Symbol:
Slc1a5
Name:
solute carrier family 1 (neutral amino acid transporter), member 5
RGD ID:
1550772
MGI Page
MGI
Description:
Enables L-aspartate transmembrane transporter activity and neutral L-amino acid transmembrane transporter activity. Involved in L-aspartate import across plasma membrane and transport across blood-brain barrier. Located in basal plasma membrane. Is active in plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; liver; and respiratory system. Orthologous to human SLC1A5 (solute carrier family 1 member 5).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AAAT; ASC; ASC-like Na(+)-dependent neutral amino acid transporter ASCT2; ASCT2; ATB(0); ATBO; insulin-activated amino acid transporter; M7V1; M7VS1; MGC46952; neutral amino acid transporter B(0); R16; RDRC; Slc1a7; sodium-dependent neutral amino acid transporter type 2; solute carrier family 1 member 5; solute carrier family 1, member 7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Gm19187
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 16,515,259 - 16,532,199 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 16,515,265 - 16,532,199 (+) Ensembl GRCm39 Ensembl GRCm38 7 16,781,334 - 16,798,274 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 16,781,340 - 16,798,274 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 17,366,695 - 17,383,623 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 15,939,929 - 15,956,765 (+) NCBI MGSCv36 mm8 Celera 7 13,979,416 - 13,996,329 (+) NCBI Celera Cytogenetic Map 7 A2 NCBI cM Map 7 9.15 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc1a5 Mouse (-)-alpha-phellandrene decreases expression ISO SLC1A5 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of SLC1A5 mRNA CTD PMID:25075043 Slc1a5 Mouse (S)-colchicine decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Colchicine results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Mouse 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO SLC1A5 (Homo sapiens) 6480464 o and p'-DDT results in increased expression of SLC1A5 mRNA CTD PMID:19371625 Slc1a5 Mouse 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Slc1a5 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of SLC1A5 mRNA CTD PMID:28960355 Slc1a5 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SLC1A5 mRNA CTD PMID:22206623 Slc1a5 Mouse 1-naphthyl isothiocyanate increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in increased expression of SLC1A5 mRNA CTD PMID:20551477 Slc1a5 Mouse 17alpha-ethynylestradiol affects expression ISO Slc1a5 (Rattus norvegicus) 6480464 Ethinyl Estradiol affects the expression of SLC1A5 mRNA CTD PMID:20170705 Slc1a5 Mouse 17alpha-ethynylestradiol increases expression ISO SLC1A5 (Homo sapiens) 6480464 Ethinyl Estradiol results in increased expression of SLC1A5 mRNA CTD PMID:18936297 Slc1a5 Mouse 17alpha-ethynylestradiol affects expression ISO SLC1A5 (Homo sapiens) 6480464 Ethinyl Estradiol affects the expression of SLC1A5 mRNA CTD PMID:20170705 Slc1a5 Mouse 17beta-estradiol increases expression ISO SLC1A5 (Homo sapiens) 6480464 Estradiol results in increased expression of SLC1A5 mRNA CTD PMID:23019147 more ... Slc1a5 Mouse 17beta-estradiol decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Estradiol results in decreased expression of SLC1A5 protein CTD PMID:33181973 Slc1a5 Mouse 17beta-estradiol increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Estradiol results in increased expression of SLC1A5 mRNA and Estradiol results in increased expression of SLC1A5 protein CTD PMID:32145629 Slc1a5 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Slc1a5 Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Slc1a5 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SLC1A5 mRNA CTD PMID:21570461 and PMID:26377647 Slc1a5 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC1A5 mRNA CTD PMID:33387578 and PMID:34747641 Slc1a5 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC1A5 mRNA CTD PMID:26290441 and PMID:27562557 Slc1a5 Mouse 2,4,4'-trichlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Slc1a5 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO SLC1A5 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Slc1a5 Mouse 2,6-dimethoxyphenol multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of SLC1A5 protein CTD PMID:38598786 Slc1a5 Mouse 2-bromohexadecanoic acid multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SLC1A5 protein] CTD PMID:38195004 Slc1a5 Mouse 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Slc1a5 (Rattus norvegicus) 6480464 3 more ... CTD PMID:23196670 Slc1a5 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SLC1A5 mRNA CTD PMID:24848799 Slc1a5 Mouse 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of SLC1A5 mRNA CTD PMID:18648102 Slc1a5 Mouse 4,4'-sulfonyldiphenol affects expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol S affects the expression of SLC1A5 protein CTD PMID:31945527 Slc1a5 Mouse 4,4'-sulfonyldiphenol increases expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol S results in increased expression of SLC1A5 protein CTD PMID:34186270 Slc1a5 Mouse acetamide increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 acetamide results in increased expression of SLC1A5 mRNA CTD PMID:31881176 Slc1a5 Mouse acrylamide increases expression ISO SLC1A5 (Homo sapiens) 6480464 Acrylamide results in increased expression of SLC1A5 mRNA CTD PMID:32763439 Slc1a5 Mouse adenine decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Adenine results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Mouse aflatoxin