Symbol:
Akap8l
Name:
A kinase anchor protein 8-like
RGD ID:
1551047
MGI Page
MGI
Description:
Predicted to enable histone deacetylase binding activity; lamin binding activity; and protein kinase A regulatory subunit binding activity. Predicted to be involved in several processes, including cell cycle G2/M phase transition; mitotic chromosome condensation; and regulation of mRNA export from nucleus. Located in nuclear matrix. Is expressed in several structures, including central nervous system and retina. Orthologous to human AKAP8L (A-kinase anchoring protein 8 like).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A kinase (PRKA) anchor protein 8-like; A-kinase anchor protein 8-like; AKAP8-like protein; HAP95; Nak; Nakap95; neighbor of A-kinase anchoring protein 95; neighbor of A-kinase-anchoring protein 95; neighbor of AKAP95
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 32,540,398 - 32,569,589 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 32,540,398 - 32,569,581 (-) Ensembl GRCm39 Ensembl GRCm38 17 32,321,424 - 32,350,616 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 32,321,424 - 32,350,607 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 32,458,369 - 32,487,522 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 32,053,032 - 32,082,199 (-) NCBI MGSCv36 mm8 Celera 17 33,242,263 - 33,271,406 (-) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 17.5 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Akap8l Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of AKAP8L mRNA CTD PMID:22206623 Akap8l Mouse 17beta-estradiol multiple interactions ISO Akap8l (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of AKAP8L mRNA CTD PMID:26496021 Akap8l Mouse 17beta-estradiol decreases expression ISO Akap8l (Rattus norvegicus) 6480464 Estradiol results in decreased expression of AKAP8L mRNA CTD PMID:35192832 Akap8l Mouse 2,3',4,4',5-Pentachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:31388691 Akap8l Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Akap8l (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of AKAP8L mRNA CTD PMID:21215274 Akap8l Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of AKAP8L mRNA CTD PMID:21570461 Akap8l Mouse 2,4-dinitrotoluene affects expression ISO Akap8l (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of AKAP8L mRNA CTD PMID:21346803 Akap8l Mouse 2,6-dinitrotoluene affects expression ISO Akap8l (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of AKAP8L mRNA CTD PMID:21346803 Akap8l Mouse 2-hydroxypropanoic acid decreases expression ISO AKAP8L (Homo sapiens) 6480464 Lactic Acid results in decreased expression of AKAP8L mRNA CTD PMID:30851411 Akap8l Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Akap8l (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of AKAP8L mRNA CTD PMID:36041667 Akap8l Mouse 6-propyl-2-thiouracil decreases expression ISO Akap8l (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of AKAP8L mRNA CTD PMID:30047161 Akap8l Mouse acrolein multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of AKAP8L mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of AKAP8L mRNA CTD PMID:32699268 Akap8l Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of AKAP8L mRNA CTD PMID:19770486 Akap8l Mouse alpha-pinene multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of AKAP8L mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of AKAP8L mRNA CTD PMID:32699268 Akap8l Mouse amitrole decreases expression ISO Akap8l (Rattus norvegicus) 6480464 Amitrole results in decreased expression of AKAP8L mRNA CTD PMID:30047161 Akap8l Mouse aristolochic acid A increases expression ISO AKAP8L (Homo sapiens) 6480464 aristolochic acid I results in increased expression of AKAP8L mRNA CTD PMID:33212167 Akap8l Mouse Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of AKAP8L mRNA CTD PMID:23650126 Akap8l Mouse arsane multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of AKAP8L mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of AKAP8L mRNA CTD PMID:39836092 Akap8l Mouse arsenic atom multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of AKAP8L mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of AKAP8L mRNA CTD PMID:39836092 Akap8l Mouse arsenous acid increases expression ISO AKAP8L (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of AKAP8L mRNA CTD PMID:20458559 Akap8l Mouse azoxystrobin multiple interactions ISO Akap8l (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of AKAP8L mRNA CTD PMID:33854195 Akap8l Mouse benzo[a]pyrene affects methylation ISO AKAP8L (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of AKAP8L promoter CTD PMID:27901495 Akap8l Mouse benzo[a]pyrene diol epoxide I decreases expression ISO AKAP8L (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Akap8l Mouse benzo[a]pyrene diol epoxide I increases expression ISO AKAP8L (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Akap8l Mouse bisphenol A multiple interactions ISO Akap8l (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of AKAP8L mRNA and [bisphenol A co-treated with Estradiol] results in decreased expression of AKAP8L mRNA CTD PMID:26496021 and PMID:36041667 Akap8l Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of AKAP8L mRNA CTD PMID:32156529 and PMID:38074096 Akap8l Mouse bisphenol A decreases expression ISO Akap8l (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of AKAP8L mRNA CTD PMID:32145629 Akap8l Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of AKAP8L mRNA CTD PMID:29165653 Akap8l Mouse bisphenol A increases methylation ISO Akap8l (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of AKAP8L gene CTD PMID:28505145 Akap8l Mouse bisphenol A increases expression ISO Akap8l (Rattus norvegicus) 6480464 bisphenol A results in increased expression of AKAP8L mRNA CTD PMID:25181051 more ... Akap8l Mouse bisphenol AF increases expression ISO AKAP8L (Homo sapiens) 6480464 bisphenol AF results in increased expression of AKAP8L protein CTD PMID:34186270 Akap8l Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of AKAP8L mRNA CTD PMID:38685157 Akap8l Mouse bisphenol F multiple interactions ISO Akap8l (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of AKAP8L mRNA CTD PMID:36041667 Akap8l Mouse buspirone increases expression ISO Akap8l (Rattus norvegicus) 6480464 Buspirone results in increased expression of AKAP8L mRNA CTD PMID:24136188 Akap8l Mouse cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of AKAP8L mRNA CTD PMID:37325564 Akap8l Mouse cadmium dichloride affects methylation ISO Akap8l (Rattus norvegicus) 6480464 Cadmium Chloride affects the methylation of AKAP8L promoter CTD PMID:22457795 Akap8l Mouse cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of AKAP8L mRNA CTD PMID:37325564 Akap8l Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Akap8l Mouse carbon nanotube decreases methylation ISO AKAP8L (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased methylation of AKAP8L gene CTD PMID:29426343 Akap8l Mouse chlorpyrifos multiple interactions ISO Akap8l (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of AKAP8L mRNA CTD PMID:33854195 Akap8l Mouse cobalt dichloride increases expression ISO AKAP8L (Homo sapiens) 6480464 cobaltous chloride results in increased expression of AKAP8L mRNA CTD PMID:19376846 Akap8l Mouse copper atom increases expression ISO Akap8l (Rattus norvegicus) 6480464 Copper results in increased expression of AKAP8L mRNA CTD PMID:30556269 Akap8l Mouse copper(0) increases expression ISO Akap8l (Rattus norvegicus) 6480464 Copper results in increased expression of AKAP8L mRNA CTD PMID:30556269 Akap8l Mouse copper(II) sulfate increases expression ISO AKAP8L (Homo sapiens) 6480464 Copper Sulfate results in increased expression of AKAP8L mRNA CTD PMID:19549813 Akap8l Mouse crocidolite asbestos increases expression EXP 6480464 Asbestos and Crocidolite results in increased expression of AKAP8L mRNA CTD PMID:19446018 Akap8l Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of AKAP8L mRNA CTD PMID:29279043 Akap8l Mouse cyclosporin A increases expression ISO AKAP8L (Homo sapiens) 6480464 Cyclosporine results in increased expression of AKAP8L mRNA CTD PMID:25562108 Akap8l Mouse DDE decreases expression ISO AKAP8L (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of AKAP8L mRNA CTD PMID:38568856 Akap8l Mouse deguelin increases expression ISO AKAP8L (Homo sapiens) 6480464 deguelin results in increased expression of AKAP8L mRNA CTD PMID:33512557 Akap8l Mouse deoxynivalenol increases expression ISO AKAP8L (Homo sapiens) 6480464 deoxynivalenol results in increased expression of AKAP8L mRNA CTD PMID:31863870 Akap8l Mouse diarsenic trioxide increases expression ISO AKAP8L (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of AKAP8L mRNA CTD PMID:20458559 Akap8l Mouse Dibutyl phosphate affects expression ISO AKAP8L (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of AKAP8L mRNA CTD PMID:37042841 Akap8l Mouse diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of AKAP8L mRNA CTD PMID:15171707 Akap8l Mouse dorsomorphin multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of AKAP8L mRNA CTD PMID:27188386 Akap8l Mouse enzyme inhibitor multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of AKAP8L protein CTD PMID:23301498 Akap8l Mouse ethyl methanesulfonate increases expression ISO AKAP8L (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of AKAP8L mRNA CTD PMID:23649840 Akap8l Mouse fenthion decreases expression EXP 6480464 Fenthion results in decreased expression of AKAP8L mRNA CTD PMID:34813904 Akap8l Mouse flutamide decreases expression ISO Akap8l (Rattus norvegicus) 6480464 Flutamide results in decreased expression of AKAP8L mRNA CTD PMID:24136188 Akap8l Mouse formaldehyde increases expression ISO AKAP8L (Homo sapiens) 6480464 Formaldehyde results in increased expression of AKAP8L mRNA CTD PMID:23649840 Akap8l Mouse FR900359 increases phosphorylation ISO AKAP8L (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of AKAP8L protein CTD PMID:37730182 Akap8l Mouse gentamycin increases expression ISO Akap8l (Rattus norvegicus) 6480464 Gentamicins results in increased expression of AKAP8L mRNA CTD PMID:33387578 Akap8l Mouse glyphosate multiple interactions ISO Akap8l (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of AKAP8L mRNA CTD PMID:33854195 Akap8l Mouse imidacloprid multiple interactions ISO Akap8l (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of AKAP8L mRNA CTD PMID:33854195 Akap8l Mouse manganese atom multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of AKAP8L mRNA CTD PMID:39836092 Akap8l Mouse manganese(0) multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of AKAP8L mRNA CTD PMID:39836092 Akap8l Mouse