Advanced Search (OLGA)

Gene: Ccin (calicin) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ccin

Name:

calicin

RGD ID:

1359369

Description:

Predicted to enable ubiquitin-like ligase-substrate adaptor activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process and spermatogenesis. Predicted to be located in cytoskeletal calyx. Predicted to be part of Cul3-RING ubiquitin ligase complex. Predicted to be active in cytoplasm. Human ortholog(s) of this gene implicated in spermatogenic failure 91. Orthologous to human CCIN (calicin); INTERACTS WITH bisphenol A; cadmium dichloride; gentamycin.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC94933

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCIN (calicin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ccin (calicin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ccin (calicin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCIN (calicin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCIN (calicin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccin (calicin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCIN (calicin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CCIN (calicin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ccin (calicin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CCIN (calicin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccin (calicin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	63,002,427 - 63,004,314 (+)	NCBI		GRCr8
mRatBN7.2	5	58,206,676 - 58,208,563 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	58,206,633 - 58,208,951 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	60,188,596 - 60,190,483 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	62,007,409 - 62,009,296 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	61,976,733 - 61,978,620 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	59,452,348 - 59,454,235 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	59,452,348 - 59,454,233 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	63,974,871 - 63,976,758 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	60,445,684 - 60,447,571 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	60,445,862 - 60,447,748 (+)	NCBI
Celera	5	56,785,152 - 56,787,039 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccin	Rat	acromesomelic dysplasia, Maroteaux type		ISO	CCIN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Acromesomelic dysplasia 1 and Maroteaux type	ClinVar	PMID:28492532
Ccin	Rat	anauxetic dysplasia		ISO	CCIN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Anauxetic dysplasia	ClinVar	PMID:28492532
Ccin	Rat	autosomal recessive distal hereditary motor neuronopathy 2		ISO	CCIN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal recessive distal spinal muscular atrophy 2	ClinVar	PMID:28492532
Ccin	Rat	distal arthrogryposis type 1A		ISO	CCIN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Arthrogryposis more ...	ClinVar	PMID:28492532
Ccin	Rat	frontotemporal dementia and/or amyotrophic lateral sclerosis 6		ISO	CCIN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Frontotemporal dementia and/or amyotrophic lateral sclerosis 6	ClinVar	PMID:28492532
Ccin	Rat	galactosemia		ISO	CCIN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deficiency of UDPglucose-hexose-1-phosphate uridylyltransferase	ClinVar	PMID:28492532
Ccin	Rat	hyperphosphatasia with impaired intellectual development syndrome 2		ISO	CCIN (Homo sapiens)	8554872	ClinVar Annotator: match by term: GLYCOSYLPHOSPHATIDYLINOSITOL BIOSYNTHESIS DEFECT 6	ClinVar	PMID:22683086 more ...
Ccin	Rat	paraplegia		ISO	CCIN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Spastic paraplegia	ClinVar	PMID:23332916 more ...
Ccin	Rat	primary ciliary dyskinesia		ISO	CCIN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Primary ciliary dyskinesia	ClinVar	PMID:28492532
Ccin	Rat	spermatogenic failure 91		ISO	CCIN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Spermatogenic failure 91	ClinVar	PMID:31985809 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccin	Rat	spermatogenic failure 91		ISO	CCIN (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccin	Rat	1,2-dimethylhydrazine	increases expression	ISO	Ccin (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of CCIN mRNA	CTD	PMID:22206623
Ccin	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Ccin (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of CCIN mRNA	CTD	PMID:21354282 and PMID:31961203
Ccin	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	CCIN (Homo sapiens)	6480464	[Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of CCIN mRNA	CTD	PMID:26159488
Ccin	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Ccin (Mus musculus)	6480464	bisphenol S affects the methylation of CCIN gene	CTD	PMID:31683443
Ccin	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Ccin (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of CCIN mRNA	CTD	PMID:34319233
Ccin	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CCIN mRNA	CTD	PMID:25181051
Ccin	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of CCIN promoter	CTD	PMID:22457795
Ccin	Rat	cyclophosphamide	increases expression	ISO	CCIN (Homo sapiens)	6480464	Cyclophosphamide results in increased expression of CCIN protein	CTD	PMID:17475930
Ccin	Rat	endosulfan	multiple interactions	ISO	CCIN (Homo sapiens)	6480464	[Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of CCIN mRNA	CTD	PMID:26159488
Ccin	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of CCIN mRNA	CTD	PMID:33387578
Ccin	Rat	glyphosate	decreases expression	ISO	CCIN (Homo sapiens)	6480464	Glyphosate results in decreased expression of CCIN mRNA	CTD	PMID:28711546
Ccin	Rat	graphite	affects expression	EXP		6480464	Graphite affects the expression of CCIN mRNA	CTD	PMID:29933104
Ccin	Rat	paracetamol	affects expression	ISO	Ccin (Mus musculus)	6480464	Acetaminophen affects the expression of CCIN mRNA	CTD	PMID:17562736
Ccin	Rat	sodium fluoride	increases expression	ISO	Ccin (Mus musculus)	6480464	Sodium Fluoride results in increased expression of CCIN protein	CTD	PMID:28918527
Ccin	Rat	trichloroethene	increases methylation	EXP		6480464	Trichloroethylene results in increased methylation of CCIN gene	CTD	PMID:27618143
Ccin	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of CCIN mRNA	CTD	PMID:33387578