B1 increases expression ISO SLC1A5 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of SLC1A5 mRNA CTD PMID:22100608 Slc1a5 Mouse aflatoxin B1 increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Aflatoxin B1 results in increased expression of SLC1A5 mRNA CTD PMID:25378103 Slc1a5 Mouse alpha-phellandrene decreases expression ISO SLC1A5 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of SLC1A5 mRNA CTD PMID:25075043 Slc1a5 Mouse ammonium chloride affects expression ISO Slc1a5 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of SLC1A5 mRNA CTD PMID:16483693 Slc1a5 Mouse arsane affects methylation ISO SLC1A5 (Homo sapiens) 6480464 Arsenic affects the methylation of SLC1A5 gene CTD PMID:25304211 Slc1a5 Mouse arsane multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SLC1A5 mRNA CTD PMID:39836092 Slc1a5 Mouse arsenic atom affects methylation ISO SLC1A5 (Homo sapiens) 6480464 Arsenic affects the methylation of SLC1A5 gene CTD PMID:25304211 Slc1a5 Mouse arsenic atom multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SLC1A5 mRNA CTD PMID:39836092 Slc1a5 Mouse atrazine affects methylation ISO Slc1a5 (Rattus norvegicus) 6480464 Atrazine affects the methylation of SLC1A5 gene CTD PMID:28931070 Slc1a5 Mouse Bardoxolone methyl decreases expression ISO SLC1A5 (Homo sapiens) 6480464 bardoxolone methyl results in decreased expression of SLC1A5 protein CTD PMID:35929395 Slc1a5 Mouse Bardoxolone methyl decreases glycosylation ISO SLC1A5 (Homo sapiens) 6480464 bardoxolone methyl results in decreased glycosylation of SLC1A5 protein CTD PMID:35929395 Slc1a5 Mouse beauvericin multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in increased expression of SLC1A5 protein CTD PMID:32407736 Slc1a5 Mouse benzo[a]pyrene decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SLC1A5 mRNA CTD PMID:20106945 and PMID:21632981 Slc1a5 Mouse benzo[a]pyrene increases expression ISO SLC1A5 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of SLC1A5 mRNA CTD PMID:32234424 Slc1a5 Mouse benzo[a]pyrene affects methylation ISO SLC1A5 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SLC1A5 promoter CTD PMID:27901495 Slc1a5 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of SLC1A5 mRNA CTD PMID:22228805 Slc1a5 Mouse benzoates increases expression ISO SLC1A5 (Homo sapiens) 6480464 Benzoates analog results in increased expression of SLC1A5 mRNA CTD PMID:29472718 Slc1a5 Mouse beta-naphthoflavone increases expression ISO SLC1A5 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of SLC1A5 mRNA CTD PMID:32858204 Slc1a5 Mouse bis(2-chloroethyl) sulfide increases expression EXP 6480464 Mustard Gas results in increased expression of SLC1A5 mRNA CTD PMID:15674843 Slc1a5 Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of SLC1A5 mRNA CTD PMID:34319233 Slc1a5 Mouse bisphenol A affects expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol A affects the expression of SLC1A5 mRNA CTD PMID:20170705 and PMID:30903817 Slc1a5 Mouse bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC1A5 mRNA CTD PMID:32156529 and PMID:38701888 Slc1a5 Mouse bisphenol A decreases expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SLC1A5 protein CTD PMID:37567409 Slc1a5 Mouse bisphenol A decreases expression ISO Slc1a5 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SLC1A5 mRNA CTD PMID:25181051 more ... Slc1a5 Mouse bisphenol A increases expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol A results in increased expression of SLC1A5 mRNA CTD PMID:19371625 and PMID:29275510 Slc1a5 Mouse bisphenol A increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of SLC1A5 mRNA and bisphenol A results in increased expression of SLC1A5 protein CTD PMID:17010207 and PMID:32145629 Slc1a5 Mouse bisphenol AF increases expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SLC1A5 protein CTD PMID:34186270 Slc1a5 Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of SLC1A5 mRNA CTD PMID:38685157 Slc1a5 Mouse bisphenol F increases expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol F results in increased expression of SLC1A5 protein CTD PMID:34186270 Slc1a5 Mouse Butylbenzyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Mouse cadmium atom multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SLC1A5 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SLC1A5 protein CTD PMID:38195004 Slc1a5 Mouse cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of SLC1A5 protein CTD PMID:39032683 Slc1a5 Mouse cadmium atom increases expression ISO SLC1A5 (Homo sapiens) 6480464 Cadmium results in increased expression of SLC1A5 protein CTD PMID:39032683 Slc1a5 Mouse cadmium dichloride increases expression ISO SLC1A5 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Mouse cadmium dichloride multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SLC1A5 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SLC1A5 protein CTD PMID:38195004 Slc1a5 Mouse cadmium dichloride decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SLC1A5 mRNA CTD PMID:38568856 Slc1a5 Mouse caffeine decreases phosphorylation ISO SLC1A5 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of SLC1A5 protein CTD PMID:35688186 Slc1a5 Mouse calcium silicate decreases expression EXP 6480464 calcium silicate results in decreased expression of SLC1A5 mRNA CTD PMID:29279043 Slc1a5 Mouse cefaloridine increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Cephaloridine results in increased expression of SLC1A5 mRNA CTD PMID:18500788 Slc1a5 Mouse chloroacetaldehyde affects expression ISO SLC1A5 (Homo sapiens) 6480464 chloroacetaldehyde