am Heart Assoc. 2022 Oct 4;11(19):e027573. doi: 10.1161/JAHA.122.027573. Epub 2022 Sep 29.
2.
Protein kinase-D1 overexpression prevents lipid-induced cardiac insulin resistance.
Dirkx E, etal., J Mol Cell Cardiol. 2014 Nov;76:208-17. doi: 10.1016/j.yjmcc.2014.08.017. Epub 2014 Aug 28.
3.
Requirement of protein kinase D1 for pathological cardiac remodeling.
Fielitz J, etal., Proc Natl Acad Sci U S A. 2008 Feb 26;105(8):3059-63. doi: 10.1073/pnas.0712265105. Epub 2008 Feb 14.
4.
Regulation of cardiac stress signaling by protein kinase d1.
Harrison BC, etal., Mol Cell Biol. 2006 May;26(10):3875-88. doi: 10.1128/MCB.26.10.3875-3888.2006.
5.
PKCepsilon-PKD1 signaling complex at Z-discs plays a pivotal role in the cardiac hypertrophy induced by G-protein coupling receptor agonists.
Iwata M, etal., Biochem Biophys Res Commun. 2005 Feb 25;327(4):1105-13. doi: 10.1016/j.bbrc.2004.12.128.
6.
Compatibility of Astragalus and Salvia extract inhibits myocardial fibrosis and ventricular remodeling by regulation of protein kinase D1 protein.
Mao B, etal., Int J Clin Exp Med. 2015 Mar 15;8(3):3716-24. eCollection 2015.
7.
Novel Autosomal Recessive Splice-Altering Variant in PRKD1 Is Associated with Congenital Heart Disease.
Massadeh S, etal., Genes (Basel). 2021 Apr 21;12(5):612. doi: 10.3390/genes12050612.
8.
MGDs mouse GO annotations
MGD data from the GO Consortium
9.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
10.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Distinct genetic architectures for syndromic and nonsyndromic congenital heart defects identified by exome sequencing.
Sifrim A, etal., Nat Genet. 2016 Sep;48(9):1060-5. doi: 10.1038/ng.3627. Epub 2016 Aug 1.
15.
Small heat shock protein 20 (Hsp20) facilitates nuclear import of protein kinase D 1 (PKD1) during cardiac hypertrophy.
Sin YY, etal., Cell Commun Signal. 2015 Mar 7;13:16. doi: 10.1186/s12964-015-0094-x.
16.
The C-terminus of the long AKAP13 isoform (AKAP-Lbc) is critical for development of compensatory cardiac hypertrophy.
Taglieri DM, etal., J Mol Cell Cardiol. 2014 Jan;66:27-40. doi: 10.1016/j.yjmcc.2013.10.010. Epub 2013 Oct 23.
17.
PLCε, PKD1, and SSH1L transduce RhoA signaling to protect mitochondria from oxidative stress in the heart.
Xiang SY, etal., Sci Signal. 2013 Dec 17;6(306):ra108. doi: 10.1126/scisignal.2004405.
Prkd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 50,388,009 - 50,696,075 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 50,388,014 - 50,695,881 (-) Ensembl GRCm39 Ensembl GRCm38 12 50,341,226 - 50,649,271 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 50,341,231 - 50,649,098 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 51,442,218 - 51,750,210 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 51,217,854 - 51,571,105 (-) NCBI MGSCv36 mm8 Celera 12 51,654,217 - 51,955,593 (-) NCBI Celera Cytogenetic Map 12 B3 NCBI cM Map 12 21.78 NCBI
PRKD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 29,576,479 - 29,927,847 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 29,576,479 - 30,191,898 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 30,045,685 - 30,397,053 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 29,115,436 - 29,466,650 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 29,115,439 - 29,466,652 NCBI Celera 14 9,911,927 - 10,263,081 (-) NCBI Celera Cytogenetic Map 14 q12 NCBI HuRef 14 10,161,470 - 10,512,671 (-) NCBI HuRef CHM1_1 14 30,044,967 - 30,396,713 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 23,774,515 - 24,125,722 (-) NCBI T2T-CHM13v2.0
