Advanced Search (OLGA)

Gene: RPL5 (ribosomal protein L5) Sus scrofa

Subscribe to Updates

Analyze

Symbol:

RPL5

Name:

ribosomal protein L5

RGD ID:

14238667

Description:

ENCODES a protein that exhibits 5S rRNA binding (ortholog); mRNA 3'-UTR binding (ortholog); mRNA 5'-UTR binding (ortholog); INVOLVED IN negative regulation of protein neddylation (ortholog); negative regulation of ubiquitin protein ligase activity (ortholog); negative regulation of ubiquitin-dependent protein catabolic process (ortholog); PARTICIPATES IN p53 signaling pathway; ribosome biogenesis pathway; translation pathway; ASSOCIATED WITH aplastic anemia (ortholog); congenital hypoplastic anemia (ortholog); Diamond-Blackfan anemia (ortholog); FOUND IN aminoacyl-tRNA synthetase multienzyme complex (ortholog); cytoplasm (ortholog); cytosol (ortholog)

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

60S ribosomal protein L5; large ribosomal subunit protein uL18

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPL5 (ribosomal protein L5)	HGNC	EggNOG, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Rpl5 (ribosomal protein L5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Rpl5 (ribosomal protein L5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpl5 (ribosomal protein L5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPL5 (ribosomal protein L5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPL5 (ribosomal protein L5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpl5 (ribosomal protein L5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPL5 (ribosomal protein L5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpl5 (ribosomal protein L5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

Sscrofa11.1 - Pig Sscrofa11.1 Assembly

Position:

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	124,358,594 - 124,367,645 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	124,359,786 - 124,367,612 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	135,982,736 - 135,990,562 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RPL5	Pig	glioblastoma		ISO	RPL5 (Homo sapiens)	9068941	DNA:mutations:multiple (human)	RGD	PMID:26892688 and REF_RGD_ID:11535147
RPL5	Pig	T-cell acute lymphoblastic leukemia		ISO	RPL5 (Homo sapiens)	9068941	DNA:snps more ...	RGD	PMID:23263491 and REF_RGD_ID:11535135

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RPL5	Pig	aplastic anemia		ISO	RPL5 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Aplastic anemia	ClinVar	PMID:25741868
RPL5	Pig	congenital hypoplastic anemia		ISO	RPL5 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital hypoplastic anemia	ClinVar	PMID:20054847 more ...
RPL5	Pig	Diamond-Blackfan anemia		ISO	RPL5 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:16199547 more ...
RPL5	Pig	Diamond-Blackfan anemia 1		ISO	RPL5 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Diamond-Blackfan anemia 1	ClinVar	PMID:19061985 more ...
RPL5	Pig	Diamond-Blackfan anemia 6		ISO	RPL5 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Diamond-Blackfan anemia 6	ClinVar	PMID:16199547 more ...
RPL5	Pig	genetic disease		ISO	RPL5 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar
RPL5	Pig	severe congenital neutropenia 2		ISO	RPL5 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neutropenia more ...	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RPL5	Pig	ovarian cyst		ISO	RPL5 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:21239663
RPL5	Pig	T-cell acute lymphoblastic leukemia		ISO	RPL5 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:23263491

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RPL5	Pig	Diamond-Blackfan anemia 6		ISO	RPL5 (Homo sapiens)	7240710		OMIM