affects the expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Mouse chloropicrin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 chloropicrin results in decreased expression of SLC1A5 mRNA CTD PMID:26352163 Slc1a5 Mouse chlorpromazine increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Chlorpromazine results in increased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Mouse chlorpyrifos increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Chlorpyrifos results in increased expression of SLC1A5 mRNA CTD PMID:20600679 Slc1a5 Mouse chlorpyrifos multiple interactions EXP 6480464 [Chlorpyrifos co-treated with NGF protein] results in increased expression of SLC1A5 mRNA CTD PMID:20600679 Slc1a5 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SLC1A5 mRNA CTD PMID:20938992 Slc1a5 Mouse cidofovir anhydrous increases expression ISO SLC1A5 (Homo sapiens) 6480464 Cidofovir results in increased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Mouse cisplatin increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Cisplatin results in increased expression of SLC1A5 mRNA CTD PMID:21080177 Slc1a5 Mouse cisplatin increases expression ISO SLC1A5 (Homo sapiens) 6480464 Cisplatin results in increased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Mouse cisplatin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Cisplatin results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Mouse clodronic acid decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Clodronic Acid results in decreased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Mouse cobalt dichloride decreases expression ISO SLC1A5 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SLC1A5 mRNA CTD PMID:19320972 Slc1a5 Mouse colforsin daropate hydrochloride decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Colforsin results in decreased expression of SLC1A5 mRNA and Colforsin results in decreased expression of SLC1A5 protein CTD PMID:37385477 Slc1a5 Mouse colforsin daropate hydrochloride multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 Valproic Acid promotes the reaction [Colforsin results in decreased expression of SLC1A5 protein] CTD PMID:37385477 Slc1a5 Mouse copper atom increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of SLC1A5 mRNA CTD PMID:26033743 Slc1a5 Mouse copper(0) increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of SLC1A5 mRNA CTD PMID:26033743 Slc1a5 Mouse corosolic acid increases expression ISO SLC1A5 (Homo sapiens) 6480464 corosolic acid results in increased expression of SLC1A5 mRNA CTD PMID:37939859 Slc1a5 Mouse coumarin affects phosphorylation ISO SLC1A5 (Homo sapiens) 6480464 coumarin affects the phosphorylation of SLC1A5 protein CTD PMID:35688186 Slc1a5 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of SLC1A5 mRNA CTD PMID:29279043 Slc1a5 Mouse Cuprizon increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of SLC1A5 mRNA CTD PMID:26577399 Slc1a5 Mouse cyclosporin A increases expression ISO SLC1A5 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SLC1A5 mRNA CTD PMID:20106945 more ... Slc1a5 Mouse deoxynivalenol decreases expression ISO SLC1A5 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of SLC1A5 mRNA CTD PMID:31863870 Slc1a5 Mouse dexamethasone multiple interactions EXP 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SLC1A5 mRNA CTD PMID:24848799 Slc1a5 Mouse dextran sulfate multiple interactions EXP 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of SLC1A5 protein] CTD PMID:32272095 Slc1a5 Mouse dextran sulfate decreases expression EXP 6480464 Dextran Sulfate results in decreased expression of SLC1A5 protein CTD PMID:32272095 Slc1a5 Mouse Di-n-octyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Mouse diazinon multiple interactions EXP 6480464 [Diazinon co-treated with NGF protein] results in increased expression of SLC1A5 mRNA CTD PMID:20600679 Slc1a5 Mouse Dibutyl phosphate affects expression ISO SLC1A5 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SLC1A5 mRNA CTD PMID:37042841 Slc1a5 Mouse dibutyl phthalate increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of SLC1A5 mRNA CTD PMID:21266533 Slc1a5 Mouse dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Mouse dieldrin multiple interactions EXP 6480464 [Dieldrin co-treated with NGF protein] results in increased expression of SLC1A5 mRNA CTD PMID:20600679 Slc1a5 Mouse diethyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Mouse Diisodecyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Mouse diisononyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Mouse dioxygen decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Mouse dioxygen multiple interactions ISO Slc1a5 (Rattus norvegicus) 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of SLC1A5 mRNA CTD PMID:33729688 Slc1a5 Mouse disodium selenite increases expression ISO SLC1A5 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of SLC1A5 mRNA CTD PMID:24383545 Slc1a5 Mouse dithioerythritol multiple interactions ISO Slc1a5 (Rattus norvegicus) 6480464 Dithioerythritol inhibits the reaction [Thiazoles analog results in decreased activity of SLC1A5 protein] CTD PMID:23010140 Slc1a5 Mouse doxorubicin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SLC1A5 mRNA CTD PMID:29803840 Slc1a5 Mouse endosulfan increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Endosulfan results in increased expression of SLC1A5 mRNA CTD PMID:29391264 Slc1a5 Mouse enniatin multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in increased expression of SLC1A5 protein CTD PMID:32407736 Slc1a5 Mouse enzyme inhibitor multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of SLC1A5 protein CTD PMID:23301498 Slc1a5 Mouse erianin multiple interactions EXP 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of SLC1A5 protein] CTD PMID:32272095 Slc1a5 Mouse ethanol decreases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Ethanol results in decreased expression of SLC1A5 mRNA CTD PMID:20655511 Slc1a5 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of SLC1A5 mRNA CTD PMID:19167417 Slc1a5 Mouse etoposide decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Etoposide results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Mouse folic acid multiple interactions EXP 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Slc1a5 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of SLC1A5 mRNA CTD PMID:25629700 Slc1a5 Mouse formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of SLC1A5 mRNA CTD PMID:33259821 Slc1a5 Mouse FR900359 affects phosphorylation ISO SLC1A5 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of SLC1A5 protein CTD PMID:37730182 Slc1a5 Mouse furfural multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of SLC1A5 protein CTD PMID:38598786 Slc1a5 Mouse genistein increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Genistein results in increased expression of SLC1A5 mRNA CTD PMID:17010207 Slc1a5 Mouse genistein increases expression ISO SLC1A5 (Homo sapiens) 6480464 Genistein results in increased expression of SLC1A5 mRNA CTD PMID:19371625 and PMID:23019147 Slc1a5 Mouse gentamycin decreases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of SLC1A5 mRNA CTD PMID:22061828 Slc1a5 Mouse GSK-J4 decreases expression ISO SLC1A5 (Homo sapiens) 6480464 GSK-J4 results in decreased expression of SLC1A5 mRNA CTD PMID:29301935 Slc1a5 Mouse hydroxyurea decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Hydroxyurea results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Mouse ifosfamide increases expression ISO SLC1A5 (Homo sapiens) 6480464 Ifosfamide results in increased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Mouse Indeno[1,2,3-cd]pyrene decreases expression EXP 6480464 indeno(1 more ... CTD PMID:26377693 Slc1a5 Mouse ivermectin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SLC1A5 protein CTD PMID:32959892 Slc1a5 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SLC1A5 mRNA CTD PMID:20938992 Slc1a5 Mouse lamivudine multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of SLC1A5 mRNA CTD PMID:15784690 Slc1a5 Mouse lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of SLC1A5 mRNA CTD PMID:12057914 Slc1a5 Mouse lipopolysaccharide multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of SLC1A5 mRNA CTD PMID:35877022 Slc1a5 Mouse Lobetyolin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 lobetyolin results in decreased expression of SLC1A5 mRNA and lobetyolin results in decreased expression of SLC1A5 protein CTD PMID:34075790 Slc1a5 Mouse Lobetyolin multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 AKT1 protein inhibits the reaction [lobetyolin results in decreased expression of SLC1A5 protein] and benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [lobetyolin results in decreased expression of SLC1A5 protein] CTD PMID:34075790 Slc1a5 Mouse maneb multiple interactions EXP 6480464 [Maneb co-treated with Paraquat] results in decreased expression of SLC1A5 mRNA CTD PMID:36117858 Slc1a5 Mouse manganese atom multiple interactions ISO Slc1a5 (Rattus norvegicus) 6480464 Manganese promotes the reaction [PRKCD protein binds to SLC1A5 protein] CTD PMID:21812036 Slc1a5 Mouse manganese atom multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA CTD PMID:39836092 Slc1a5 Mouse manganese(0) multiple interactions ISO Slc1a5 (Rattus norvegicus) 6480464 Manganese promotes the reaction [PRKCD protein binds to SLC1A5 protein] CTD PMID:21812036 Slc1a5 Mouse manganese(0) multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA CTD PMID:39836092 Slc1a5 Mouse manganese(II) chloride multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA CTD PMID:39836092 Slc1a5 Mouse methylmercury chloride increases expression ISO SLC1A5 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SLC1A5 mRNA CTD PMID:28001369 Slc1a5 Mouse mitomycin C decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Mitomycin results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Mouse N(4)-hydroxycytidine decreases expression EXP 6480464 N(4)-hydroxycytidine results in decreased expression of SLC1A5 mRNA CTD PMID:37748715 Slc1a5 Mouse N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [lobetyolin results in decreased expression of SLC1A5 protein] CTD PMID:34075790 Slc1a5 Mouse N-methyl-4-phenylpyridinium increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SLC1A5 mRNA CTD PMID:28801915 Slc1a5 Mouse N-nitrosodiethylamine multiple interactions ISO Slc1a5 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of SLC1A5 mRNA CTD PMID:20360939 Slc1a5 Mouse nickel atom multiple interactions EXP 6480464 [Nickel co-treated with NGF protein] results in increased expression of SLC1A5 mRNA CTD PMID:20600679 Slc1a5 Mouse Nonylphenol increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 nonylphenol results in increased expression of SLC1A5 mRNA CTD PMID:17010207 Slc1a5 Mouse ochratoxin A decreases expression ISO SLC1A5 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of SLC1A5 mRNA CTD PMID:30559759 Slc1a5 Mouse okadaic acid increases expression ISO SLC1A5 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of SLC1A5 mRNA and Okadaic Acid results in increased expression of SLC1A5 protein CTD PMID:38832940 Slc1a5 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of SLC1A5 mRNA CTD PMID:34911549 Slc1a5 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of SLC1A5 mRNA CTD PMID:17562736 Slc1a5 Mouse paracetamol increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of SLC1A5 mRNA CTD PMID:33387578 Slc1a5 Mouse paracetamol increases expression ISO SLC1A5 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SLC1A5 mRNA CTD PMID:29067470 Slc1a5 Mouse paraquat multiple interactions EXP 6480464 [Maneb co-treated with Paraquat] results in decreased expression of SLC1A5 mRNA CTD PMID:36117858 Slc1a5 Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Slc1a5 Mouse pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of SLC1A5 mRNA CTD PMID:23892564 Slc1a5 Mouse perfluorohexanesulfonic acid decreases expression EXP 6480464 perfluorohexanesulfonic acid results in decreased expression of SLC1A5 mRNA CTD PMID:37995155 Slc1a5 Mouse perfluorohexanesulfonic acid increases splicing EXP 6480464 perfluorohexanesulfonic acid results in increased splicing of SLC1A5 mRNA CTD PMID:37995155 Slc1a5 Mouse perfluorononanoic acid increases expression ISO SLC1A5 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of SLC1A5 mRNA CTD PMID:32588087 Slc1a5 Mouse perfluorooctane-1-sulfonic acid increases expression ISO SLC1A5 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of SLC1A5 mRNA CTD PMID:32588087 and PMID:36864359 Slc1a5 Mouse phenethyl caffeate multiple interactions ISO Slc1a5 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of SLC1A5 mRNA CTD PMID:20360939 Slc1a5 Mouse phenobarbital multiple interactions EXP 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of SLC1A5 mRNA] CTD PMID:19482888 Slc1a5 Mouse phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of SLC1A5 mRNA CTD PMID:19482888 Slc1a5 Mouse phorbol 13-acetate 12-myristate decreases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Tetradecanoylphorbol Acetate results in decreased expression of SLC1A5 protein CTD PMID:21812036 Slc1a5 Mouse resveratrol increases expression ISO SLC1A5 (Homo sapiens) 6480464 resveratrol results in increased expression of SLC1A5 mRNA CTD PMID:19371625 Slc1a5 Mouse S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO SLC1A5 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of SLC1A5 mRNA CTD PMID:33725128 Slc1a5 Mouse SB 431542 multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of SLC1A5 protein CTD PMID:37664457 Slc1a5 Mouse serpentine asbestos increases expression ISO SLC1A5 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of SLC1A5 mRNA CTD PMID:29523930 Slc1a5 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of SLC1A5 mRNA CTD PMID:31170414 Slc1a5 Mouse sodium arsenite multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA more ... CTD PMID:33781819 and PMID:39836092 Slc1a5 Mouse sodium arsenite increases expression ISO SLC1A5 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SLC1A5 mRNA and sodium arsenite results in increased expression of SLC1A5 protein CTD PMID:33781819 and PMID:38568856 Slc1a5 Mouse sodium chloride multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of SLC1A5 protein more ... CTD PMID:38598786 Slc1a5 Mouse sulforaphane increases expression ISO SLC1A5 (Homo sapiens) 6480464 sulforaphane results in increased expression of SLC1A5 mRNA CTD PMID:31838189 Slc1a5 Mouse sunitinib increases expression ISO SLC1A5 (Homo sapiens) 6480464 Sunitinib results in increased expression of SLC1A5 mRNA CTD PMID:31533062 Slc1a5 Mouse T-2 toxin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of SLC1A5 mRNA CTD PMID:31863870 Slc1a5 Mouse tamoxifen increases expression EXP 6480464 Tamoxifen results in increased expression of SLC1A5 mRNA CTD PMID:25123088 Slc1a5 Mouse tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of SLC1A5 mRNA CTD PMID:17484886 Slc1a5 Mouse thiazoles multiple interactions ISO Slc1a5 (Rattus norvegicus) 6480464 Dithioerythritol inhibits the reaction [Thiazoles analog results in decreased activity of SLC1A5 protein] CTD PMID:23010140 Slc1a5 Mouse thiazoles decreases activity ISO Slc1a5 (Rattus norvegicus) 6480464 Thiazoles analog results in decreased activity of SLC1A5 protein CTD PMID:23010140 Slc1a5 Mouse thioacetamide increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of SLC1A5 mRNA CTD PMID:23411599 and PMID:34492290 Slc1a5 Mouse thiram increases expression ISO SLC1A5 (Homo sapiens) 6480464 Thiram results in increased expression of SLC1A5 mRNA CTD PMID:38568856 Slc1a5 Mouse titanium dioxide decreases expression ISO SLC1A5 (Homo sapiens) 6480464 titanium dioxide results in decreased expression of SLC1A5 protein CTD PMID:30910687 Slc1a5 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of SLC1A5 gene CTD PMID:35295148 Slc1a5 Mouse tolcapone affects binding ISO Slc1a5 (Rattus norvegicus) 6480464 tolcapone binds to SLC1A5 protein CTD PMID:19783845 Slc1a5 Mouse tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of SLC1A5 mRNA CTD PMID:24848799 Slc1a5 Mouse trichloroethene increases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of SLC1A5 mRNA CTD PMID:33387578 Slc1a5 Mouse Triptolide increases expression EXP 6480464 triptolide results in increased expression of SLC1A5 mRNA CTD PMID:32835833 Slc1a5 Mouse trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of SLC1A5 mRNA CTD PMID:35537566 Slc1a5 Mouse tunicamycin increases expression ISO SLC1A5 (Homo sapiens) 6480464 Tunicamycin results in increased expression of SLC1A5 mRNA CTD PMID:29453283 Slc1a5 Mouse valproic acid increases methylation ISO SLC1A5 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SLC1A5 gene CTD PMID:29154799 Slc1a5 Mouse valproic acid multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 Valproic Acid promotes the reaction [Colforsin results in decreased expression of SLC1A5 protein] CTD PMID:37385477 Slc1a5 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of SLC1A5 mRNA CTD PMID:17963808 Slc1a5 Mouse XL147 multiple interactions EXP 6480464 XL147 inhibits the reaction [N-nitroso-tris-chloroethylurea results in increased expression of SLC1A5 mRNA] CTD PMID:29891994 Slc1a5 Mouse zearalenone increases expression ISO SLC1A5 (Homo sapiens) 6480464 Zearalenone results in increased expression of SLC1A5 mRNA CTD PMID:19371625 Slc1a5 Mouse zearalenone decreases expression ISO Slc1a5 (Rattus norvegicus) 6480464 Zearalenone results in decreased expression of SLC1A5 mRNA and Zearalenone results in decreased expression of SLC1A5 protein CTD PMID:32858132 Slc1a5 Mouse zidovudine multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of SLC1A5 mRNA CTD PMID:15784690 Slc1a5 Mouse zinc dichloride decreases expression ISO SLC1A5 (Homo sapiens) 6480464 zinc chloride results in decreased expression of SLC1A5 mRNA CTD PMID:18947441 Slc1a5 Mouse zoledronic acid decreases expression ISO SLC1A5 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of SLC1A5 mRNA CTD PMID:25596134
Imported Annotations - SMPDB
(-)-alpha-phellandrene (ISO) (S)-colchicine (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (EXP) 1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (ISO) 2-bromohexadecanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) acetamide (ISO) acrylamide (ISO) adenine (ISO) aflatoxin B1 (ISO) alpha-phellandrene (ISO) ammonium chloride (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) Bardoxolone methyl (ISO) beauvericin (ISO) benzo[a]pyrene (EXP,ISO) benzoates (ISO) beta-naphthoflavone (ISO) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) Butylbenzyl phthalate (EXP) cadmium atom (EXP,ISO) cadmium dichloride (ISO) caffeine (ISO) calcium silicate (EXP) cefaloridine (ISO) chloroacetaldehyde (ISO) chloropicrin (ISO) chlorpromazine (ISO) chlorpyrifos (EXP,ISO) choline (EXP) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) cobalt dichloride (ISO) colforsin daropate hydrochloride (ISO) copper atom (ISO) copper(0) (ISO) corosolic acid (ISO) coumarin (ISO) crocidolite asbestos (EXP) Cuprizon (ISO) cyclosporin A (ISO) deoxynivalenol (ISO) dexamethasone (EXP) dextran sulfate (EXP) Di-n-octyl phthalate (EXP) diazinon (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dieldrin (EXP) diethyl phthalate (EXP) Diisodecyl phthalate (EXP) diisononyl phthalate (EXP) dioxygen (ISO) disodium selenite (ISO) dithioerythritol (ISO) doxorubicin (ISO) endosulfan (ISO) enniatin (ISO) enzyme inhibitor (ISO) erianin (EXP) ethanol (EXP,ISO) etoposide (ISO) folic acid (EXP) formaldehyde (EXP) FR900359 (ISO) furfural (ISO) genistein (ISO) gentamycin (ISO) GSK-J4 (ISO) hydroxyurea (ISO) ifosfamide (ISO) Indeno[1,2,3-cd]pyrene (EXP) ivermectin (ISO) L-methionine (EXP) lamivudine (ISO) lipopolysaccharide (EXP,ISO) Lobetyolin (ISO) maneb (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methylmercury chloride (ISO) mitomycin C (ISO) N(4)-hydroxycytidine (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (ISO) nickel atom (EXP) Nonylphenol (ISO) ochratoxin A (ISO) okadaic acid (ISO) ozone (EXP) paracetamol (EXP,ISO) paraquat (EXP) PCB138 (EXP) pentachlorophenol (EXP) perfluorohexanesulfonic acid (EXP) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenethyl caffeate (ISO) phenobarbital (EXP) phorbol 13-acetate 12-myristate (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) serpentine asbestos (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sulforaphane (ISO) sunitinib (ISO) T-2 toxin (ISO) tamoxifen (EXP) tetrachloromethane (EXP) thiazoles (ISO) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP,ISO) tolcapone (ISO) tributylstannane (EXP) trichloroethene (ISO) Triptolide (EXP) trovafloxacin (EXP) tunicamycin (ISO) valproic acid (EXP,ISO) XL147 (EXP) zearalenone (ISO) zidovudine (ISO) zinc dichloride (ISO) zoledronic acid (ISO)
1.
Tissue-based metabolomics reveals metabolic biomarkers and potential therapeutic targets for esophageal squamous cell carcinoma.
Chen Z, etal., J Pharm Biomed Anal. 2021 Apr 15;197:113937. doi: 10.1016/j.jpba.2021.113937. Epub 2021 Feb 5.
2.
Clinicopathological significance of LAT1 and ASCT2 in patients with surgically resected esophageal squamous cell carcinoma.
Honjo H, etal., J Surg Oncol. 2016 Mar;113(4):381-9. doi: 10.1002/jso.24160. Epub 2016 Mar 3.
3.
MGDs mouse GO annotations
MGD data from the GO Consortium
4.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.
Cardiac glutaminolysis: a maladaptive cancer metabolism pathway in the right ventricle in pulmonary hypertension.
Piao L, etal., J Mol Med (Berl). 2013 Oct;91(10):1185-97. doi: 10.1007/s00109-013-1064-7. Epub 2013 Jun 21.
6.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Prognostic significance of amino-acid transporter expression (LAT1, ASCT2, and xCT) in surgically resected tongue cancer.
Toyoda M, etal., Br J Cancer. 2014 May 13;110(10):2506-13. doi: 10.1038/bjc.2014.178. Epub 2014 Apr 24.
9.
Clinical significance of coexpression of L-type amino acid transporter 1 (LAT1) and ASC amino acid transporter 2 (ASCT2) in lung adenocarcinoma.
Yazawa T, etal., Am J Transl Res. 2015 Jun 15;7(6):1126-39. eCollection 2015.
Slc1a5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 16,515,259 - 16,532,199 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 16,515,265 - 16,532,199 (+) Ensembl GRCm39 Ensembl GRCm38 7 16,781,334 - 16,798,274 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 16,781,340 - 16,798,274 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 17,366,695 - 17,383,623 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 15,939,929 - 15,956,765 (+) NCBI MGSCv36 mm8 Celera 7 13,979,416 - 13,996,329 (+) NCBI Celera Cytogenetic Map 7 A2 NCBI cM Map 7 9.15 NCBI
SLC1A5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 46,774,883 - 46,788,594 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 46,774,883 - 46,788,594 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 47,278,140 - 47,291,851 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 51,969,980 - 51,983,653 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 51,969,981 - 51,983,653 NCBI Celera 19 44,082,395 - 44,096,097 (-) NCBI Celera Cytogenetic Map 19 q13.32 NCBI HuRef 19 43,702,915 - 43,716,958 (-) NCBI HuRef CHM1_1 19 47,280,017 - 47,293,715 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 49,600,712 - 49,614,415 (-) NCBI T2T-CHM13v2.0
Slc1a5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 86,584,949 - 86,599,052 (+) NCBI GRCr8 mRatBN7.2 1 77,456,849 - 77,470,952 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 77,456,694 - 77,470,952 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 82,837,237 - 82,851,346 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 91,401,281 - 91,415,390 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 84,592,328 - 84,606,437 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 78,710,686 - 78,724,789 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 78,710,539 - 78,724,794 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 79,957,648 - 79,971,751 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 77,111,082 - 77,125,166 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 77,189,192 - 77,203,276 (+) NCBI Celera 1 71,941,916 - 71,956,019 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
Slc1a5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955574 798,004 - 806,631 (-) NCBI ChiLan1.0 ChiLan1.0
SLC1A5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 52,922,399 - 52,939,392 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 54,793,572 - 54,807,596 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 43,765,001 - 43,778,981 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 52,294,052 - 52,308,159 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 52,294,655 - 52,307,529 (-) Ensembl panpan1.1 panPan2
SLC1A5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 109,150,205 - 109,161,375 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 109,150,205 - 109,161,141 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 108,630,028 - 108,640,938 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 109,676,678 - 109,687,827 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 109,676,206 - 109,688,731 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 109,353,817 - 109,364,724 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 108,988,004 - 108,998,931 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 109,856,686 - 109,867,593 (+) NCBI UU_Cfam_GSD_1.0
Slc1a5
SLC1A5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 52,647,438 - 52,661,459 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 52,647,432 - 52,661,464 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 48,026,660 - 48,032,162 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC1A5
Slc1a5
.
Predicted Target Of
Count of predictions: 1335 Count of miRNA genes: 680 Interacting mature miRNAs: 821 Transcripts: ENSMUST00000108496, ENSMUST00000127401, ENSMUST00000131664, ENSMUST00000134407, ENSMUST00000135817, ENSMUST00000141349, ENSMUST00000147814 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300722 Sle3_m systemic lupus erythmatosus susceptibility 3 (mouse) Not determined 7 3511728 87142720 Mouse 25314307 Mlh1fc2_m MLH1 foci count 2 (mouse) 7 6502999 133501729 Mouse 4141566 Femwf8_m femur work to failure 8 (mouse) Not determined 13032485 47032621 Mouse 38501068 Tip1_m tuberculosis immunophenotype 1, spleen CFU (mouse) 7 3602999 72549748 Mouse 1301115 Lrdm1_m lymphoproliferation (Fas) renal disease modifier 1 (mouse) Not determined 7 3352048 24879418 Mouse 25314314 Sccor1_m synaptonemal complex length to mean MLH1 count ratio 1 (mouse) 7 13333925 47349748 Mouse 12904941 Edlmmq6_m extensor digitorum longus muscle mass QTL 6 (mouse) 7 1 21821047 Mouse 1301177 Vent3_m ventricular size 3 (mouse) Not determined 7 1 20511925 Mouse 10054067 Sle20_m systematic lupus erythematosus susceptibility 20 (mouse) Not determined 7 1 20511925 Mouse 25394569 Skmw57_m skeletal muscle weight 57, gastroc (mouse) 7 4580469 16687861 Mouse 10449139 Eosn1_m eosinophil differential 1 (mouse) 7 12480877 46480877 Mouse 12904948 Tammq5_m tibialis anterior muscle mass QTL 5 (mouse) 7 1 21821047 Mouse 1302115 Abhr3_m allergen-induced bronchial hyperresponsiveness 3 (mouse) Not determined 7 3315996 16637423 Mouse 11522751 Cocia17_m cocaine-induced activity, QTL 17 (mouse) 7 13135204 47135204 Mouse 12792978 Fbmd3_m femoral bone mineral density 3, females only (mouse) 7 7050288 142367832 Mouse 1301572 Sluc30_m susceptibility to lung cancer 30 (mouse) Not determined 7 2431696 36431844 Mouse 1357699 Nhdlq6_m non-HDL QTL 6 (mouse) Not determined 7 9988867 43988984 Mouse 10449158 Eosn3_m eosinophil differential 3 (mouse) 7 12480877 46480877 Mouse 1558893 Spir1_m Streptococcus pneumoniae infection resistance 1 (mouse) Not determined 7 10305798 44305936 Mouse 12904953 Gmmq5_m gastrocnemius muscle mass QTL 5 (mouse) 7 1 21821047 Mouse 1302188 Lxw6_m lupus BXSB x NZW 6 (mouse) Not determined 7 1 21698146 Mouse
BB222471
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 7 16,790,315 - 16,790,462 UniSTS GRCm38 MGSCv37 7 17,375,664 - 17,375,811 UniSTS GRCm37 Celera 7 13,988,366 - 13,988,513 UniSTS Cytogenetic Map 7 A2 UniSTS Whitehead/MRC_RH 7 203.98 UniSTS
UniSTS:235608
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 7 16,797,829 - 16,798,263 UniSTS GRCm38 MGSCv37 7 17,383,178 - 17,383,612 UniSTS GRCm37 Celera 7 13,995,884 - 13,996,318 UniSTS Cytogenetic Map 7 A2 UniSTS
Slc1a5
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 7 A2 UniSTS cM Map 7 9.15 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000108496 ⟹ ENSMUSP00000104136
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 16,515,265 - 16,532,199 (+) Ensembl GRCm38.p6 Ensembl 7 16,781,340 - 16,798,274 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000127401
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 16,515,293 - 16,532,199 (+) Ensembl GRCm38.p6 Ensembl 7 16,781,368 - 16,798,274 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000131664
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 16,519,591 - 16,521,093 (+) Ensembl GRCm38.p6 Ensembl 7 16,785,666 - 16,787,168 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000134407
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 16,526,952 - 16,530,084 (+) Ensembl GRCm38.p6 Ensembl 7 16,793,027 - 16,796,159 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000135817
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 16,518,663 - 16,527,631 (+) Ensembl GRCm38.p6 Ensembl 7 16,784,738 - 16,793,706 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000141349
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 16,527,102 - 16,529,868 (+) Ensembl GRCm38.p6 Ensembl 7 16,793,177 - 16,795,943 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000147814
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 16,520,296 - 16,527,721 (+) Ensembl GRCm38.p6 Ensembl 7 16,786,371 - 16,793,796 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000206444
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 16,516,323 - 16,521,104 (+) Ensembl GRCm38.p6 Ensembl 7 16,782,398 - 16,787,179 (+) Ensembl
RefSeq Acc Id:
NM_009201 ⟹ NP_033227
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 16,515,271 - 16,532,199 (+) NCBI GRCm38 7 16,781,346 - 16,798,274 (+) NCBI MGSCv37 7 17,366,695 - 17,383,623 (+) RGD Celera 7 13,979,416 - 13,996,329 (+) RGD cM Map 7 ENTREZGENE
Sequence:
GGTCGCTTCCGTCTAGCAGCCTCAGAGACACGCGGCGCGGCCTGGGAGGTTTCTCCTTGGCGCCACTTTCCATATCCCCCGGGCTGCTTCCTATTTGCATCTGGAAATTTGATTTTTCTCTCCAGAGC
hide sequence
RefSeq Acc Id:
XM_006539695 ⟹ XP_006539758
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 16,515,259 - 16,532,168 (+) NCBI GRCm38 7 16,781,345 - 16,798,243 (+) NCBI
Sequence:
GCCTTTAATCCTGGTCGCTTCCGTCTAGCAGCCTCAGAGACACGCGGCGCGGCCTGGGAGGTTTCTCCTTGGCGCCACTTTCCATATCCCCCGGGCTGCTTCCTATTTGCATCTGGAAATTTGATTTT
hide sequence
RefSeq Acc Id:
XR_391052
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 16,515,259 - 16,532,177 (+) NCBI GRCm38 7 16,781,334 - 16,798,243 (+) NCBI
Sequence:
GCCTTTAATCCTGGTCGCTTCCGTCTAGCAGCCTCAGAGACACGCGGCGCGGCCTGGGAGGTTT
hide sequence
RefSeq Acc Id:
NP_033227 ⟸ NM_009201
- UniProtKB:
Q3UFR4 (UniProtKB/TrEMBL), Q9ESU7 (UniProtKB/TrEMBL)
- Sequence:
MAVDPPKADPKGVVAVDSTANGGPALGSREDQSAKAGGCCGSRDRVRRCIRANLLVLLTVAAVVAGVGLGLGVSAAGGADALGPARLTAFAFPGELLLRLLKMIILPLVVCSLIGGAASLDPSALGRV
hide sequence
RefSeq Acc Id:
XP_006539758 ⟸ XM_006539695
- Peptide Label:
isoform X1
- Sequence:
MNPKTTHVKYRNPVSSGRSIQPWSRYAPVGILFLVASKIVEMKDVRQLFISLGKYILCCLLGHA
hide sequence
Ensembl Acc Id:
ENSMUSP00000104136 ⟸ ENSMUST00000108496
RGD ID: 6891938 Promoter ID: EPDNEW_M9420 Type: multiple initiation site Name: Slc1a5_1 Description: Mus musculus solute carrier family 1 , member 5 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 7 16,781,369 - 16,781,429 EPDNEW
RGD ID: 6842040 Promoter ID: MM_KWN:48922 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000065232, NM_009201, OTTMUST00000052917 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 17,365,706 - 17,367,737 (+) MPROMDB
RGD ID: 6842041 Promoter ID: MM_KWN:48923 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Kidney, Lung Transcripts: OTTMUST00000052918 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 17,369,126 - 17,370,102 (+) MPROMDB
RGD ID: 6842039 Promoter ID: MM_KWN:48924 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, ES_Cell Transcripts: OTTMUST00000052919 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 17,370,021 - 17,371,062 (+) MPROMDB
RGD ID: 6842045 Promoter ID: MM_KWN:48925 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, Lung Transcripts: OTTMUST00000052920 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 17,370,831 - 17,372,117 (+) MPROMDB
RGD ID: 6842043 Promoter ID: MM_KWN:48926 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, Kidney, Lung Transcripts: OTTMUST00000052921, OTTMUST00000052922 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 17,377,441 - 17,379,222 (+) MPROMDB