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccin	Rat	cell differentiation	involved_in	IEA	UniProtKB-KW:KW-0221	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ccin	Rat	proteasome-mediated ubiquitin-dependent protein catabolic process	involved_in	IBA	FB:FBgn0037978 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ccin	Rat	spermatogenesis	involved_in	ISO	Ccin (Mus musculus)	1624291	PMID:36546111	RGD	PMID:36546111
Ccin	Rat	spermatogenesis	involved_in	IEA	UniProtKB-KW:KW-0744	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ccin	Rat	spermatogenesis	involved_in	IEA	UniProtKB:Q8CDE2 and ensembl:ENSMUSP00000092725	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ccin	Rat	spermatogenesis	involved_in	IEA	UniProtKB:Q13939 and ensembl:ENSP00000334996	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ccin	Rat	spermatogenesis	involved_in	ISO	CCIN (Homo sapiens)	1624291	PMID:36546111	RGD	PMID:36546111
Ccin	Rat	spermatogenesis	involved_in	ISS	UniProtKB:Q8CDE2	1600115	GO_REF:0000024	UniProt	GO_REF:0000024

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccin	Rat	Cul3-RING ubiquitin ligase complex	part_of	IBA	FB:FBgn0037978 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ccin	Rat	cytoplasm	is_active_in	IBA	MGI:1858732 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ccin	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ccin	Rat	cytoskeletal calyx	located_in	ISS	UniProtKB:Q8CDE2	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ccin	Rat	cytoskeletal calyx	located_in	IEA	UniProtKB-SubCell:SL-0032	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ccin	Rat	cytoskeletal calyx	located_in	IEA	UniProtKB:Q8CDE2 and ensembl:ENSMUSP00000092725	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ccin	Rat	cytoskeletal calyx	located_in	ISO	Ccin (Mus musculus)	1624291	PMID:36546111	RGD	PMID:36546111
Ccin	Rat	cytoskeletal calyx	located_in	IEA	UniProtKB:Q13939 and ensembl:ENSP00000334996	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ccin	Rat	cytoskeletal calyx	located_in	ISO	CCIN (Homo sapiens)	1624291	PMID:36546111	RGD	PMID:36546111
Ccin	Rat	cytoskeleton	located_in	IEA	UniProtKB-KW:KW-0206	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccin	Rat	protein binding	enables	ISO	CCIN (Homo sapiens)	1624291	UniProtKB:O60260-5 more ...	RGD	PMID:32814053 and PMID:38573307
Ccin	Rat	ubiquitin-like ligase-substrate adaptor activity	enables	IBA	FB:FBgn0037978 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:21630459