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RPL5	Pig	negative regulation of protein neddylation	involved_in	ISO	RPL5 (Homo sapiens)	9068941	PMID:18560357	CAFA	PMID:18560357
RPL5	Pig	negative regulation of ubiquitin protein ligase activity	involved_in	ISO	RPL5 (Homo sapiens)	9068941	PMID:18560357	CAFA	PMID:18560357
RPL5	Pig	negative regulation of ubiquitin-dependent protein catabolic process	involved_in	ISO	RPL5 (Homo sapiens)	9068941	PMID:18560357	CAFA	PMID:18560357
RPL5	Pig	positive regulation of gene expression	involved_in	ISO	RPL5 (Homo sapiens)	9068941	PMID:18560357	CAFA	PMID:18560357
RPL5	Pig	positive regulation of phosphatase activity		ISO	Rpl5 (Rattus norvegicus)	9068941		RGD	PMID:7649987 and REF_RGD_ID:2316860
RPL5	Pig	positive regulation of translation	involved_in	ISO	RPL5 (Homo sapiens)	9068941	PMID:16213212	CAFA	PMID:16213212
RPL5	Pig	protein stabilization	involved_in	ISO	RPL5 (Homo sapiens)	9068941	PMID:18560357	CAFA	PMID:18560357
RPL5	Pig	regulation of signal transduction by p53 class mediator	involved_in	ISO	RPL5 (Homo sapiens)	9068941	PMID:24120868	UniProt	PMID:24120868
RPL5	Pig	ribosomal large subunit assembly	involved_in	IBA	PANTHER:PTN000601661 more ...	150520179		GO_Central	GO_REF:0000033
RPL5	Pig	ribosomal large subunit biogenesis	involved_in	ISO	RPL5 (Homo sapiens)	9068941	PMID:18697920	UniProt	PMID:18697920
RPL5	Pig	rRNA processing	involved_in	ISO	RPL5 (Homo sapiens)	9068941	PMID:18697920	UniProt	PMID:18697920
RPL5	Pig	translation	involved_in	IEA	InterPro:IPR005485	150520179		InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RPL5	Pig	aminoacyl-tRNA synthetase multienzyme complex		ISO	Rpl5 (Rattus norvegicus)	9068941		RGD	PMID:8982850 and REF_RGD_ID:2316859
RPL5	Pig	cytoplasm	located_in	ISS	UniProtKB:P46777	150520179		UniProt	GO_REF:0000024
RPL5	Pig	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	150520179		UniProt	GO_REF:0000044
RPL5	Pig	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043
RPL5	Pig	cytosol	located_in	ISO	RPL5 (Homo sapiens)	9068941		HPA	GO_REF:0000052
RPL5	Pig	cytosolic large ribosomal subunit		ISO	Rpl5 (Rattus norvegicus)	9068941		RGD	PMID:3988767 and REF_RGD_ID:11035230
RPL5	Pig	cytosolic large ribosomal subunit	part_of	IBA	MGI:102854 more ...	150520179		GO_Central	GO_REF:0000033
RPL5	Pig	cytosolic ribosome		ISO	Rpl5 (Rattus norvegicus)	9068941		RGD	PMID:3733691 and REF_RGD_ID:11035229
RPL5	Pig	cytosolic ribosome	located_in	IEA	ARBA:ARBA00026577	150520179		UniProt	GO_REF:0000117
RPL5	Pig	cytosolic ribosome	part_of	ISO	RPL5 (Homo sapiens)	9068941	PMID:23636399	FlyBase	PMID:23636399
RPL5	Pig	endoplasmic reticulum	located_in	ISO	RPL5 (Homo sapiens)	9068941		HPA	GO_REF:0000052
RPL5	Pig	nucleolus	located_in	ISS	UniProtKB:P46777	150520179		UniProt	GO_REF:0000024
RPL5	Pig	nucleolus	located_in	IEA	UniProtKB-SubCell:SL-0188	150520179		UniProt	GO_REF:0000044
RPL5	Pig	nucleoplasm	located_in	ISO	RPL5 (Homo sapiens)	9068941	PMID:24120868	UniProt	PMID:24120868
RPL5	Pig	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043
RPL5	Pig	postsynaptic density	is_active_in	ISO	Rpl5 (Rattus norvegicus)	9068941	PMID:15020595	SynGO	PMID:15020595 and REF_RGD_ID:13702264
RPL5	Pig	protein-containing complex	part_of	ISO	RPL5 (Homo sapiens)	9068941	PMID:15314173	CAFA	PMID:15314173
RPL5	Pig	ribonucleoprotein complex	part_of	IEA	UniProtKB-KW:KW-0687	150520179		UniProt	GO_REF:0000043
RPL5	Pig	ribonucleoprotein complex		ISO	Rpl5 (Rattus norvegicus)	9068941		RGD	PMID:1665486 more ...
RPL5	Pig	ribosome	located_in	IEA	InterPro:IPR005485	150520179		InterPro	GO_REF:0000002
RPL5	Pig	ribosome	located_in	IEA	UniProtKB-KW:KW-0689	150520179		UniProt	GO_REF:0000043
RPL5	Pig	synapse	is_active_in	ISO	Rpl5 (Mus musculus)	9068941	PMID:16635246 and PMID:25211037	SynGO	PMID:16635246 and PMID:25211037

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RPL5	Pig	5S rRNA binding		ISO	Rpl5 (Rattus norvegicus)	9068941		RGD	PMID:6430881 and REF_RGD_ID:11039444
RPL5	Pig	5S rRNA binding	enables	IBA	PANTHER:PTN000601661 more ...	150520179		GO_Central	GO_REF:0000033
RPL5	Pig	5S rRNA binding	enables	IEA	InterPro:IPR005485	150520179		InterPro	GO_REF:0000002
RPL5	Pig	mRNA 3'-UTR binding	enables	ISO	RPL5 (Homo sapiens)	9068941	PMID:16213212	CAFA	PMID:16213212
RPL5	Pig	mRNA 5'-UTR binding	enables	ISO	RPL5 (Homo sapiens)	9068941	PMID:16213212	CAFA	PMID:16213212
RPL5	Pig	mRNA binding		ISO	Rpl5 (Rattus norvegicus)	9068941		RGD	PMID:7338522 and REF_RGD_ID:11040966
RPL5	Pig	protein binding	enables	ISO	UniProtKB:P63241	9068941	PMID:9465063	UniProt	PMID:9465063
RPL5	Pig	protein binding	enables	ISO	PR:Q61937	9068941	PMID:16648475	MGI	PMID:16648475
RPL5	Pig	protein binding	enables	ISO	UniProtKB:O42480 more ...	9068941	PMID:9687515	UniProt	PMID:9687515
RPL5	Pig	protein binding	enables	ISO	UniProtKB:P06748	9068941	PMID:16648475	UniProt	PMID:16648475
RPL5	Pig	protein binding	enables	ISO	UniProtKB:O15381	9068941	PMID:15469983	UniProt	PMID:15469983
RPL5	Pig	protein binding	enables	ISO	UniProtKB:Q15527	9068941	PMID:21900206 more ...	IntAct	PMID:21900206 more ...
RPL5	Pig	protein binding	enables	ISO	UniProtKB:P62829	9068941	PMID:30021884	IntAct	PMID:30021884
RPL5	Pig	protein binding	enables	ISO	UniProtKB:P43146 more ...	9068941	PMID:20434207	IntAct	PMID:20434207
RPL5	Pig	protein binding	enables	ISO	UniProtKB:P62142	9068941	PMID:7649987	IntAct	PMID:7649987 and REF_RGD_ID:2316860
RPL5	Pig	protein binding	enables	ISO	UniProtKB:P62266 more ...	9068941	PMID:35271311	IntAct	PMID:35271311
RPL5	Pig	protein binding	enables	ISO	UniProtKB:P23804	9068941	PMID:17936560 more ...	IntAct	PMID:17936560 more ...
RPL5	Pig	protein binding	enables	ISO	UniProtKB:Q53EL6	9068941	PMID:12054647	UniProt	PMID:12054647
RPL5	Pig	protein binding	enables	ISO	UniProtKB:Q14684	9068941	PMID:20926688	IntAct	PMID:20926688
RPL5	Pig	protein binding	enables	ISO	UniProtKB:P62829 more ...	9068941	PMID:15314173	CAFA	PMID:15314173
RPL5	Pig	protein binding	enables	ISO	UniProtKB:Q00987	9068941	PMID:17110929 more ...	IntAct	PMID:17110929 more ...
RPL5	Pig	protein binding	enables	ISO	UniProtKB:P62913 and UniProtKB:Q00987	9068941	PMID:18560357	CAFA	PMID:18560357
RPL5	Pig	RNA binding	enables	IEA	UniProtKB-KW:KW-0694	150520179		UniProt	GO_REF:0000043
RPL5	Pig	rRNA binding	enables	IEA	UniProtKB-KW:KW-0699	150520179		UniProt	GO_REF:0000043
RPL5	Pig	structural constituent of ribosome	enables	IEA	InterPro:IPR005485	150520179		InterPro	GO_REF:0000002
RPL5	Pig	structural constituent of ribosome	enables	IBA	FB:FBgn0064225 more ...	150520179		GO_Central	GO_REF:0000033
RPL5	Pig	ubiquitin ligase inhibitor activity	enables	ISO	RPL5 (Homo sapiens)	9068941	PMID:18560357	CAFA	PMID:18560357
RPL5	Pig	ubiquitin protein ligase binding	enables	ISO	UniProtKB:Q00987	9068941	PMID:18560357	CAFA	PMID:18560357

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RPL5	Pig	ribosome biogenesis pathway		ISO	RPL5 (Homo sapiens)	9068941		RGD	PMID:23636399 and REF_RGD_ID:10002762
RPL5	Pig	translation pathway		ISO	RPL5 (Homo sapiens)	9068941		RGD	PMID:23636399 and REF_RGD_ID:10002762

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RPL5	Pig	p53 signaling pathway		ISO	RPL5 (Homo sapiens)	9068941		PID	PID:200206

PMID:14681463	PMID:17145712	PMID:22301074	PMID:30032202

RPL5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	124,358,594 - 124,367,645 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	124,359,786 - 124,367,612 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	135,982,736 - 135,990,562 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPL5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	92,831,986 - 92,841,924 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	92,832,013 - 92,841,924 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	93,297,543 - 93,307,481 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	93,070,182 - 93,080,069 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	93,009,630 - 93,019,501	NCBI
Celera	1	91,551,185 - 91,561,073 (+)	NCBI		Celera
Cytogenetic Map	1	p22.1	NCBI
HuRef	1	91,418,759 - 91,428,647 (+)	NCBI		HuRef
CHM1_1	1	93,412,392 - 93,422,277 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	92,677,128 - 92,687,066 (+)	NCBI		T2T-CHM13v2.0

Rpl5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	108,048,388 - 108,056,871 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	108,048,368 - 108,056,871 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	107,900,508 - 107,909,005 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	107,900,502 - 107,909,005 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	108,329,547 - 108,338,024 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	108,329,609 - 108,337,069 (+)	NCBI		MGSCv36	mm8
Celera	5	105,013,413 - 105,021,863 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	58.5	NCBI

Rpl5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	1,988,792 - 1,995,236 (-)	NCBI		GRCr8
mRatBN7.2	14	1,843,856 - 1,850,301 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	1,843,770 - 1,850,290 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	1,722,761 - 1,729,199 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	3,024,541 - 3,030,980 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	1,721,230 - 1,727,668 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	2,860,963 - 2,867,397 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	2,860,965 - 2,867,397 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	2,861,092 - 2,867,612 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	2,397,640 - 2,404,072 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	2,397,639 - 2,404,072 (-)	NCBI
Celera	14	1,863,797 - 1,870,229 (-)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

Rpl5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	1,748,809 - 1,758,622 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955423	1,748,809 - 1,758,622 (-)	NCBI	ChiLan1.0	ChiLan1.0

RPL5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	134,179,007 - 134,189,039 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	133,333,923 - 133,344,414 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	95,497,047 - 95,507,006 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	94,231,605 - 94,241,522 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	94,230,451 - 94,241,522 (+)	Ensembl	panpan1.1		panPan2

RPL5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	56,207,171 - 56,216,030 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	56,207,173 - 56,215,956 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	58,904,824 - 58,915,282 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	56,582,922 - 56,593,715 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	56,582,927 - 56,593,683 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	56,262,557 - 56,272,992 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	56,240,615 - 56,251,042 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	56,700,600 - 56,711,209 (-)	NCBI		UU_Cfam_GSD_1.0

Rpl5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	102,602,706 - 102,606,012 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936537	6,341,961 - 6,344,831 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPL5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	40,416,553 - 40,427,027 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	40,413,897 - 40,427,060 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	77,589,297 - 77,599,820 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpl5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624742	4,973,229 - 4,983,361 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in RPL5
343 total Variants

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	hemolymphoid system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
10	4	23	3	2	5	14	12	23	3	6	3


RefSeq Transcripts	NM_001114284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AEMK02000025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK237194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK350182	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK391704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK393844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK394513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK398700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CU305735	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU352798	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GFLN01039357	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSSSCT00000007554 ⟹ ENSSSCP00000007354

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	4	124,358,594 - 124,366,529 (-)	Ensembl

Ensembl Acc Id:

ENSSSCT00000040918 ⟹ ENSSSCP00000046769

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	4	124,358,594 - 124,367,645 (-)	Ensembl

Ensembl Acc Id:

ENSSSCT00000067358 ⟹ ENSSSCP00000067120

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	4	124,358,594 - 124,366,529 (-)	Ensembl

Ensembl Acc Id:

ENSSSCT00000085097 ⟹ ENSSSCP00000065449

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	4	124,358,594 - 124,367,645 (-)	Ensembl

RefSeq Acc Id:

NM_001114284 ⟹ NP_001107756

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1	4	124,359,786 - 124,367,612 (-)	NCBI