Prkd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 73,460,640 - 73,774,433 (-) NCBI GRCr8 mRatBN7.2 6 67,725,193 - 68,039,002 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 67,725,905 - 68,039,042 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 68,177,553 - 68,489,871 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 68,484,172 - 68,796,501 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 67,919,348 - 68,237,248 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 71,035,017 - 71,349,531 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 71,035,332 - 71,349,249 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 80,600,725 - 80,914,319 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 70,364,135 - 70,682,006 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 70,393,721 - 70,394,895 (-) NCBI Celera 6 66,643,414 - 66,954,727 (-) NCBI Celera Cytogenetic Map 6 q22 NCBI
Prkd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 30,554,013 - 30,860,649 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 30,554,095 - 30,860,588 (+) NCBI ChiLan1.0 ChiLan1.0
PRKD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 30,905,194 - 31,258,408 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 30,122,170 - 30,474,871 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 10,353,284 - 10,707,841 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 28,499,753 - 28,650,036 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 28,496,282 - 28,650,030 (-) Ensembl panpan1.1 panPan2
PRKD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 9,004,641 - 9,327,054 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 9,005,115 - 9,328,358 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 8,933,899 - 9,256,073 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 9,106,948 - 9,429,506 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 9,107,422 - 9,430,511 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 8,787,713 - 9,109,715 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 8,868,816 - 9,191,637 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 9,140,306 - 9,462,703 (-) NCBI UU_Cfam_GSD_1.0
Prkd1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 40,963,196 - 41,207,484 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936494 4,469,089 - 4,601,214 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936494 4,469,092 - 4,601,183 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 69,527,811 - 69,872,863 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 69,527,743 - 69,872,374 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 74,585,433 - 74,730,165 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
Prkd1
.
Predicted Target Of
Count of predictions: 203 Count of miRNA genes: 173 Interacting mature miRNAs: 182 Transcripts: ENSMUST00000002765 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
14747008 Mancz10_m mandible centroid size 10 (mouse) 12 29863522 63863522 Mouse 1300818 Bbaa10_m B.burgdorferi-associated arthritis 10 (mouse) Not determined 12 35091004 65511019 Mouse 10402492 Dipa8_m drug induced psychomotor activation 8 (mouse) Not determined 12 34933872 68934019 Mouse 4142234 Tmc1m3_m Tmc1 modifier 3 (mouse) Not determined 12 5418440 77031203 Mouse 13524843 Ppiq8_m prepulse inhibition QTL 8 (mouse) 12 11043194 50945796 Mouse 13524839 Ppiq10_m prepulse inhibition QTL 10 (mouse) 12 13043195 54945798 Mouse 4141843 Moen3_m modifier of engrailed QTL 3 (mouse) Not determined 12 29801584 63801733 Mouse 4142002 Tbqt3_m tibia bone quality traits 3 (mouse) Not determined 12 35285496 109936243 Mouse 15039339 Nmrs29_m NAFLD-associated magnetic resonance shift 29 (mouse) 12 17825852 51825852 Mouse 1302172 Skts5_m skin tumor susceptibility 5 (mouse) Not determined 12 22148866 56149016 Mouse 1300636 Gct2_m granulosa cell tumorigenesis 2 (mouse) Not determined 12 29160685 63160884 Mouse 10043848 Hdlq90_m HDL QTL 90 (mouse) Not determined 12 17839939 51840081 Mouse 1357479 Splwt1_m spleen weight 1 (mouse) Not determined 12 41693175 90887526 Mouse 1558978 Cplaq10_m circadian period of locomotor activity 10 (mouse) Not determined 12 15341026 79040364 Mouse 1301574 Lmblgq5_m limb length QTL 5 (mouse) Not determined 12 17596447 80956883 Mouse 1300870 Ath18_m atherosclerosis 18 (mouse) Not determined 12 18259966 52260067 Mouse 1301989 Hdlq18_m HDL QTL 18 (mouse) Not determined 12 29160685 63160884 Mouse 12904956 Edlmmq10_m extensor digitorum longus muscle mass QTL 10 (mouse) 12 19739833 53739833 Mouse 13207568 Tcq14_m total cholesterol QTL 14 (mouse) 12 11660001 97176774 Mouse 27226753 Femd7_m femur midshaft diameter 7, 10 week (mouse) 12 9550000 84146774 Mouse
BB362079
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 50,622,628 - 50,622,756 UniSTS GRCm38 MGSCv37 12 51,723,615 - 51,723,743 UniSTS GRCm37 Celera 12 51,929,330 - 51,929,458 UniSTS Cytogenetic Map 12 C1 UniSTS Whitehead/MRC_RH 12 446.42 UniSTS
Prkcm
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 50,341,833 - 50,342,038 UniSTS GRCm38 MGSCv37 12 51,442,820 - 51,443,025 UniSTS GRCm37 Celera 12 51,654,819 - 51,655,024 UniSTS Cytogenetic Map 12 C1 UniSTS cM Map 12 UniSTS cM Map UN UniSTS
D12Mit64
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 50,458,226 - 50,458,363 UniSTS GRCm38 MGSCv37 12 51,559,213 - 51,559,350 UniSTS GRCm37 Celera 12 51,772,242 - 51,772,375 UniSTS Cytogenetic Map 12 C1 UniSTS cM Map 12 22.0 UniSTS Whitehead Genetic 12 17.5 UniSTS Whitehead/MRC_RH 12 441.2 UniSTS Whitehead_YAC 12 UniSTS
UniSTS:236839
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 50,626,348 - 50,626,551 UniSTS GRCm38 MGSCv37 12 51,727,335 - 51,727,538 UniSTS GRCm37 Cytogenetic Map 12 C1 UniSTS
UniSTS:224841
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 50,341,781 - 50,341,934 UniSTS GRCm38 MGSCv37 12 51,442,768 - 51,442,921 UniSTS GRCm37 Celera 12 51,654,767 - 51,654,920 UniSTS Cytogenetic Map 12 C1 UniSTS
Prkcm
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 C1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000002765 ⟹ ENSMUSP00000002765
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 50,388,014 - 50,695,881 (-) Ensembl GRCm38.p6 Ensembl 12 50,341,231 - 50,649,098 (-) Ensembl
RefSeq Acc Id:
NM_001382814 ⟹ NP_001369743
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,696,032 (-) NCBI GRCm38 12 50,341,231 - 50,649,249 (-) NCBI
Sequence:
GGTCGCGCGGACCCGCCGTGGTCCCCGGAGCGGAGCGCGCCGCGGCCGCAGTAGCTGGGCGCCTCCCCCGCGCTGCCGCGCGCCCGCCTGCTCGCCTGCCCGCCCGCCGGCCCCGGCTCCGCTCGGCC
hide sequence
RefSeq Acc Id:
NM_001382815 ⟹ NP_001369744
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,494,841 - 50,696,032 (-) NCBI GRCm38 12 50,448,058 - 50,649,249 (-) NCBI
Sequence:
GGTCGCGCGGACCCGCCGTGGTCCCCGGAGCGGAGCGCGCCGCGGCCGCAGTAGCTGGGCGCCTCCCCCGCGCTGCCGCGCGCCCGCCTGCTCGCCTGCCCGCCCGCCGGCCCCGGCTCCGCTCGGCC
hide sequence
RefSeq Acc Id:
NM_001382816 ⟹ NP_001369745
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,402,815 (-) NCBI GRCm38 12 50,341,231 - 50,356,032 (-) NCBI
Sequence:
CAGGCGTGGGTAACATTTTAAATGACCTCAATTTAAAATTCTGGAACCATGTTTAAATTTTAGA
hide sequence
RefSeq Acc Id:
NM_008858 ⟹ NP_032884
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,696,032 (-) NCBI GRCm38 12 50,341,231 - 50,649,249 (-) NCBI MGSCv37 12 51,442,218 - 51,750,210 (-) RGD Celera 12 51,654,217 - 51,955,593 (-) RGD cM Map 12 ENTREZGENE
Sequence:
GGTCGCGCGGACCCGCCGTGGTCCCCGGAGCGGAGCGCGCCGCGGCCGCAGTAGCTGGGCGCCT
hide sequence
RefSeq Acc Id:
NR_168537
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,696,032 (-) NCBI GRCm38 12 50,341,231 - 50,649,249 (-) NCBI
Sequence:
GGTCGCGCGGACCCGCCGTGGTCCCCGGAGCGGAGCGCGCCGCGGCCGCAGTAGCTGGGCGCCT
hide sequence
RefSeq Acc Id:
NR_168538
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,402,815 (-) NCBI GRCm38 12 50,341,231 - 50,356,032 (-) NCBI
Sequence:
CAGGCGTGGGTAACATTTTAAATGACCTCAATTTAAAATTCTGGAACCATGTTTAAATTTTAGAAGACCCTTTCATTGTATTCGTTAAAAGGAAAGTTAACAATTGTGAGCCTGTGGTATGTGATAAT
hide sequence
RefSeq Acc Id:
NR_168539
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,402,815 (-) NCBI GRCm38 12 50,341,231 - 50,356,032 (-) NCBI
Sequence:
CAGGCGTGGGTAACATTTTAAATGACCTCAATTTAAAATTCTGGAACCATGTTTAAATTTTAGAAGACCCTTTCATTGTATTCGTTAAAAGGAAAGTTAACAATTGTGAGCCTGTGGTATGTGATAAT
hide sequence
RefSeq Acc Id:
NR_168540
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,402,815 (-) NCBI GRCm38 12 50,341,231 - 50,356,032 (-) NCBI
Sequence:
CAGGCGTGGGTAACATTTTAAATGACCTCAATTTAAAATTCTGGAACCATGTTTAAATTTTAGA
hide sequence
RefSeq Acc Id:
NR_168541
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,402,815 (-) NCBI GRCm38 12 50,341,231 - 50,356,032 (-) NCBI
Sequence:
CAGGCGTGGGTAACATTTTAAATGACCTCAATTTAAAATTCTGGAACCATGTTTAAATTTTAGA
hide sequence
RefSeq Acc Id:
NR_168542
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,402,815 (-) NCBI GRCm38 12 50,341,231 - 50,356,032 (-) NCBI
Sequence:
CAGGCGTGGGTAACATTTTAAATGACCTCAATTTAAAATTCTGGAACCATGTTTAAATTTTAGA
hide sequence
RefSeq Acc Id:
NR_168543
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,402,815 (-) NCBI GRCm38 12 50,341,231 - 50,356,032 (-) NCBI
Sequence:
CAGGCGTGGGTAACATTTTAAATGACCTCAATTTAAAATTCTGGAACCATGTTTAAATTTTAGA
hide sequence
RefSeq Acc Id:
NR_168544
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,402,815 (-) NCBI GRCm38 12 50,341,231 - 50,356,032 (-) NCBI
Sequence:
CAGGCGTGGGTAACATTTTAAATGACCTCAATTTAAAATTCTGGAACCATGTTTAAATTTTAGAAGACCCTTTCATTGTATTCGTTAAAAGGAAAGTTAACAATTGTGAGCCTGTGGTATGTGATAAT
hide sequence
RefSeq Acc Id:
NR_168545
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,014 - 50,402,815 (-) NCBI GRCm38 12 50,341,231 - 50,356,032 (-) NCBI
Sequence:
CAGGCGTGGGTAACATTTTAAATGACCTCAATTTAAAATTCTGGAACCATGTTTAAATTTTAGA
hide sequence
RefSeq Acc Id:
XM_006515586 ⟹ XP_006515649
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,502 - 50,696,075 (-) NCBI GRCm38 12 50,341,226 - 50,649,271 (-) NCBI
Sequence:
GCTCCGCGGCGCCGCCCTCGCCCCGCCCCGCCCCGCCGGCGCCGGTCGCGCGGACCCGCCGTGGTCCCCGGAGCGGAGCGCGCCGCGGCCGCAGTAGCTGGGCGCCTCCCCCGCGCTGCCGCGCGCCC
hide sequence
RefSeq Acc Id:
XM_006515590 ⟹ XP_006515653
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,502 - 50,482,195 (-) NCBI GRCm38 12 50,341,226 - 50,435,430 (-) NCBI
Sequence:
CAATTCACATTACAGTTAACAATACTTCTTATATCTGTTCTGTTGCTATTTATGCCTTAGTGCC
hide sequence
RefSeq Acc Id:
XM_006515591 ⟹ XP_006515654
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,411,295 - 50,696,075 (-) NCBI GRCm38 12 50,364,512 - 50,649,271 (-) NCBI
Sequence:
GCTCCGCGGCGCCGCCCTCGCCCCGCCCCGCCCCGCCGGCGCCGGTCGCGCGGACCCGCCGTGG
hide sequence
RefSeq Acc Id:
XM_036157250 ⟹ XP_036013143
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,502 - 50,696,031 (-) NCBI
Sequence:
GTCGCGCGGACCCGCCGTGGTCCCCGGAGCGGAGCGCGCCGCGGCCGCAGTAGCTGGGCGCCTC
hide sequence
RefSeq Acc Id:
XR_001780428
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,009 - 50,696,075 (-) NCBI GRCm38 12 50,341,226 - 50,649,271 (-) NCBI
Sequence:
GCTCCGCGGCGCCGCCCTCGCCCCGCCCCGCCCCGCCGGCGCCGGTCGCGCGGACCCGCCGTGGTCCCCGGAGCGGAGCGCGCCGCGGCCGCAGTAGCTGGGCGCCTCCCCCGCGCTGCCGCGCGCCC
hide sequence
RefSeq Acc Id:
XR_001780429
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,009 - 50,696,075 (-) NCBI GRCm38 12 50,341,226 - 50,649,271 (-) NCBI
Sequence:
GCTCCGCGGCGCCGCCCTCGCCCCGCCCCGCCCCGCCGGCGCCGGTCGCGCGGACCCGCCGTGG
hide sequence
RefSeq Acc Id:
XR_001780431
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,009 - 50,696,075 (-) NCBI GRCm38 12 50,341,226 - 50,649,271 (-) NCBI
Sequence:
GCTCCGCGGCGCCGCCCTCGCCCCGCCCCGCCCCGCCGGCGCCGGTCGCGCGGACCCGCCGTGGTCCCCGGAGCGGAGCGCGCCGCGGCCGCAGTAGCTGGGCGCCTCCCCCGCGCTGCCGCGCGCCC
hide sequence
RefSeq Acc Id:
XR_001780432
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,388,009 - 50,696,075 (-) NCBI GRCm38 12 50,341,226 - 50,649,271 (-) NCBI
Sequence:
GCTCCGCGGCGCCGCCCTCGCCCCGCCCCGCCCCGCCGGCGCCGGTCGCGCGGACCCGCCGTGG
hide sequence
RefSeq Acc Id:
XR_004937445
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,474,931 - 50,696,054 (-) NCBI
Sequence:
CCCGCCCCGCCCCGCCGGCGCCGGTCGCGCGGACCCGCCGTGGTCCCCGGAGCGGAGCGCGCCG
hide sequence
RefSeq Acc Id:
XR_004937446
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 50,474,932 - 50,696,054 (-) NCBI
Sequence:
CCCGCCCCGCCCCGCCGGCGCCGGTCGCGCGGACCCGCCGTGGTCCCCGGAGCGGAGCGCGCCG
hide sequence
RefSeq Acc Id:
NP_032884 ⟸ NM_008858
- Peptide Label:
isoform 1
- UniProtKB:
E9QNA3 (UniProtKB/Swiss-Prot), Q62101 (UniProtKB/Swiss-Prot)
- Sequence:
MSVPPLLRPPSPLLPAAAAVAAAAAALVPGSGPAPFPAPGAAPAGGISFHLQIGLSREPVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGLYDKILLFRHDPASDNILQLVKIASDIQEGDLIE
hide sequence
RefSeq Acc Id:
XP_006515649 ⟸ XM_006515586
- Peptide Label:
isoform X1
- Sequence:
MSVPPLLRPPSPLLPAAAAVAAAAAALVPGSGPAPFPAPGAAPAGGISFHLQIGLSREPVLLLQ
hide sequence
RefSeq Acc Id:
XP_006515653 ⟸ XM_006515590
- Peptide Label:
isoform X2
- Sequence:
MLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGLGTVRTASAEFSTSVPDEPLLSPVSPGFEQKSPSESFIGREKRSNSQSYIGRPIQLDKLLMSKVKVPHTFVIHSYTRPTVCQ
hide sequence
RefSeq Acc Id:
XP_006515654 ⟸ XM_006515591
- Peptide Label:
isoform X3
- Sequence:
MSVPPLLRPPSPLLPAAAAVAAAAAALVPGSGPAPFPAPGAAPAGGISFHLQIGLSREPVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGLYDKILLFRHDPASDNILQLVKIASDIQEGDLIE
hide sequence
RefSeq Acc Id:
NP_001369743 ⟸ NM_001382814
- Peptide Label:
isoform 2
RefSeq Acc Id:
NP_001369745 ⟸ NM_001382816
- Peptide Label:
isoform 4
RefSeq Acc Id:
NP_001369744 ⟸ NM_001382815
- Peptide Label:
isoform 3
Ensembl Acc Id:
ENSMUSP00000002765 ⟸ ENSMUST00000002765
RefSeq Acc Id:
XP_036013143 ⟸ XM_036157250
- Peptide Label:
isoform X2
RGD ID: 8678232 Promoter ID: EPDNEW_M17147 Type: initiation region Name: Prkd1_1 Description: Mus musculus protein kinase D1 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 12 50,649,200 - 50,649,260 EPDNEW