Ccin
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	63,002,427 - 63,004,314 (+)	NCBI		GRCr8
mRatBN7.2	5	58,206,676 - 58,208,563 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	58,206,633 - 58,208,951 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	60,188,596 - 60,190,483 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	62,007,409 - 62,009,296 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	61,976,733 - 61,978,620 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	59,452,348 - 59,454,235 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	59,452,348 - 59,454,233 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	63,974,871 - 63,976,758 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	60,445,684 - 60,447,571 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	60,445,862 - 60,447,748 (+)	NCBI
Celera	5	56,785,152 - 56,787,039 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

CCIN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	36,169,388 - 36,171,334 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	36,169,388 - 36,171,334 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	36,169,385 - 36,171,331 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	36,159,391 - 36,161,320 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	36,159,390 - 36,161,320	NCBI
Celera	9	36,102,976 - 36,104,918 (+)	NCBI		Celera
Cytogenetic Map	9	p13.3	NCBI
HuRef	9	36,123,296 - 36,125,238 (+)	NCBI		HuRef
CHM1_1	9	36,169,794 - 36,171,736 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	36,191,394 - 36,193,340 (+)	NCBI		T2T-CHM13v2.0

Ccin
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	43,983,504 - 43,985,533 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	43,983,483 - 43,985,423 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	43,983,504 - 43,985,533 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	43,983,483 - 43,985,423 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	43,996,376 - 43,998,405 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	44,004,604 - 44,006,633 (+)	NCBI		MGSCv36	mm8
Celera	4	44,004,720 - 44,006,749 (+)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	23.08	NCBI

Ccin
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004958151	6 - 1,111 (+)	NCBI	ChiLan1.0	ChiLan1.0

CCIN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	88,411,833 - 88,424,872 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	88,417,770 - 88,430,809 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	36,014,394 - 36,021,056 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	36,815,577 - 36,822,204 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	36,820,373 - 36,822,139 (+)	Ensembl	panpan1.1		panPan2

CCIN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	52,637,580 - 52,640,121 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	51,228,265 - 51,230,803 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	53,743,935 - 53,746,473 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	11	52,246,797 - 52,249,335 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	52,268,837 - 52,271,375 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	52,970,389 - 52,972,927 (+)	NCBI		UU_Cfam_GSD_1.0

Ccin
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	167,595,289 - 167,597,603 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	4,143,347 - 4,145,113 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	4,143,238 - 4,145,183 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCIN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	236,948,636 - 236,950,402 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	236,947,871 - 236,950,447 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	264,620,225 - 264,622,451 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCIN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	44,387,239 - 44,390,726 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	44,387,995 - 44,389,761 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	41,478,897 - 41,480,841 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccin
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624868	4,536,042 - 4,537,911 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ccin
4 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	12
Count of miRNA genes:	12
Interacting mature miRNAs:	12
Transcripts:	ENSRNOT00000019887
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
6	3	22	35	25	24	11	9	11	5	69	42	25	8	38	13


RefSeq Transcripts	NM_001005904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019887 ⟹ ENSRNOP00000019887

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,206,633 - 58,208,951 (+)	Ensembl
Rnor_6.0 Ensembl	5	59,452,348 - 59,454,233 (+)	Ensembl

RefSeq Acc Id:

NM_001005904 ⟹ NP_001005904

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	63,002,427 - 63,004,314 (+)	NCBI
mRatBN7.2	5	58,206,676 - 58,208,563 (+)	NCBI
Rnor_6.0	5	59,452,348 - 59,454,235 (+)	NCBI
Rnor_5.0	5	63,974,871 - 63,976,758 (+)	NCBI
RGSC_v3.4	5	60,445,684 - 60,447,571 (+)	RGD
Celera	5	56,785,152 - 56,787,039 (+)	RGD