Sequence:

show sequence

GCTGCTCTGTGGCAAGCCGCCGATTGGGAGCTCTGTTCTGCAGGATGGGGTTTGTAAAAGTCGTCAAGAATAAGGCTTACTTCAAGAGGTACCAGGTGAAATTTAGAAGACGACGAGAGGGTAAAACT
GACTACTATGCCCGGAAACGATTGGTCATCCAAGATAAAAATAAGTATAACACACCAAAATACAGGATGATAGTTCGTGTAACCAACAGAGATATAATTTGTCAGATTGCTTATGCCCGTATAGAAGG
AGATATGATAGTTTGTGCAGCTTATGCTCACGAACTCCCAAAGTATGGCGTGAAGGTCGGCCTGACAAATTATGCTGCAGCTTATTGTACTGGCCTGCTGCTGGCCCGCAGGCTTCTTAATAGGTTTG
GTATGGACAAGATTTACGAAGGCCAGGTCGAGGTGACTGGAGATGAATACAATGTGGAAAGCATCGACGGTCAGCCTGGTGCCTTCACCTGTTACCTGGATGCAGGGCTTACCAGGACGACTACTGGA
AACAAAGTTTTTGGGGCCCTGAAGGGAGCCGTAGATGGAGGCCTGTCTATCCCTCACAGCACCAAACGATTCCCTGGTTATGATTCAGAAAGCAAAGAATTCAATGCTGAAGTGCACCGAAAGCACAT
CCTGGGGCAGAATGTTGCAGATTATATGCGTTACCTGATTGAAGAAGATGAGGATGCTTACAAGAAACAGTTCTCTCAGTACATAAAGAACAACGTGACTCCAGACATGATGGAGGAAATGTATAAGA
AAGCTCATGCTGCGATACGAGAGAATCCAGTGTATGAGAAGAAGCCTAAGAAAGAAGTTAAAAAGAAGAGGTGGAATCGTCCCAAAATGTCACTTGCCCAGAAGAAAGATCGGGTTGCTCAGAAGAAA
GCAAGCTTCCTTCGAGCTCAGGAACGGGCTGCTGAGAGCTAATAAACCAGGCCATAGTTTTTCTATGAAGATTTTTTCAAAGACATTAATAAATGTATCAATCAAGCCAAAAAAAAAAAAAAAAAAAA
AGAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001107756	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABY61325	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSSSCP00000046769
GenBank Protein	Q95276	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001107756 ⟸ NM_001114284

- UniProtKB:

B0FWK5 (UniProtKB/TrEMBL), A0A287ASD0 (UniProtKB/TrEMBL), A0A4X1U3L7 (UniProtKB/TrEMBL), A0A8D1QIY7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVTGD
EYNVESIDGQPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHILGQNVADYMRYLIEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVYEKK
PKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES

hide sequence

Ensembl Acc Id:

ENSSSCP00000046769 ⟸ ENSSSCT00000040918

Ensembl Acc Id:

ENSSSCP00000065449 ⟸ ENSSSCT00000085097

Ensembl Acc Id:

ENSSSCP00000007354 ⟸ ENSSSCT00000007554

Ensembl Acc Id:

ENSSSCP00000067120 ⟸ ENSSSCT00000067358

Protein Domains

Large ribosomal subunit protein uL18 C-terminal

Database	Acc Id	Source(s)
Ensembl Genes	ENSSSCG00000006899	Ensembl, ENTREZGENE
Ensembl Transcript	ENSSSCT00000040918	ENTREZGENE
Gene3D-CATH	3.30.420.100	UniProtKB/Swiss-Prot
InterPro	Rbsml_L5_euk/L18_arc	UniProtKB/Swiss-Prot
NCBI Gene	RPL5	ENTREZGENE
PANTHER	LARGE RIBOSOMAL SUBUNIT PROTEIN UL18	UniProtKB/Swiss-Prot
	PTHR23410	UniProtKB/Swiss-Prot
Pfam	Ribosomal_L5e	UniProtKB/Swiss-Prot
PRINTS	RIBOSOMALL5	UniProtKB/Swiss-Prot
Superfamily-SCOP	Translational machinery components	UniProtKB/Swiss-Prot
UniProt	A0A287ASD0	ENTREZGENE, UniProtKB/TrEMBL
	A0A4X1TYB5_PIG	UniProtKB/TrEMBL
	A0A4X1U3L7	ENTREZGENE
	A0A4X1U3N9_PIG	UniProtKB/TrEMBL
	A0A8D0MVZ5_PIG	UniProtKB/TrEMBL
	A0A8D1QIY7	ENTREZGENE, UniProtKB/TrEMBL
	B0FWK5	ENTREZGENE, UniProtKB/TrEMBL
	Q95276	ENTREZGENE, UniProtKB/Swiss-Prot
VGNC ID	VGNC:109640	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)