Advanced Search (OLGA)

Gene: Ccdc107 (coiled-coil domain containing 107) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Ccdc107

Name:

coiled-coil domain containing 107

RGD ID:

13792742

MGI Page

MGI

Description:

Predicted to be located in membrane. Orthologous to human CCDC107 (coiled-coil domain containing 107).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1110032O22Rik; coiled-coil domain-containing protein 107; RIKEN cDNA 1110032O22 gene

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	43,493,365 - 43,495,921 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	43,492,900 - 43,495,921 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	43,493,340 - 43,495,921 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	43,492,900 - 43,495,921 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	43,506,269 - 43,508,792 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	43,514,497 - 43,517,020 (+)	NCBI		MGSCv36	mm8
Celera	4	43,527,417 - 43,529,940 (+)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	23.04	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccdc107	Mouse	acromesomelic dysplasia, Maroteaux type		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: Acromesomelic dysplasia 1, Maroteaux type	ClinVar	PMID:28492532
Ccdc107	Mouse	anauxetic dysplasia		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: Anauxetic dysplasia	ClinVar	PMID:10026268\|PMID:11207361\|PMID:11940090\|PMID:12107819\|PMID:12888988\|PMID:14569119\|PMID:16097009\|PMID:16254002\|PMID:16838329\|PMID:17701897\|PMID:18804272\|PMID:25741868\|PMID:28094436\|PMID:28492532\|PMID:8034306\|PMID:8444246\|PMID:9156319
Ccdc107	Mouse	anauxetic dysplasia 1		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: Spondylometaepiphyseal dysplasia Menger type	ClinVar	PMID:10026268\|PMID:11207361\|PMID:11940090\|PMID:12107819\|PMID:12888988\|PMID:14569119\|PMID:16097009\|PMID:16254002\|PMID:16838329\|PMID:17701897\|PMID:18804272\|PMID:25741868\|PMID:28094436\|PMID:28492532\|PMID:8034306\|PMID:8444246\|PMID:9156319
Ccdc107	Mouse	autosomal recessive distal hereditary motor neuronopathy 2		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: Autosomal recessive distal spinal muscular atrophy 2	ClinVar	PMID:28492532
Ccdc107	Mouse	cartilage-hair hypoplasia		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: Cartilage-hair hypoplasia	ClinVar	PMID:10026268\|PMID:11207361\|PMID:11940090\|PMID:12107819\|PMID:12888988\|PMID:14569119\|PMID:16097009\|PMID:16254002\|PMID:16838329\|PMID:17701897\|PMID:18804272\|PMID:25741868\|PMID:28094436\|PMID:28492532\|PMID:8034306\|PMID:8444246\|PMID:9156319
Ccdc107	Mouse	distal arthrogryposis type 1A		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: Arthrogryposis, distal, type 1A	ClinVar	PMID:28492532
Ccdc107	Mouse	frontotemporal dementia and/or amyotrophic lateral sclerosis 6		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: Frontotemporal dementia and/or amyotrophic lateral sclerosis 6	ClinVar	PMID:28492532
Ccdc107	Mouse	galactosemia		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: Deficiency of UDPglucose-hexose-1-phosphate uridylyltransferase	ClinVar	PMID:28492532
Ccdc107	Mouse	hyperphosphatasia with impaired intellectual development syndrome 2		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: GLYCOSYLPHOSPHATIDYLINOSITOL BIOSYNTHESIS DEFECT 6	ClinVar	PMID:22683086\|PMID:24417746\|PMID:28492532
Ccdc107	Mouse	Metaphyseal Dysplasia without Hypotrichosis		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: Cartilage-hair hypoplasia variant, skeletal manifestations only	ClinVar	PMID:10026268\|PMID:11207361\|PMID:11940090\|PMID:12107819\|PMID:12888988\|PMID:14569119\|PMID:16097009\|PMID:16254002\|PMID:16838329\|PMID:17701897\|PMID:18804272\|PMID:25741868\|PMID:28094436\|PMID:28492532\|PMID:8034306\|PMID:8444246\|PMID:9156319