Sequence:

show sequence

GAAAAAGTCTGCCCTCCAGTACCTGCTACCGATCTTCTGTCTCAGCCAACAAGAAGCACCATGAAACTGGAATTCACAGAGAAAAACTACAACAGCTTTGTGCTGCAAAACCTGAATAAACAGAGGAA
GCGCAAAGAGTACTGGGACATGGCCCTGACTGTGGACCACCATGTCTTCTTCGCACATCGCAACGTGCTGGCTGCCGTCTCTCCACTGGTGAAAAGTCTTGTCTCCAGCAACGACATGAAGACCACCG
ATGAACTCTACATCACCATTGACCCCAACTACCTGAGTCCAGCCACGGTGGACCAGCTCCTGGACTACTTCTACAGCGGCAAAGTGGTGATCTCAGAACAGAATGTGGAGGAGCTGCTCCGTGGCGCT
CAGTATTTCAATACCCCACGCCTTCGGATTCACTGCAATGACTTCCTGATTAAGTCCATTCGACGCGTCAACTGCTTGCGCTACCTCTTCTTGGCTGAGCTGTTCGAGCTTAAAGAAGTATCAGACTT
GGCCTACTCTGGCATTCGCGACAACTTCCACTTCTGGGCCAGTCCCGAGGGCTCTATGCACTTCATGCGCTGCCCACCTGTCATCTTCGGCCGCCTGCTCCGTGATGAAAACCTTCACGTGCTCAACG
AGGACCAGGCTCTCAGCGCACTCATCAATTGGGTGTACTTCCGGAAGGAGGAGCGGGAAAAATACTTCAAGAAGTTCTTCAATTACATCAACCTCAATGCTGTCTCCAACAAGACGCTGATGTTTGCC
AGCAACAAGCTGACTGGCTTGGAGAACAACTCGGCCCACGCGACCTTAATCGAAAGTGTCCTGATGGACCGCAAGCAGGAGCGCCCGTGCAGCCTGCTGAGCTACCAGCGGAAAGGGGCCCTGCTTGA
TTCAGTGGTCATCCTGGGTGGCCAGAAGGCCCATGGCAAGTTCAACGACGGAGTGTTTGCGTATATCATCCAGGAGAACCTGTGGCTGAAGCTCTCAGAGATGCCATACCGAGCAGCCGCGCTCAGTG
CCACTGCTGCTGGCCGTTACATCTACATATCTGGTGGCACCACTGAGCAGATTTCAGGACTGAAGACAGCATGGCGGTATGATATGGATGACAACTCCTGGACCAAGCTGCCTGACCTGCCCATTGGG
CTTGTCTTCCACACCATGGTGACCTGTGGGGGAACAGTTTACTCAGTGGGTGGGAGCATTGCCCCACGCCGGTACGTCTCTAACATCTATCGCTACGATGAACGCAAGGAAGCCTGGTGCTTGGCAGG
CAAGATGAGCATCCCTATGGACGGGACTGCAGTGATCACTAAGGGTGACCGGAACCTGTACATTGTCACCGGGCGATGCCTGGTGAAGGGCTACATCTCCCGGGTCGGTGTGGTGGACTGCTTCGACA
CCTGTACAGGGGAAGTGGTCCAGTGTATCACTTTCCCCATCGAATTCAACCACCGGCCCCTGCTCTCCTTCCACCAGGACAATATCCTCCGTGTACACAGCCACCGGCAGAGCGTGGAAATCAACTTA
CAGAAGATAAAGGCCAACAAGTCAACCACCTCAGTGCCTCTGTTGCCCAACAGTTGTCCCTTGGATGTATCCCACGCTATCTGCTCCATCGGAGACAGCAAGGTGTTTGTATGTGGGGGTGTCACCAC
AGCCAGCGATGTTCAGACAAAGGACTACACCATCAACCCTAATGCTTACTTGCTGGACCAAAAGATAGGTGAATGGAAGACCCTTGCCTGCCCACCCGAGGCACTGGACTGCCCTGCCTGCTGTCTAG
CCAAGCTGCCTTGCAAGATTCTTCAAAGAATTTAAACAACTTTTTAAGCGGGAGAATAAGTAAATGCATTATTATTCACAATTTAATGACAGAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001005904	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83832	(Get FASTA)	NCBI Sequence Viewer
	EDL98782	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019887.3
	ENSRNOP00000106158
GenBank Protein	Q5XI58	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001005904 ⟸ NM_001005904

- UniProtKB:

Q5XI58 (UniProtKB/Swiss-Prot), A6IJ62 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKLEFTEKNYNSFVLQNLNKQRKRKEYWDMALTVDHHVFFAHRNVLAAVSPLVKSLVSSNDMKTTDELYITIDPNYLSPATVDQLLDYFYSGKVVISEQNVEELLRGAQYFNTPRLRIHCNDFLIKSI
RRVNCLRYLFLAELFELKEVSDLAYSGIRDNFHFWASPEGSMHFMRCPPVIFGRLLRDENLHVLNEDQALSALINWVYFRKEEREKYFKKFFNYINLNAVSNKTLMFASNKLTGLENNSAHATLIESV
LMDRKQERPCSLLSYQRKGALLDSVVILGGQKAHGKFNDGVFAYIIQENLWLKLSEMPYRAAALSATAAGRYIYISGGTTEQISGLKTAWRYDMDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSI
APRRYVSNIYRYDERKEAWCLAGKMSIPMDGTAVITKGDRNLYIVTGRCLVKGYISRVGVVDCFDTCTGEVVQCITFPIEFNHRPLLSFHQDNILRVHSHRQSVEINLQKIKANKSTTSVPLLPNSCP
LDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNAYLLDQKIGEWKTLACPPEALDCPACCLAKLPCKILQRI

hide sequence

Ensembl Acc Id:

ENSRNOP00000019887 ⟸ ENSRNOT00000019887

Protein Domains

BACK BTB

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XI58-F1-model_v2	AlphaFold	Q5XI58	1-588	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13693686

Promoter ID:

EPDNEW_R4211

Type:

initiation region

Name:

Ccin_1

Description:

calicin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	59,452,328 - 59,452,388	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-41480	BioCyc
Ensembl Genes	ENSRNOG00000014831	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000019887.6	UniProtKB/Swiss-Prot
	ENSRNOT00000124170	ENTREZGENE
Gene3D-CATH	1.25.40.420	UniProtKB/Swiss-Prot
	2.120.10.80	UniProtKB/Swiss-Prot
	Potassium Channel Kv1.1, Chain A	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7112736	IMAGE-MGC_LOAD
InterPro	BACK	UniProtKB/Swiss-Prot
	BTB/POZ_dom	UniProtKB/Swiss-Prot
	Calicin_BTB_POZ	UniProtKB/Swiss-Prot
	Kelch-typ_b-propeller	UniProtKB/Swiss-Prot
	Kelch_1	UniProtKB/Swiss-Prot
	SKP1/BTB/POZ_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:298392	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94933	IMAGE-MGC_LOAD
NCBI Gene	298392	ENTREZGENE
PANTHER	LD33804P	UniProtKB/Swiss-Prot
Pfam	BACK	UniProtKB/Swiss-Prot
	BTB	UniProtKB/Swiss-Prot
	Kelch_1	UniProtKB/Swiss-Prot
	Kelch_6	UniProtKB/Swiss-Prot
PhenoGen	Ccin	PhenoGen
PROSITE	BTB	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000014831	RatGTEx
SMART	BACK	UniProtKB/Swiss-Prot
	BTB	UniProtKB/Swiss-Prot
	Kelch	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF117281	UniProtKB/Swiss-Prot
	SSF54695	UniProtKB/Swiss-Prot
UniProt	A6IJ62	ENTREZGENE, UniProtKB/TrEMBL
	CALI_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-07-29	Ccin	calicin			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM