Symbol:
XK
Name:
X-linked Kx blood group antigen, Kell and VPS13A binding protein
RGD ID:
14214844
Description:
ENCODES a protein that exhibits protein-macromolecule adaptor activity (inferred); INVOLVED IN intracellular calcium ion homeostasis (ortholog); intracellular magnesium ion homeostasis (ortholog); myelination (ortholog); ASSOCIATED WITH autistic disorder (ortholog); disease of mental health (ortholog); genetic disease (ortholog); FOUND IN plasma membrane (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
membrane transport protein XK; X-linked Kx blood group; X-linked Kx blood group (McLeod syndrome)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
XK (X-linked Kx blood group antigen, Kell and VPS13A binding protein) HGNC
Ensembl, Inparanoid, NCBI, OrthoDB
Mus musculus (house mouse):
Xk (X-linked Kx blood group) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Xk (X-linked Kx blood group antigen, Kell and VPS13A binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Xk (X-linked Kx blood group antigen, Kell and VPS13A binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
XK (X-linked Kx blood group antigen, Kell and VPS13A binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
XK (X-linked Kx blood group antigen, Kell and VPS13A binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Xk (X-linked Kx blood group antigen, Kell and VPS13A binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
XK (X-linked Kx blood group antigen, Kell and VPS13A binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Xk (X-linked Kx blood group antigen, Kell and VPS13A binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
Sscrofa11.1 - Pig Sscrofa11.1 Assembly
Position:
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 33,544,731 - 33,602,574 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 33,544,287 - 33,602,576 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 37,205,690 - 37,263,628 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
JBrowse:
View Region in Genome Browser (JBrowse)
Model
XK Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 33,544,731 - 33,602,574 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 33,544,287 - 33,602,576 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 37,205,690 - 37,263,628 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
XK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 37,685,791 - 37,732,130 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 37,685,791 - 37,732,130 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 37,545,044 - 37,591,383 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 37,430,052 - 37,476,322 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 37,301,324 - 37,347,594 NCBI Celera X 41,682,795 - 41,729,061 (+) NCBI Celera Cytogenetic Map X p21.1 NCBI HuRef X 35,290,888 - 35,336,107 (+) NCBI HuRef CHM1_1 X 37,576,264 - 37,622,522 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 37,089,348 - 37,135,703 (+) NCBI T2T-CHM13v2.0
Xk Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 9,139,023 - 9,179,484 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 9,138,995 - 9,179,489 (+) Ensembl GRCm39 Ensembl GRCm38 X 9,272,784 - 9,313,245 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 9,272,756 - 9,313,250 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 8,849,910 - 8,890,371 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 8,429,873 - 8,468,132 (+) NCBI MGSCv36 mm8 Celera X 7,012,285 - 7,052,336 (+) NCBI Celera Cytogenetic Map X A1.1 NCBI cM Map X 4.22 NCBI
Xk Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 16,108,913 - 16,145,322 (-) NCBI GRCr8 mRatBN7.2 X 13,436,412 - 13,472,830 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 13,436,418 - 13,472,830 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 13,623,720 - 13,660,104 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 17,120,655 - 17,157,035 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 13,377,235 - 13,413,615 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 14,497,376 - 14,534,479 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 14,498,119 - 14,534,473 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 15,278,669 - 15,315,169 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 25,591,152 - 25,624,913 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 25,644,621 - 25,678,382 (-) NCBI Celera X 13,951,523 - 13,985,552 (+) NCBI Celera Cytogenetic Map X q12 NCBI
Xk Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955587 668,070 - 728,959 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955587 668,871 - 725,829 (+) NCBI ChiLan1.0 ChiLan1.0
XK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 39,334,500 - 39,381,063 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 39,337,936 - 39,384,437 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 30,136,046 - 30,182,541 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 37,846,539 - 37,892,348 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 37,846,539 - 37,892,348 (+) Ensembl panpan1.1 panPan2
XK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 32,453,404 - 32,498,145 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 32,453,570 - 32,495,110 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 19,801,126 - 19,845,752 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 32,491,214 - 32,543,437 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 32,491,295 - 32,540,402 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 32,578,961 - 32,624,840 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 32,544,040 - 32,588,642 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 32,592,018 - 32,636,881 (+) NCBI UU_Cfam_GSD_1.0
Xk Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 24,691,389 - 24,745,510 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936502 4,532,100 - 4,587,439 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936502 4,532,100 - 4,584,931 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
XK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666056 38,148,973 - 38,193,937 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Xk
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
10
4
23
3
2
5
13
12
23
2
6
3
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSSSCT00000065377 ⟹ ENSSSCP00000055669
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl X 33,544,730 - 33,599,834 (+) Ensembl
Ensembl Acc Id:
ENSSSCT00000065925 ⟹ ENSSSCP00000032000
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl X 33,544,731 - 33,602,574 (+) Ensembl
RefSeq Acc Id:
XM_003135014 ⟹ XP_003135062
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 X 33,544,287 - 33,602,576 (+) NCBI
Sequence:
AAAGCGTCTGTGTGGCCTGGTTATTTTTAGGTAACCGAAGACGCTGGCCCTTTGAGGAATGGGGCGTTCTCTAGGCCCGGGAAATAGACACTGGGCTGGAAAGGCATCCTGACCCCAACTCCGACCCC
hide sequence
RefSeq Acc Id:
XP_003135062 ⟸ XM_003135014
- UniProtKB:
A0A286ZKL8 (UniProtKB/TrEMBL), A0A4X1VJC2 (UniProtKB/TrEMBL), A0A8D0VNX5 (UniProtKB/TrEMBL), A0A8D1GTF7 (UniProtKB/TrEMBL)
- Sequence:
MKFPGSVLASVFLFVAETTTALYLSSTYRSRGDGMWQALTLLFSLLPCALVQLTLLFVHRDFSRDRPLVLLLHLLQLGPLFRCFEVFCIYCQSGRIEEPYVSITRKRQMPKNGLSEEIEKEVGQAEGK
hide sequence
Ensembl Acc Id:
ENSSSCP00000055669 ⟸ ENSSSCT00000065377
Ensembl Acc Id:
ENSSSCP00000032000 ⟸ ENSSSCT00000065925
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-07-19
XK
X-linked Kx blood group antigen, Kell and VPS13A binding protein
XK
X-linked Kx blood group
Symbol and/or name change
5135510 APPROVED