manganese(II) chloride multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of AKAP8L mRNA CTD PMID:39836092 Akap8l Mouse methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of AKAP8L mRNA CTD PMID:26307267 Akap8l Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of AKAP8L mRNA CTD PMID:34813904 Akap8l Mouse methimazole decreases expression ISO Akap8l (Rattus norvegicus) 6480464 Methimazole results in decreased expression of AKAP8L mRNA CTD PMID:30047161 Akap8l Mouse methoxychlor affects methylation ISO Akap8l (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of AKAP8L gene CTD PMID:35440735 Akap8l Mouse methyl methanesulfonate increases expression ISO AKAP8L (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of AKAP8L mRNA CTD PMID:23649840 Akap8l Mouse nefazodone decreases expression ISO Akap8l (Rattus norvegicus) 6480464 nefazodone results in decreased expression of AKAP8L mRNA CTD PMID:24136188 Akap8l Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of AKAP8L mRNA CTD PMID:35964746 Akap8l Mouse ozone multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of AKAP8L mRNA more ... CTD PMID:32699268 Akap8l Mouse ozone multiple interactions ISO Akap8l (Rattus norvegicus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of AKAP8L mRNA CTD PMID:37871705 Akap8l Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of AKAP8L mRNA CTD PMID:34911549 Akap8l Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of AKAP8L mRNA CTD PMID:17562736 Akap8l Mouse paracetamol increases expression ISO Akap8l (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of AKAP8L mRNA CTD PMID:33387578 Akap8l Mouse pirinixic acid decreases expression ISO Akap8l (Rattus norvegicus) 6480464 pirinixic acid results in decreased expression of AKAP8L mRNA CTD PMID:22484513 Akap8l Mouse pregnenolone 16alpha-carbonitrile decreases expression ISO Akap8l (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in decreased expression of AKAP8L mRNA CTD PMID:30047161 Akap8l Mouse rac-lactic acid decreases expression ISO AKAP8L (Homo sapiens) 6480464 Lactic Acid results in decreased expression of AKAP8L mRNA CTD PMID:30851411 Akap8l Mouse SB 431542 multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of AKAP8L mRNA CTD PMID:27188386 Akap8l Mouse sodium arsenite increases expression ISO AKAP8L (Homo sapiens) 6480464 sodium arsenite results in increased expression of AKAP8L mRNA CTD PMID:38568856 Akap8l Mouse sodium arsenite multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of AKAP8L mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of AKAP8L mRNA CTD PMID:39836092 Akap8l Mouse sulfadimethoxine decreases expression ISO Akap8l (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of AKAP8L mRNA CTD PMID:30047161 Akap8l Mouse sunitinib decreases expression ISO AKAP8L (Homo sapiens) 6480464 Sunitinib results in decreased expression of AKAP8L mRNA CTD PMID:31533062 Akap8l Mouse tetraphene increases expression EXP 6480464 benz(a)anthracene results in increased expression of AKAP8L mRNA CTD PMID:26377693 Akap8l Mouse thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of AKAP8L protein CTD PMID:24648495 Akap8l Mouse thiabendazole multiple interactions ISO Akap8l (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of AKAP8L mRNA CTD PMID:33854195 Akap8l Mouse thimerosal increases expression ISO AKAP8L (Homo sapiens) 6480464 Thimerosal results in increased expression of AKAP8L mRNA CTD PMID:27188386 Akap8l Mouse thioacetamide decreases expression ISO Akap8l (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of AKAP8L mRNA CTD PMID:34492290 Akap8l Mouse thiram increases expression ISO AKAP8L (Homo sapiens) 6480464 Thiram results in increased expression of AKAP8L mRNA CTD PMID:38568856 Akap8l Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of AKAP8L gene and titanium dioxide results in decreased methylation of AKAP8L promoter CTD PMID:35295148 Akap8l Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of AKAP8L gene CTD PMID:35295148 Akap8l Mouse trichostatin A decreases expression ISO AKAP8L (Homo sapiens) 6480464 trichostatin A results in decreased expression of AKAP8L mRNA CTD PMID:24935251 Akap8l Mouse triphenyl phosphate affects expression ISO AKAP8L (Homo sapiens) 6480464 triphenyl phosphate affects the expression of AKAP8L mRNA CTD PMID:37042841 Akap8l Mouse urethane increases expression ISO AKAP8L (Homo sapiens) 6480464 Urethane results in increased expression of AKAP8L mRNA CTD PMID:28818685 Akap8l Mouse valdecoxib decreases expression ISO Akap8l (Rattus norvegicus) 6480464 valdecoxib results in decreased expression of AKAP8L mRNA CTD PMID:24136188 Akap8l Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of AKAP8L mRNA CTD PMID:17963808 Akap8l Mouse valproic acid increases expression ISO AKAP8L (Homo sapiens) 6480464 Valproic Acid results in increased expression of AKAP8L mRNA CTD PMID:37505509 Akap8l Mouse valproic acid multiple interactions ISO AKAP8L (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of AKAP8L mRNA CTD PMID:27188386 Akap8l Mouse valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of AKAP8L mRNA CTD PMID:21427059 Akap8l Mouse valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of AKAP8L mRNA CTD PMID:21427059 Akap8l Mouse valproic acid affects expression ISO AKAP8L (Homo sapiens) 6480464 Valproic Acid affects the expression of AKAP8L mRNA CTD PMID:25979313 Akap8l Mouse valproic acid decreases expression ISO AKAP8L (Homo sapiens) 6480464 Valproic Acid results in decreased expression of AKAP8L mRNA CTD PMID:23179753 Akap8l Mouse vinclozolin increases expression ISO Akap8l (Rattus norvegicus) 6480464 vinclozolin results in increased expression of AKAP8L mRNA CTD PMID:23034163 Akap8l Mouse vorinostat decreases expression ISO AKAP8L (Homo sapiens) 6480464 vorinostat results in decreased expression of AKAP8L mRNA CTD PMID:27188386
1,2-dimethylhydrazine (EXP) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (ISO) acrolein (ISO) aflatoxin B1 (EXP) alpha-pinene (ISO) amitrole (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) buspirone (ISO) cadmium atom (EXP) cadmium dichloride (EXP,ISO) carbon nanotube (EXP,ISO) chlorpyrifos (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (EXP) cyclosporin A (ISO) DDE (ISO) deguelin (ISO) deoxynivalenol (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (EXP) dorsomorphin (ISO) enzyme inhibitor (ISO) ethyl methanesulfonate (ISO) fenthion (EXP) flutamide (ISO) formaldehyde (ISO) FR900359 (ISO) gentamycin (ISO) glyphosate (ISO) imidacloprid (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (EXP) methidathion (EXP) methimazole (ISO) methoxychlor (ISO) methyl methanesulfonate (ISO) nefazodone (ISO) nitrates (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) rac-lactic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) sulfadimethoxine (ISO) sunitinib (ISO) tetraphene (EXP) thapsigargin (EXP) thiabendazole (ISO) thimerosal (ISO) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) urethane (ISO) valdecoxib (ISO) valproic acid (EXP,ISO) vinclozolin (ISO) vorinostat (ISO)
Akap8l Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 32,540,398 - 32,569,589 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 32,540,398 - 32,569,581 (-) Ensembl GRCm39 Ensembl GRCm38 17 32,321,424 - 32,350,616 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 32,321,424 - 32,350,607 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 32,458,369 - 32,487,522 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 32,053,032 - 32,082,199 (-) NCBI MGSCv36 mm8 Celera 17 33,242,263 - 33,271,406 (-) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 17.5 NCBI
AKAP8L Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 15,380,050 - 15,418,988 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 15,380,050 - 15,419,141 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 15,490,861 - 15,529,799 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 15,351,859 - 15,390,833 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 15,351,858 - 15,390,833 NCBI Celera 19 15,386,496 - 15,425,477 (-) NCBI Celera Cytogenetic Map 19 p13.12 NCBI HuRef 19 15,058,829 - 15,097,763 (-) NCBI HuRef CHM1_1 19 15,490,499 - 15,529,470 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 15,505,027 - 15,543,979 (-) NCBI T2T-CHM13v2.0
Akap8l Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 11,983,215 - 12,012,843 (-) NCBI GRCr8 mRatBN7.2 7 11,332,671 - 11,362,287 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 11,332,672 - 11,362,275 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 14,151,159 - 14,180,750 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 16,028,581 - 16,058,168 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 13,900,096 - 13,929,674 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 14,340,168 - 14,369,835 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 14,340,170 - 14,369,821 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 14,494,264 - 14,524,003 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 12,889,649 - 12,919,236 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 12,889,649 - 12,919,236 (-) NCBI Celera 7 9,443,795 - 9,473,308 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
Akap8l Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 7,839,339 - 7,874,432 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 7,839,339 - 7,874,432 (+) NCBI ChiLan1.0 ChiLan1.0
AKAP8L Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 20,293,841 - 20,332,210 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 19,296,597 - 19,334,983 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 14,912,960 - 14,950,479 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 15,897,896 - 15,936,684 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 15,897,969 - 15,936,486 (-) Ensembl panpan1.1 panPan2
AKAP8L Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 46,773,585 - 46,800,544 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 46,747,062 - 46,817,240 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 46,621,143 - 46,648,110 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 47,260,225 - 47,287,202 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 47,232,152 - 47,287,197 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 46,495,088 - 46,522,051 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 46,911,738 - 46,938,694 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 47,185,246 - 47,212,220 (+) NCBI UU_Cfam_GSD_1.0
Akap8l Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 205,539,079 - 205,574,596 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936596 5,088,361 - 5,123,649 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936596 5,088,260 - 5,123,735 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
AKAP8L Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 62,184,763 - 62,221,935 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 62,184,735 - 62,241,631 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 61,760,062 - 61,797,260 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
AKAP8L Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 13,987,731 - 14,023,130 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 13,987,736 - 14,023,148 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 5,484,922 - 5,520,168 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Akap8l
.
Predicted Target Of
Count of predictions: 280 Count of miRNA genes: 254 Interacting mature miRNAs: 280 Transcripts: ENSMUST00000050214 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10045977 Tir9_m trypanosome infection response 9 (mouse) Not determined 17 27878119 43885114 Mouse 1302038 Radpf1_m radiation pulmonary fibrosis 1 (mouse) Not determined 17 16835455 33819843 Mouse 1300890 Bhr3_m bronchial hyperresponsiveness 3 (mouse) Not determined 17 3974890 48866091 Mouse 11075105 Modc1_m modifier of Odc1 (mouse) 17 27715792 45622654 Mouse 1300995 Fembrs4_m femur breaking strength 4 (mouse) Not determined 17 15061652 49061760 Mouse 15039348 Nmrs37_m NAFLD-associated magnetic resonance shift 37 (mouse) 17 27815209 61815209 Mouse 4141357 Mrdq1_m modifier of retinal degeneration QTL 1 (mouse) Not determined 30987903 48039703 Mouse 1302152 Skull25_m skull morphology 25 (mouse) Not determined 17 16819721 50819843 Mouse 1302028 Asbb3_m autoimmune susceptibility in C57BL/6J and BALB/c 3 (mouse) Not determined 17 10878119 44878219 Mouse 15039354 Nmrs36_m NAFLD-associated magnetic resonance shift 36 (mouse) 17 19145025 53145025 Mouse 4141215 Mnic1_m macronutrient intake, carbohydrate 1 (mouse) Not determined 4854752 45670266 Mouse 1300787 Cd8mts5_m CD8 memory T cell subset 5 (mouse) Not determined 17 8584914 42585149 Mouse 13524847 Asrq8a_m acoustic startle response 8a (mouse) 17 12646961 46646961 Mouse 1300914 Pcir4_m periosteal circumference 4 (mouse) Not determined 17 15061652 49061760 Mouse 13452396 Leusq3_m leucocytosis susceptibility QTL 3 (mouse) 17 17462208 51462345 Mouse 13452399 Leusq6_m leucocytosis susceptibility QTL 6 (mouse) 17 17462208 51462345 Mouse 1300535 Char3_m P. chabaudi malaria resistance QTL 3 (mouse) Not determined 17 17462208 51462345 Mouse 4140955 Plgr1_m plague resistance locus 1 (mouse) Not determined 31033500 65033630 Mouse 1302070 Tbbmd7_m total body bone mineral density 7 (mouse) Not determined 17 15061652 49061760 Mouse 10412214 Sxbq3_m SGC/Knj cross B6 QTL 3 (mouse) Not determined 17 17462208 51462345 Mouse 10412083 Sm2_m susceptibility to Schistosoma mansoni infection 2 (mouse) Not determined 17 17029943 51030078 Mouse 10412204 Bbaa29_m B.burgdorferi-associated arthritis 29 (mouse) Not determined 17 26051185 60051352 Mouse 10043949 Pbft7_m percent body fat 7 (mouse) Not determined 17 6893936 40893936 Mouse 4141067 Hbnr2_m Heligmosomoides bakeri nematode resistance 2 (mouse) Not determined 11885971 45886119 Mouse 12904946 Tammq8_m tibialis anterior muscle mass QTL 8 (mouse) 17 12451787 46451787 Mouse 10412198 Sst5_m susceptibility to tuberculosis 5 (mouse) Not determined 17 25076583 55712970 Mouse 4142342 Lfnq4_m lung function QTL 4 (mouse) Not determined 11206484 39364059 Mouse 10412196 Bbaa28_m B.burgdorferi-associated arthritis 28 (mouse) Not determined 17 25584914 43976235 Mouse 1301935 Skull24_m skull morphology 24 (mouse) Not determined 17 8584914 42585149 Mouse 1301331 Lbw1_m lupus NZB x NZW 1 (mouse) Not determined 17 18418357 52420983 Mouse 1301840 Ssial4_m susceptibility to sialadenitiss 4 (mouse) Not determined 17 18175412 52178214 Mouse 1300692 Blmpf1_m bleomycin-induced pulmonary fibrosis 1 (mouse) Not determined 17 32061652 37644775 Mouse 1357789 Kdnw3_m kidney weight 3 (mouse) Not determined 17 4854752 47885665 Mouse 1301338 Lmr1_m leishmaniasis resistance 1 (mouse) Not determined 17 10081340 86996400 Mouse 1300703 Uvbi2_m UVB induced immunosuppression 2 (mouse) Not determined 17 28622406 62622654 Mouse 11038694 Pas19_m pulmonary adenoma susceptibility 19 (mouse) 17 29711164 34754437 Mouse 1301056 Pas2_m pulmonary adenoma susceptibility 2 (mouse) Not determined 17 18422141 52424327 Mouse 1301454 Eae5_m susceptibility to experimental allergic encephalomyelitis 5 (mouse) Not determined 17 24612750 58612864 Mouse 14747010 Mancz14_m mandible centroid size 14 (mouse) 17 11998184 45998184 Mouse 1302005 Loco2_m locomotor activity 2 (mouse) Not determined 17 26884972 60885114 Mouse 4141272 Tfv1_m total food volume 1 (mouse) Not determined 4854752 65637357 Mouse 1300602 Eye2_m eye weight 2 (mouse) Not determined 17 26505337 41105037 Mouse 10412276 Leci2_m leukocyte endothelial cell interactions 2 (mouse) Not determined 17 3348175 37348299 Mouse 1302140 Wta4_m weight adult 4 (mouse) Not determined 17 16819721 50819843 Mouse 1300706 Alan1_m alloantigen response 1 (mouse) Not determined 17 4854752 46469702 Mouse 1558886 Lgth9_m body length 9 (mouse) Not determined 17 15061652 49061760 Mouse 1558758 Kcal2_m kilocalorie 2 (mouse) Not determined 17 26401012 52911704 Mouse 4142150 Stheal11_m soft tissue heal 11 (mouse) Not determined 17 12286211 83361768 Mouse 11081168 Tir7_m trypanosome infection response 7 (mouse) 17 14123372 48123496 Mouse 1300589 Myaa2_m modifier of Yaa 2 (mouse) Not determined 17 30132555 64132666 Mouse
D10Mit157.2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 D1 UniSTS Cytogenetic Map 16 B4 UniSTS Cytogenetic Map 18 E2 UniSTS Cytogenetic Map 4 C3 UniSTS Cytogenetic Map 7 B2 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 14 E2.2 UniSTS Cytogenetic Map 4 C7 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 1 F UniSTS Cytogenetic Map 6 C3 UniSTS Cytogenetic Map 11 D UniSTS Cytogenetic Map 3 G2 UniSTS Cytogenetic Map 17 A1 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 3 B UniSTS Cytogenetic Map 8 C1 UniSTS Cytogenetic Map 18 A2 UniSTS Cytogenetic Map 3 F2 UniSTS Cytogenetic Map 14 C3 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 8 E2 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 18 B1 UniSTS Cytogenetic Map 9 C UniSTS Cytogenetic Map 14 C2 UniSTS Cytogenetic Map 6 A1 UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 13 D2.1 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 11 B1.3 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 17 E3 UniSTS Cytogenetic Map 11 B3 UniSTS Cytogenetic Map 1 H4 UniSTS Cytogenetic Map 6 A3 UniSTS Cytogenetic Map 5 E4-E5 UniSTS Cytogenetic Map 15 E1 UniSTS Cytogenetic Map 13 D UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 14 D1 UniSTS Cytogenetic Map 7 B4 UniSTS Cytogenetic Map 8 D3 UniSTS Cytogenetic Map X D UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 7 E2 UniSTS Cytogenetic Map 1 H2.3 UniSTS Cytogenetic Map 7 A2 UniSTS Cytogenetic Map 7 F3 UniSTS Cytogenetic Map 9 F1 UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 15 D2 UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 16 B2 UniSTS Cytogenetic Map 7 C UniSTS Cytogenetic Map 3 F2.1 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 1 C4 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 9 F3 UniSTS Cytogenetic Map 2 B UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 9 A4 UniSTS Cytogenetic Map 5 A3 UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 16 B1 UniSTS Cytogenetic Map 1 A5 UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 9 E1 UniSTS Cytogenetic Map 6 G1 UniSTS Cytogenetic Map X A2 UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 5 E2 UniSTS Cytogenetic Map 12 C1 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 10 C2 UniSTS Cytogenetic Map 9 B UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 10 A4 UniSTS Cytogenetic Map 8 A2 UniSTS Cytogenetic Map 18 A1 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 1 C2 UniSTS Cytogenetic Map 11 B2 UniSTS Cytogenetic Map 6 E3 UniSTS Cytogenetic Map 5 C3.3 UniSTS Cytogenetic Map 1 B UniSTS Cytogenetic Map 17 A3.1 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 4 B1 UniSTS Cytogenetic Map 15 A2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 5 G3 UniSTS Cytogenetic Map 4 A3 UniSTS Cytogenetic Map 2 H3 UniSTS Cytogenetic Map 8 A1 UniSTS Cytogenetic Map 8 A1.1 UniSTS Cytogenetic Map 16 A3 UniSTS Cytogenetic Map 10 B1 UniSTS Cytogenetic Map 19 A UniSTS Cytogenetic Map 10 A1 UniSTS Cytogenetic Map 13 D1 UniSTS Cytogenetic Map 4 A1 UniSTS Cytogenetic Map 9 A3 UniSTS Cytogenetic Map 17 C UniSTS Cytogenetic Map 1 D UniSTS Cytogenetic Map 5 E3 UniSTS Cytogenetic Map 15 D3 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 7 D3 UniSTS Cytogenetic Map 2 A1 UniSTS Cytogenetic Map 14 C1 UniSTS Cytogenetic Map 14 E5 UniSTS Cytogenetic Map 10 C UniSTS Cytogenetic Map 18 B2 UniSTS Cytogenetic Map 2 F1 UniSTS Cytogenetic Map 10 D3 UniSTS Cytogenetic Map 17 A2 UniSTS Cytogenetic Map 2 C3 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 17 B2 UniSTS Cytogenetic Map 5 B2 UniSTS Cytogenetic Map 5 G1 UniSTS Cytogenetic Map 4 C6 UniSTS Cytogenetic Map 13 C3 UniSTS Cytogenetic Map 2 E1 UniSTS Cytogenetic Map 17 A3.2-A3.3 UniSTS Cytogenetic Map 19 C3 UniSTS Cytogenetic Map 7 E3 UniSTS Cytogenetic Map 13 C1 UniSTS Cytogenetic Map 9 E3.1 UniSTS Cytogenetic Map 15 E3 UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X E3 UniSTS Cytogenetic Map 4 C4 UniSTS Cytogenetic Map 3 E3 UniSTS Cytogenetic Map 11 A4 UniSTS Cytogenetic Map 4 C5 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 9 A2 UniSTS Cytogenetic Map 7 E1 UniSTS Cytogenetic Map 5 D-E1 UniSTS Cytogenetic Map 5 B3 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 5 A2 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 1 E4 UniSTS Cytogenetic Map 17 E4 UniSTS Cytogenetic Map 1 G2 UniSTS Cytogenetic Map 15 B3.1 UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 6 A3.3 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 6 F2 UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 4 D2.1 UniSTS Cytogenetic Map 4 A5 UniSTS Cytogenetic Map 3 F2.2 UniSTS Cytogenetic Map 1 E3-E4 UniSTS Cytogenetic Map 9 F1-F3 UniSTS Cytogenetic Map 1 C1.1 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 12 A2 UniSTS Cytogenetic Map 17 A3-B UniSTS Cytogenetic Map 7 F5 UniSTS Cytogenetic Map 14 A3 UniSTS Cytogenetic Map 5 G1.1 UniSTS Cytogenetic Map X F2-F4 UniSTS Cytogenetic Map 7 D2 UniSTS Cytogenetic Map 2 F3 UniSTS Cytogenetic Map 10 A3 UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 9 F1-F2 UniSTS Cytogenetic Map 13 A3.2 UniSTS Cytogenetic Map 10 A2 UniSTS Cytogenetic Map 1 C1 UniSTS Cytogenetic Map 1 A1 UniSTS Cytogenetic Map 12 D3 UniSTS Cytogenetic Map 1 A3-A5 UniSTS Cytogenetic Map 2 A2 UniSTS Cytogenetic Map 3 A1 UniSTS Cytogenetic Map X A3.3 UniSTS Cytogenetic Map 16 A-B1 UniSTS Cytogenetic Map 1 D2.3 UniSTS Cytogenetic Map 6 B2.3 UniSTS Cytogenetic Map 2 G3 UniSTS Cytogenetic Map X A2-A3.1 UniSTS Cytogenetic Map 9 A5.3 UniSTS Cytogenetic Map 14 A2-B UniSTS Cytogenetic Map 8 E1-E2 UniSTS Cytogenetic Map 8 A3 UniSTS Cytogenetic Map 1 G3-H1 UniSTS Cytogenetic Map 8 B3-C1 UniSTS Cytogenetic Map 19 C1 UniSTS Cytogenetic Map 8 C5 UniSTS Cytogenetic Map 8 A4 UniSTS Cytogenetic Map 15 F3 UniSTS Cytogenetic Map 14 E4 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map X F5 UniSTS cM Map 10 40.0 UniSTS Whitehead Genetic 10 33.9 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000050214 ⟹ ENSMUSP00000051389
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,540,398 - 32,569,581 (-) Ensembl GRCm38.p6 Ensembl 17 32,321,424 - 32,350,607 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000235265 ⟹ ENSMUSP00000158056
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,555,447 - 32,569,480 (-) Ensembl GRCm38.p6 Ensembl 17 32,336,473 - 32,350,506 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000235387
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,556,900 - 32,569,563 (-) Ensembl GRCm38.p6 Ensembl 17 32,337,926 - 32,350,589 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000235614 ⟹ ENSMUSP00000157768
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,540,585 - 32,554,553 (-) Ensembl GRCm38.p6 Ensembl 17 32,321,611 - 32,335,579 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000235724
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,540,400 - 32,551,873 (-) Ensembl GRCm38.p6 Ensembl 17 32,321,426 - 32,332,899 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000236039
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,540,398 - 32,569,549 (-) Ensembl GRCm38.p6 Ensembl 17 32,321,424 - 32,350,575 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000236105
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,540,398 - 32,569,551 (-) Ensembl GRCm38.p6 Ensembl 17 32,321,424 - 32,350,577 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000236494
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,551,529 - 32,552,448 (-) Ensembl GRCm38.p6 Ensembl 17 32,332,555 - 32,333,474 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000236503 ⟹ ENSMUSP00000157684
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,540,399 - 32,569,569 (-) Ensembl GRCm38.p6 Ensembl 17 32,321,425 - 32,350,595 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000236618
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,551,453 - 32,553,454 (-) Ensembl GRCm38.p6 Ensembl 17 32,332,479 - 32,334,480 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000236765 ⟹ ENSMUSP00000158510
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,551,785 - 32,555,384 (-) Ensembl GRCm38.p6 Ensembl 17 32,332,811 - 32,336,410 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000237879
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,540,545 - 32,552,455 (-) Ensembl GRCm38.p6 Ensembl 17 32,321,571 - 32,333,481 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000237936 ⟹ ENSMUSP00000158213
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 32,551,808 - 32,555,527 (-) Ensembl GRCm38.p6 Ensembl 17 32,332,834 - 32,336,553 (-) Ensembl
RefSeq Acc Id:
NM_001403535 ⟹ NP_001390464
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,398 - 32,569,524 (-) NCBI
RefSeq Acc Id:
NM_001403536 ⟹ NP_001390465
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,398 - 32,569,524 (-) NCBI
RefSeq Acc Id:
NM_017476 ⟹ NP_059504
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,398 - 32,569,524 (-) NCBI GRCm38 17 32,321,424 - 32,350,577 (-) NCBI MGSCv37 17 32,458,369 - 32,487,522 (-) RGD Celera 17 33,242,263 - 33,271,406 (-) RGD cM Map 17 ENTREZGENE
Sequence:
AAGGACCCCAGGGATTGTTGTGGCGTCAGACGCGCAGAGTAGCGGTCTGTGTCCACGGCTCGGGTGTTCTCTGCGGCCATGAGCTACACAGGTTTTGTCCAAGGATCCGAAACCACTTTGCAGTCTAC
hide sequence
RefSeq Acc Id:
NR_175380
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,398 - 32,569,524 (-) NCBI
RefSeq Acc Id:
NR_175381
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,398 - 32,569,524 (-) NCBI
RefSeq Acc Id:
NR_175382
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,398 - 32,569,524 (-) NCBI
RefSeq Acc Id:
NR_175383
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,398 - 32,569,524 (-) NCBI
RefSeq Acc Id:
NR_175384
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,398 - 32,569,524 (-) NCBI
RefSeq Acc Id:
NR_175385
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,398 - 32,569,524 (-) NCBI
RefSeq Acc Id:
NR_175386
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,398 - 32,569,524 (-) NCBI
RefSeq Acc Id:
NR_175387
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,398 - 32,569,524 (-) NCBI
RefSeq Acc Id:
XM_030249905 ⟹ XP_030105765
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,928 - 32,569,583 (-) NCBI GRCm38 17 32,321,955 - 32,350,616 (-) NCBI
Sequence:
GAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTCAGACG
hide sequence
RefSeq Acc Id:
XR_003952151
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,589 (-) NCBI GRCm38 17 32,321,747 - 32,350,616 (-) NCBI
Sequence:
GCCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTCAGACGCGCAGAGTAGCGGTCTGTGTCCACGGCTCGGGTGTTCTCTGCGGCCATGAGCTACACA
hide sequence
RefSeq Acc Id:
XR_003952154
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,589 (-) NCBI GRCm38 17 32,321,747 - 32,350,615 (-) NCBI
Sequence:
GCCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGT
hide sequence
RefSeq Acc Id:
XR_003952155
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,403 - 32,569,589 (-) NCBI GRCm38 17 32,321,747 - 32,350,615 (-) NCBI
Sequence:
GCCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGT
hide sequence
RefSeq Acc Id:
XR_003952159
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,589 (-) NCBI GRCm38 17 32,321,744 - 32,350,615 (-) NCBI
Sequence:
GCCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTCAGACGCGCAGAGTAGCGGTCTGTGTCCACGGCTCGGGTGTTCTCTGCGGCCATGAGCTACACA
hide sequence
RefSeq Acc Id:
XR_003952161
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,588 (-) NCBI GRCm38 17 32,321,747 - 32,350,615 (-) NCBI
Sequence:
CCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTCAGACGCGCAGAGTAGCGGTCTGTGTCCACGGCTCGGGTGTTCTCTGCGGCCATGAGCTACACAG
hide sequence
RefSeq Acc Id:
XR_003952162
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,588 (-) NCBI GRCm38 17 32,321,744 - 32,350,615 (-) NCBI
Sequence:
CCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTC
hide sequence
RefSeq Acc Id:
XR_003952163
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,589 (-) NCBI GRCm38 17 32,321,747 - 32,350,615 (-) NCBI
Sequence:
GCCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTCAGACGCGCAGAGTAGCGGTCTGTGTCCACGGCTCGGGTGTTCTCTGCGGCCATGAGCTACACA
hide sequence
RefSeq Acc Id:
XR_003952164
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,403 - 32,569,589 (-) NCBI GRCm38 17 32,321,747 - 32,350,615 (-) NCBI
Sequence:
GCCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTCAGACGCGCAGAGTAGCGGTCTGTGTCCACGGCTCGGGTGTTCTCTGCGGCCATGAGCTACACA
hide sequence
RefSeq Acc Id:
XR_003952165
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,589 (-) NCBI GRCm38 17 32,321,747 - 32,350,615 (-) NCBI
Sequence:
GCCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGT
hide sequence
RefSeq Acc Id:
XR_004939555
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,670 - 32,569,583 (-) NCBI
Sequence:
GAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTCAGACGCGCAGAGTAGCGGTCTGTGTCCACGGCTCGGGTGTTCTCTGCGGCCATGAGCTACACAGGTTTT
hide sequence
RefSeq Acc Id:
XR_004939556
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,583 (-) NCBI
Sequence:
GAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTCAGACG
hide sequence
RefSeq Acc Id:
XR_004939557
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,589 (-) NCBI
Sequence:
GCCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTCAGACGCGCAGAGTAGCGGTCTGTGTCCACGGCTCGGGTGTTCTCTGCGGCCATGAGCTACACA
hide sequence
RefSeq Acc Id:
XR_004939558
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,589 (-) NCBI
Sequence:
GCCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTCAGACGCGCAGAGTAGCGGTCTGTGTCCACGGCTCGGGTGTTCTCTGCGGCCATGAGCTACACA
hide sequence
RefSeq Acc Id:
XR_004939559
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,589 (-) NCBI
Sequence:
GCCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGT
hide sequence
RefSeq Acc Id:
XR_004939560
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 32,540,718 - 32,569,589 (-) NCBI
Sequence:
GCCAATGAGATAAGGAGGCGGGGCTGGAGCGTGTGTGGAAGGACCCCAGGGATTGTTGTGGCGTCAGACGCGCAGAGTAGCGGTCTGTGTCCACGGCTCGGGTGTTCTCTGCGGCCATGAGCTACACA
hide sequence
RefSeq Acc Id:
NP_059504 ⟸ NM_017476
- Peptide Label:
isoform 1
- UniProtKB:
Q5RL57 (UniProtKB/TrEMBL), Q9D0K8 (UniProtKB/TrEMBL)
- Sequence:
MSYTGFVQGSETTLQSTYCDTSAQPTCDYGYGTWNSGTNRGYENYGYGYGYGQDNTTNYGYGMATSHSWEMASSDTNANPSASGSASADSVLSRINQRLDMMPHLETDMIQGGVYGSGGGERYDSYEA
hide sequence
RefSeq Acc Id:
XP_030105765 ⟸ XM_030249905
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSMUSP00000158213 ⟸ ENSMUST00000237936
Ensembl Acc Id:
ENSMUSP00000157684 ⟸ ENSMUST00000236503
Ensembl Acc Id:
ENSMUSP00000158510 ⟸ ENSMUST00000236765
Ensembl Acc Id:
ENSMUSP00000157768 ⟸ ENSMUST00000235614
Ensembl Acc Id:
ENSMUSP00000051389 ⟸ ENSMUST00000050214
Ensembl Acc Id:
ENSMUSP00000158056 ⟸ ENSMUST00000235265
RefSeq Acc Id:
NP_001390465 ⟸ NM_001403536
- Peptide Label:
isoform 3
- UniProtKB:
Q3TLG2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001390464 ⟸ NM_001403535
- Peptide Label:
isoform 2
- UniProtKB:
A0A494B9L0 (UniProtKB/TrEMBL), Q3TLG2 (UniProtKB/TrEMBL)
RGD ID: 13675508 Promoter ID: EPDNEW_M21903 Type: initiation region Name: Akap8l_1 Description: Mus musculus A kinase anchor protein 8-like , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 17 32,350,550 - 32,350,610 EPDNEW
RGD ID: 6847342 Promoter ID: MM_ACW:22410 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney, Liver, Lung, Spleen Transcripts: AKAP8L.ESEP07, AKAP8L.HSEP07 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 17 32,470,396 - 32,471,557 (-) MPROMDB
RGD ID: 6827838 Promoter ID: MM_KWN:23040 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_017476, UC008BWK.1, UC008BWL.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 17 32,487,426 - 32,488,482 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-07-04
Akap8l
A kinase anchor protein 8-like
Akap8l
A kinase (PRKA) anchor protein 8-like
Symbol and/or name change
5135510 APPROVED