Ccdc107	Mouse	paraplegia		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: Spastic paraplegia	ClinVar	PMID:23332916\|PMID:23332917\|PMID:28492532
Ccdc107	Mouse	primary ciliary dyskinesia		ISO	RGD:1605844	8554872	ClinVar Annotator: match by term: Primary ciliary dyskinesia	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccdc107	Mouse	(+)-catechin	multiple interactions	ISO	RGD:1605844	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of CCDC107 mRNA	CTD	PMID:24763279
Ccdc107	Mouse	(1->4)-beta-D-glucan	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CCDC107 mRNA	CTD	PMID:36331819
Ccdc107	Mouse	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of CCDC107 mRNA	CTD	PMID:22206623
Ccdc107	Mouse	1,3-dinitrobenzene	increases expression	ISO	RGD:1560252	6480464	3-dinitrobenzene results in increased expression of CCDC107 mRNA	CTD	PMID:21983209
Ccdc107	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1560252	6480464	Tetrachlorodibenzodioxin results in decreased expression of CCDC107 mRNA	CTD	PMID:21215274
Ccdc107	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1560252	6480464	Tetrachlorodibenzodioxin results in increased expression of CCDC107 mRNA	CTD	PMID:33387578
Ccdc107	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of CCDC107 mRNA	CTD	PMID:26377647
Ccdc107	Mouse	2,3,7,8-Tetrachlorodibenzofuran	increases expression	ISO	RGD:1560252	6480464	2,3,7,8-tetrachlorodibenzofuran results in increased expression of CCDC107 mRNA	CTD	PMID:32109520
Ccdc107	Mouse	2-hydroxypropanoic acid	decreases expression	ISO	RGD:1605844	6480464	Lactic Acid results in decreased expression of CCDC107 mRNA	CTD	PMID:30851411
Ccdc107	Mouse	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1605844	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Ccdc107	Mouse	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:1605844	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Ccdc107	Mouse	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of CCDC107 mRNA	CTD	PMID:39298647
Ccdc107	Mouse	4-hydroxyphenyl retinamide	increases expression	EXP		6480464	Fenretinide results in increased expression of CCDC107 mRNA	CTD	PMID:28973697
Ccdc107	Mouse	benzo[a]pyrene	multiple interactions	EXP		6480464	Benzo(a)pyrene promotes the reaction [AHR protein binds to CCDC107 promoter]	CTD	PMID:19654925
Ccdc107	Mouse	bis(2-ethylhexyl) phthalate	increases expression	EXP		6480464	Diethylhexyl Phthalate results in increased expression of CCDC107 mRNA	CTD	PMID:33754040
Ccdc107	Mouse	bisphenol A	multiple interactions	ISO	RGD:1605844	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Ccdc107	Mouse	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of CCDC107 mRNA	CTD	PMID:32156529\|PMID:35479511
Ccdc107	Mouse	bisphenol F	affects expression	EXP		6480464	bisphenol F affects the expression of CCDC107 mRNA	CTD	PMID:38685157
Ccdc107	Mouse	cadmium atom	multiple interactions	ISO	RGD:1605844	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CCDC107 more ...	CTD	PMID:35301059
Ccdc107	Mouse	cadmium dichloride	increases expression	ISO	RGD:1560252	6480464	Cadmium Chloride results in increased expression of CCDC107 mRNA	CTD	PMID:33453195
Ccdc107	Mouse	cadmium dichloride	multiple interactions	ISO	RGD:1605844	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CCDC107 more ...	CTD	PMID:35301059
Ccdc107	Mouse	chlorpyrifos	increases expression	EXP		6480464	Chlorpyrifos results in increased expression of CCDC107 mRNA	CTD	PMID:37019170
Ccdc107	Mouse	choline	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ...	CTD	PMID:20938992
Ccdc107	Mouse	cisplatin	decreases expression	ISO	RGD:1605844	6480464	Cisplatin results in decreased expression of CCDC107 mRNA	CTD	PMID:27392435
Ccdc107	Mouse	clofibrate	increases expression	EXP		6480464	Clofibrate results in increased expression of CCDC107 mRNA	CTD	PMID:23811191
Ccdc107	Mouse	copper(II) sulfate	affects expression	ISO	RGD:1605844	6480464	Copper Sulfate affects the expression of CCDC107 mRNA	CTD	PMID:19549813
Ccdc107	Mouse	dexamethasone	multiple interactions	ISO	RGD:1605844	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Ccdc107	Mouse	dexamethasone	increases expression	ISO	RGD:1605844	6480464	Dexamethasone results in increased expression of CCDC107 mRNA	CTD	PMID:25047013
Ccdc107	Mouse	diazinon	increases methylation	ISO	RGD:1605844	6480464	Diazinon results in increased methylation of CCDC107 gene	CTD	PMID:22964155
Ccdc107	Mouse	Dibutyl phosphate	affects expression	ISO	RGD:1605844	6480464	di-n-butylphosphoric acid affects the expression of CCDC107 mRNA	CTD	PMID:37042841
Ccdc107	Mouse	ethanol	affects expression	EXP		6480464	Ethanol affects the expression of CCDC107 mRNA	CTD	PMID:30319688
Ccdc107	Mouse	folic acid	multiple interactions	EXP		6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of CCDC107 mRNA; [Methionine deficiency co-treated more ...	CTD	PMID:20938992\|PMID:22206623
Ccdc107	Mouse	glyphosate	increases expression	ISO	RGD:1560252	6480464	Glyphosate results in increased expression of CCDC107 mRNA	CTD	PMID:26302742
Ccdc107	Mouse	indometacin	multiple interactions	ISO	RGD:1605844	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Ccdc107	Mouse	inulin	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of CCDC107 mRNA	CTD	PMID:36331819
Ccdc107	Mouse	L-methionine	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ...	CTD	PMID:20938992
Ccdc107	Mouse	nefazodone	decreases expression	ISO	RGD:1560252	6480464	nefazodone results in decreased expression of CCDC107 mRNA	CTD	PMID:24136188
Ccdc107	Mouse	nimesulide	decreases expression	ISO	RGD:1560252	6480464	nimesulide results in decreased expression of CCDC107 mRNA	CTD	PMID:24136188
Ccdc107	Mouse	nitrates	multiple interactions	EXP		6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of CCDC107 more ...	CTD	PMID:35964746
Ccdc107	Mouse	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of CCDC107 mRNA	CTD	PMID:17562736
Ccdc107	Mouse	perfluorononanoic acid	decreases expression	ISO	RGD:1605844	6480464	perfluoro-n-nonanoic acid results in decreased expression of CCDC107 mRNA	CTD	PMID:32588087
Ccdc107	Mouse	perfluorooctane-1-sulfonic acid	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CCDC107 mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Ccdc107	Mouse	rac-lactic acid	decreases expression	ISO	RGD:1605844	6480464	Lactic Acid results in decreased expression of CCDC107 mRNA	CTD	PMID:30851411
Ccdc107	Mouse	sunitinib	decreases expression	ISO	RGD:1605844	6480464	Sunitinib results in decreased expression of CCDC107 mRNA	CTD	PMID:31533062
Ccdc107	Mouse	thioacetamide	decreases expression	ISO	RGD:1560252	6480464	Thioacetamide results in decreased expression of CCDC107 mRNA	CTD	PMID:23411599\|PMID:34492290
Ccdc107	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of CCDC107 gene; titanium dioxide results in decreased methylation more ...	CTD	PMID:35295148
Ccdc107	Mouse	valproic acid	affects expression	ISO	RGD:1605844	6480464	Valproic Acid affects the expression of CCDC107 mRNA	CTD	PMID:25979313
Ccdc107	Mouse	vinclozolin	increases expression	ISO	RGD:1560252	6480464	vinclozolin results in increased expression of CCDC107 mRNA	CTD	PMID:22570695
Ccdc107	Mouse	vinclozolin	decreases expression	ISO	RGD:1560252	6480464	vinclozolin results in decreased expression of CCDC107 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccdc107	Mouse	biological_process	involved_in	ND		2290270		MGI	GO_REF:0000015

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccdc107	Mouse	cellular_component	is_active_in	ND		2290270		MGI	GO_REF:0000015
Ccdc107	Mouse	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	2290270		UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccdc107	Mouse	molecular_function	enables	ND		2290270		MGI	GO_REF:0000015
Ccdc107	Mouse	protein binding	enables	ISO	UniProtKB:P01375\|UniProtKB:P78383\|UniProtKB:Q14416\|UniProtKB:Q15848\|UniProtKB:Q9H1C4\|UniProtKB:Q9UHX3	9068941	PMID:32296183	IntAct	PMID:32296183

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccdc107	Mouse	decreased grip strength		IEA		5509061		MGI

PMID:8889548	PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932	PMID:15489334	PMID:16141072	PMID:16141073	PMID:22039455	PMID:32554809
PMID:38355793

Ccdc107
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	43,493,365 - 43,495,921 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	43,492,900 - 43,495,921 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	43,493,340 - 43,495,921 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	43,492,900 - 43,495,921 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	43,506,269 - 43,508,792 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	43,514,497 - 43,517,020 (+)	NCBI		MGSCv36	mm8
Celera	4	43,527,417 - 43,529,940 (+)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	23.04	NCBI

CCDC107
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	35,658,292 - 35,661,511 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	35,658,290 - 35,661,511 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	35,658,289 - 35,661,508 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	35,648,311 - 35,651,184 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	35,591,860 - 35,594,733 (+)	NCBI		Celera
Cytogenetic Map	9	p13.3	NCBI
HuRef	9	35,613,896 - 35,617,109 (+)	NCBI		HuRef
CHM1_1	9	35,658,115 - 35,661,328 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	35,678,944 - 35,682,163 (+)	NCBI		T2T-CHM13v2.0

Ccdc107
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	62,545,273 - 62,548,711 (+)	NCBI		GRCr8
mRatBN7.2	5	57,749,502 - 57,752,920 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	57,748,999 - 57,752,918 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	59,729,473 - 59,732,802 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	61,548,286 - 61,551,615 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	61,519,701 - 61,523,066 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	58,995,211 - 58,998,620 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	58,995,249 - 58,997,953 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	63,519,835 - 63,523,212 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	59,973,255 - 59,975,669 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	56,330,086 - 56,333,495 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

Ccdc107
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955472	633,405 - 640,175 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955472	636,633 - 640,198 (-)	NCBI	ChiLan1.0	ChiLan1.0

CCDC107
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	88,925,635 - 88,929,080 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	88,931,574 - 88,934,999 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	35,510,289 - 35,513,195 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	36,312,688 - 36,315,926 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	36,312,688 - 36,315,926 (+)	Ensembl	panpan1.1		panPan2

CCDC107
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	52,194,412 - 52,196,817 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	52,194,293 - 52,196,815 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	50,762,407 - 50,764,844 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	53,259,766 - 53,262,203 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	53,259,333 - 53,262,203 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	51,804,359 - 51,806,795 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	51,787,838 - 51,790,275 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	52,489,973 - 52,492,410 (+)	NCBI		UU_Cfam_GSD_1.0

Ccdc107
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	167,109,506 - 167,112,271 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	3,657,170 - 3,659,821 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	3,657,094 - 3,659,851 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCDC107
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	236,380,577 - 236,383,666 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	236,380,572 - 236,383,671 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	264,105,613 - 264,108,706 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCDC107
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	44,941,951 - 44,944,935 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	44,939,377 - 44,944,842 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	42,046,763 - 42,049,671 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccdc107
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624868	5,130,938 - 5,133,871 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624868	5,129,818 - 5,133,780 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ccdc107
114 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	768
Count of miRNA genes:	310
Interacting mature miRNAs:	345
Transcripts:	ENSMUST00000030181, ENSMUST00000107922, ENSMUST00000127324, ENSMUST00000137113, ENSMUST00000140005, ENSMUST00000143073
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301203	Alcp8_m	alcohol preference locus 8 (mouse)			Not determined		4	17395160	51395290	Mouse
1301586	Stheal3_m	soft tissue heal 3 (mouse)			Not determined		4	28658442	62658566	Mouse
10401115	Pgia35_m	proteoglycan induced arthritis 35 (mouse)			Not determined		4	12562377	46562509	Mouse
39128211	Lwq22_m	liver weight QTL 22 (mouse)					4	17892616	88982216	Mouse
1301786	Bpq3_m	blood pressure QTL 3 (mouse)			Not determined		4	42402240	76402381	Mouse
4141555	Nbwa2_m	NZB and NZW autoimmunity 2 (mouse)			Not determined		4	17892515	51892635	Mouse
10412178	Habiir2_m	hyperoxic acute lung injury imprinted region 2 (mouse)			Not determined		4	39452126	63283678	Mouse
1300574	Im2_m	immunoregulatory 2 (mouse)			Not determined		4	28077682	62077816	Mouse
12880405	Jcdq1_m	joint cartilage degeneration QTL 1 (mouse)					4	12562377	46562509	Mouse
4142318	Lyr2_m	lymphoma resistance 2 (mouse)			Not determined			14010457	63283678	Mouse
1301697	Sluc18_m	susceptibility to lung cancer 18 (mouse)			Not determined		4	22373448	56373612	Mouse
1357453	Kidq4_m	kidney weight QTL 4 (mouse)			Not determined		4	17892616	88982216	Mouse
4142047	Mvwf3_m	modifier of von Willebrand factor 3 (mouse)			Not determined			14010457	117072206	Mouse
11567249	Elorr3_m	ethanol induced loss of righting response 3 (mouse)					4	3722677	156268235	Mouse
1357877	Synch1_m	synechia 1 (mouse)			Not determined		4	28709925	62710107	Mouse
1300977	Mopkd1_m	modifier of polycystic kidney disease progression 1 (mouse)			Not determined		4	36550839	70550967	Mouse
25440481	Moaq1_m	modifier of alien QTL 1 (mouse)					4	19500000	46000000	Mouse
1301237	Alcp7_m	alcohol preference locus 7 (mouse)			Not determined		4	17395160	51395290	Mouse
4141911	W6q15_m	weight 6 weeks QTL 15 (mouse)			Not determined			17892616	88982216	Mouse
1302075	Bdln6_m	body length 6 (mouse)			Not determined		4	22373448	56373612	Mouse
4142290	Ssrq9_m	stress response QTL 9 (mouse)			Not determined			34395160	46332776	Mouse
1301437	Scon1_m	sucrose consumption 1 (mouse)			Not determined		4	22373448	56373612	Mouse
10401905	Sicd3_m	seizure-induced cell death 3 (mouse)			Not determined		4	9395525	43760862	Mouse
1300769	Pcyts2_m	plasmacytoma susceptibility 2 (mouse)			Not determined		4	22111944	56112145	Mouse
1301792	Hdlq10_m	HDL QTL 10 (mouse)			Not determined		4	35859707	69859853	Mouse
1301990	Arvm1_m	autoimmune renal vasculitis 1 (mouse)			Not determined		4	29332646	63332776	Mouse
1302116	Bbaa1_m	B.burgdorferi-associated arthritis 1 (mouse)			Not determined		4	38250930	72251078	Mouse
1302058	Hrtfm3_m	heart failure modifier 3 (mouse)			Not determined		4	22111944	56112145	Mouse
1302184	Aaom1_m	autoimmune aoritis in MRL mice 1 (mouse)			Not determined		4	24322299	46332776	Mouse
26884449	Sklq2_m	skull length QTL 2, 5 week (mouse)					4	36700000	128993793	Mouse
27226724	Tibw2_m	tibia width 2, proximal, 10 week (mouse)					4	43000000	108357197	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001037913	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK002915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK004044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL732506	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC027414	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000030181 ⟹ ENSMUSP00000030181

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	43,493,362 - 43,495,921 (+)	Ensembl
GRCm38.p6 Ensembl	4	43,493,362 - 43,495,921 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000107922 ⟹ ENSMUSP00000103555

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	43,493,389 - 43,495,921 (+)	Ensembl
GRCm38.p6 Ensembl	4	43,493,389 - 43,495,921 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000127324

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	43,493,377 - 43,493,810 (+)	Ensembl
GRCm38.p6 Ensembl	4	43,493,377 - 43,493,810 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000137113

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	43,493,417 - 43,495,871 (+)	Ensembl
GRCm38.p6 Ensembl	4	43,493,417 - 43,495,871 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000140005

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	43,493,417 - 43,495,864 (+)	Ensembl
GRCm38.p6 Ensembl	4	43,493,417 - 43,495,864 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000143073

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	43,492,900 - 43,494,205 (+)	Ensembl
GRCm38.p6 Ensembl	4	43,492,900 - 43,494,205 (+)	Ensembl

RefSeq Acc Id:

NM_001037913 ⟹ NP_001033002

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	43,493,365 - 43,495,921 (+)	NCBI
GRCm38	4	43,493,365 - 43,495,921 (+)	NCBI

Sequence:

show sequence

GCACTACGGCCGGAGGCCCAGCGCTGGAACGCGGGGTACCCGGCGTGCGATTCTGGTGGGCCAGGCATGGAGGGCGCTGGCCCCGTGTTGAGTATTCTGGGGCTGCTGCTTGTGTCTGCGCCTTTTGG
AGTCCTTGGGGAGCGCCCCAGCGCCGATCTGGGGGCACACCCAGAACGGGGCTCCCAGGTCAGTCCGGGAACCACCGAACCTCGGCGGCAGCCGCCACCCAAGGATCAGCGCGAGCGAGCCCGGGCCG
GATCGCTGTCTTTGGGCGCTCTGTACACCGCGGCCGTCGTGGCTTTTGTGCTGTTCAAGTGTTTGCAGGGCCCAGATGAGGCTGCTGTTCTCAGAGAGGAAAAAAACAAGAAGAAATCCTCGCAGTCA
GAGCAACAGCTGGTGCAGCTGACACAACAGCTGGCCCAGACGGAGCAGCACCTGAACCACCTGATGACACAGCTGGATCCCCTTTTTGAACAGGTGACGACTTTGGTTGGAACCCAGAGGGAACTTCT
AGACACAAAACTAAAGACCATCCACCACCTTCTACAAGACTGCCAGCCTGGCACAGGAGTGGAAGTTCCAGAACCAGAGGCCAGCATACCCTTTACTGAGGACCTGGGGAAAGAAGACCAAGAAGCTG
GAAACAGTCAGGCCTGGGAAGAGCCCATAACCTGGAGCCCAGAAACACGGAACCTAGCTCCTTCCTGGGAGGTGGAGCAGGGGCTGAGGAGAAGGTGGCACAAGACGGTGACAAAGGGTCCAGCAGTA
AATGGGGAACAACCACTGAAGGTTTAGTAAAAAGAGTCCCCTCGTA

hide sequence


Protein RefSeqs	NP_001033002	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH27414	(Get FASTA)	NCBI Sequence Viewer
	BAB22454	(Get FASTA)	NCBI Sequence Viewer
	BAB23140	(Get FASTA)	NCBI Sequence Viewer
	EDL02475	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000030181
	ENSMUSP00000030181.6
	ENSMUSP00000103555.3
GenBank Protein	Q9DCC3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001033002 ⟸ NM_001037913
- Peptide Label:	precursor
- UniProtKB:	Q9DCC3 (UniProtKB/Swiss-Prot), Q9CTB6 (UniProtKB/Swiss-Prot), A2AIN4 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MEGAGPVLSILGLLLVSAPFGVLGERPSADLGAHPERGSQVSPGTTEPRRQPPPKDQRERARAGSLSLGALYTAAVVAFVLFKCLQGPDEAAVLREEKNKKKSSQSEQQLVQLTQQLAQTEQHLNHLM TQLDPLFEQVTTLVGTQRELLDTKLKTIHHLLQDCQPGTGVEVPEPEASIPFTEDLGKEDQEAGNSQAWEEPITWSPETRNLAPSWEVEQGLRRRWHKTVTKGPAVNGEQPLKV hide sequence

Ensembl Acc Id:

ENSMUSP00000103555 ⟸ ENSMUST00000107922

Ensembl Acc Id:

ENSMUSP00000030181 ⟸ ENSMUST00000030181

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9DCC3-F1-model_v2	AlphaFold	Q9DCC3	1-242	view protein structure

RGD ID:

6883222

Promoter ID:

EPDNEW_M5062

Type:

multiple initiation site

Name:

Ccdc107_1

Description:

Mus musculus coiled-coil domain containing 107 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	4	43,493,376 - 43,493,436	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000028461	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000030181	ENTREZGENE
	ENSMUST00000030181.12	UniProtKB/Swiss-Prot
	ENSMUST00000107922.3	UniProtKB/Swiss-Prot
InterPro	CCDC107	UniProtKB/Swiss-Prot
KEGG Report	mmu:622404	UniProtKB/Swiss-Prot
MGD	MGI:1913423	ENTREZGENE
NCBI Gene	Ccdc107	ENTREZGENE
PANTHER	COILED-COIL DOMAIN-CONTAINING PROTEIN 107	UniProtKB/Swiss-Prot
	PTHR37345	UniProtKB/Swiss-Prot
PhenoGen	Ccdc107	PhenoGen
UniProt	A2AIN4	ENTREZGENE
	CC107_MOUSE	UniProtKB/Swiss-Prot
	Q9CTB6	ENTREZGENE
	Q9DCC3	ENTREZGENE
UniProt Secondary	A2AIN4	UniProtKB/Swiss-Prot
	Q9CTB6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-08-21	Ccdc107	coiled-coil domain containing 107	1110032O22Rik	RIKEN cDNA 1110032O22 gene	Symbol and/or name change	5135510	APPROVED
2024-08-21	1110032O22Rik	RIKEN cDNA 1110032O22 gene	Ccdc107	coiled-coil domain containing 107	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype