Symbol:
Acot9
Name:
acyl-CoA thioesterase 9
RGD ID:
1359188
Description:
Predicted to enable acetyl-CoA hydrolase activity and long-chain fatty acyl-CoA hydrolase activity. Predicted to be involved in acyl-CoA metabolic process; long-chain fatty acid metabolic process; and short-chain fatty acid metabolic process. Predicted to be located in mitochondrial matrix. Predicted to be active in mitochondrion. Orthologous to human ACOT9 (acyl-CoA thioesterase 9); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2-acetamidofluorene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Acate2; acyl-Coenzyme A thioesterase 2, mitochondrial; acyl-coenzyme A thioesterase 9, mitochondrial; LOC302640; similar to acyl-CoA thioesterase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ACOT9 (acyl-CoA thioesterase 9)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Acot9 (acyl-CoA thioesterase 9)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Acot9 (acyl-CoA thioesterase 9)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ACOT9 (acyl-CoA thioesterase 9)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ACOT9 (acyl-CoA thioesterase 9)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Acot9 (acyl-CoA thioesterase 9)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ACOT9 (acyl-CoA thioesterase 9)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ACOT9 (acyl-CoA thioesterase 9)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Acot9 (acyl-CoA thioesterase 9)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ACOT9 (acyl-CoA thioesterase 9)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Acot10 (acyl-CoA thioesterase 10)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Acot9 (acyl-CoA thioesterase 9)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
acot9.1 (acyl-CoA thioesterase 9, tandem duplicate 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
acot9.2 (acyl-CoA thioesterase 9, tandem duplicate 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG13771
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG1635
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG1638
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG1774
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F57F4.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T07D3.9
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T22B7.7
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
acot9
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 43,922,943 - 43,973,311 (-) NCBI GRCr8 mRatBN7.2 X 40,073,197 - 40,123,573 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 40,064,810 - 40,123,559 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 41,332,153 - 41,371,197 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 44,799,449 - 44,838,500 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 42,484,036 - 42,523,088 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 43,543,069 - 43,592,200 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 43,543,070 - 43,592,200 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 43,846,064 - 43,895,821 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 61,548,318 - 61,600,120 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 61,601,787 - 61,653,589 (-) NCBI Celera X 40,701,964 - 40,751,523 (-) NCBI Celera Cytogenetic Map X q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Acot9 Rat (+)-dexrazoxane multiple interactions ISO RGD:1620856 6480464 [Doxorubicin co-treated with Dexrazoxane] results in decreased expression of ACOT9 mRNA CTD PMID:26873546 Acot9 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ACOT9 mRNA] CTD PMID:31150632 Acot9 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1620856 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ACOT9 mRNA CTD PMID:36331819 Acot9 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1620856 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ACOT9 mRNA CTD PMID:22206623 Acot9 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:1606811 6480464 Dihydrotestosterone results in increased expression of ACOT9 mRNA CTD PMID:29581250 Acot9 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1620856 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Acot9 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1620856 6480464 Tetrachlorodibenzodioxin affects the expression of ACOT9 mRNA CTD PMID:18343893|PMID:21570461 Acot9 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ACOT9 mRNA CTD PMID:33387578 Acot9 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1620856 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Acot9 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO RGD:1620856 6480464 2,3,7,8-tetrachlorodibenzofuran affects the expression of ACOT9 mRNA CTD PMID:18343893 Acot9 Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:1606811 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in increased expression of ACOT9 protein CTD PMID:38598786 Acot9 Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of ACOT9 mRNA CTD PMID:21784091 Acot9 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of ACOT9 mRNA CTD PMID:28522335 Acot9 Rat 4,4'-diaminodiphenylmethane increases expression ISO RGD:1620856 6480464 4,4'-diaminodiphenylmethane results in increased expression of ACOT9 mRNA CTD PMID:18648102 Acot9 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ACOT9 mRNA CTD PMID:31881176 Acot9 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of ACOT9 protein CTD PMID:33236894 Acot9 Rat aristolochic acid A multiple interactions EXP 6480464 [aristolochic acid I co-treated with aristolochic acid II] results in decreased expression of ACOT9 mRNA CTD PMID:23912714 Acot9 Rat arsenite(3-) multiple interactions ISO RGD:1606811 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ACOT9 protein] CTD PMID:32406909 Acot9 Rat arsenous acid increases expression ISO RGD:1606811 6480464 Arsenic Trioxide results in increased expression of ACOT9 mRNA CTD PMID:22521957 Acot9 Rat atrazine increases expression ISO RGD:1606811 6480464 Atrazine results in increased expression of ACOT9 mRNA CTD PMID:22378314 Acot9 Rat benzene increases expression ISO RGD:1606811 6480464 Benzene results in increased expression of ACOT9 mRNA CTD PMID:15929907 Acot9 Rat benzo[a]pyrene affects methylation ISO RGD:1606811 6480464 Benzo(a)pyrene affects the methylation of ACOT9 promoter CTD PMID:27901495 Acot9 Rat benzo[a]pyrene increases methylation ISO RGD:1606811 6480464 Benzo(a)pyrene results in increased methylation of ACOT9 5' UTR CTD PMID:27901495 Acot9 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1606811 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of ACOT9 mRNA CTD PMID:19150397 Acot9 Rat Benzo[k]fluoranthene increases expression ISO RGD:1620856 6480464 benzo(k)fluoranthene results in increased expression of ACOT9 mRNA CTD PMID:26377693 Acot9 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1620856 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Acot9 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ACOT9 mRNA CTD PMID:25181051 Acot9 Rat bisphenol A decreases expression ISO RGD:1606811 6480464 bisphenol A results in decreased expression of ACOT9 mRNA CTD PMID:29275510 Acot9 Rat bisphenol A multiple interactions ISO RGD:1620856 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Acot9 Rat bisphenol AF increases expression ISO RGD:1606811 6480464 bisphenol AF results in increased expression of ACOT9 protein CTD PMID:34186270 Acot9 Rat Bisphenol B increases expression ISO RGD:1606811 6480464 bisphenol B results in increased expression of ACOT9 protein CTD PMID:34186270 Acot9 Rat bisphenol F increases expression ISO RGD:1620856 6480464 bisphenol F results in increased expression of ACOT9 mRNA CTD PMID:30951980 Acot9 Rat butanal increases methylation ISO RGD:1606811 6480464 butyraldehyde results in increased methylation of ACOT9 gene CTD PMID:30002397 Acot9 Rat cadmium dichloride increases expression ISO RGD:1606811 6480464 Cadmium Chloride results in increased expression of ACOT9 mRNA CTD PMID:38568856 Acot9 Rat carbamazepine affects expression ISO RGD:1606811 6480464 Carbamazepine affects the expression of ACOT9 mRNA CTD PMID:25979313 Acot9 Rat carbon nanotube increases expression ISO RGD:1620856 6480464 Nanotubes, Carbon analog results in increased expression of ACOT9 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Acot9 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of ACOT9 mRNA CTD PMID:18500788 Acot9 Rat choline multiple interactions ISO RGD:1620856 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression more ... CTD PMID:20938992|PMID:29127188 Acot9 Rat clofibrate increases expression ISO RGD:1620856 6480464 Clofibrate results in increased expression of ACOT9 mRNA CTD PMID:17585979 Acot9 Rat copper(II) sulfate increases expression ISO RGD:1606811 6480464 Copper Sulfate results in increased expression of ACOT9 mRNA CTD PMID:19549813 Acot9 Rat crocidolite asbestos increases expression ISO RGD:1606811 6480464 Asbestos, Crocidolite results in increased expression of ACOT9 mRNA CTD PMID:29523930 Acot9 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ACOT9 mRNA CTD PMID:26577399 Acot9 Rat cyclosporin A increases expression ISO RGD:1606811 6480464 Cyclosporine results in increased expression of ACOT9 mRNA CTD PMID:20106945|PMID:25562108 Acot9 Rat cyproconazole multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole co-treated with prochloraz] results in increased expression of ACOT9 mRNA CTD PMID:29038839 Acot9 Rat diarsenic trioxide increases expression ISO RGD:1606811 6480464 Arsenic Trioxide results in increased expression of ACOT9 mRNA CTD PMID:22521957 Acot9 Rat Dibutyl phosphate affects expression ISO RGD:1606811 6480464 di-n-butylphosphoric acid affects the expression of ACOT9 mRNA CTD PMID:37042841 Acot9 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ACOT9 mRNA CTD PMID:21266533 Acot9 Rat dibutyl phthalate increases expression ISO RGD:1620856 6480464 Dibutyl Phthalate results in increased expression of ACOT9 mRNA CTD PMID:21266533 Acot9 Rat doxorubicin multiple interactions ISO RGD:1620856 6480464 [Doxorubicin co-treated with Dexrazoxane] results in decreased expression of ACOT9 mRNA CTD PMID:26873546 Acot9 Rat doxorubicin increases expression ISO RGD:1620856 6480464 Doxorubicin results in increased expression of ACOT9 mRNA CTD PMID:26873546 Acot9 Rat enzyme inhibitor multiple interactions ISO RGD:1606811 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Acot9 Rat epoxiconazole multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole co-treated with prochloraz] results in increased expression of ACOT9 mRNA CTD PMID:29038839 Acot9 Rat epoxiconazole increases expression ISO RGD:1620856 6480464 epoxiconazole results in increased expression of ACOT9 mRNA CTD PMID:35436446 Acot9 Rat ethanol increases expression ISO RGD:1620856 6480464 Ethanol results in increased expression of ACOT9 mRNA CTD PMID:30319688 Acot9 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of ACOT9 mRNA CTD PMID:24793618 Acot9 Rat folic acid multiple interactions ISO RGD:1620856 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ACOT9 mRNA; [Choline deficiency co-treated more ... CTD PMID:20938992|PMID:22206623|PMID:29127188 Acot9 Rat folic acid decreases expression ISO RGD:1620856 6480464 Folic Acid results in decreased expression of ACOT9 mRNA CTD PMID:25629700 Acot9 Rat furan increases expression EXP 6480464 furan results in increased expression of ACOT9 mRNA CTD PMID:25539665|PMID:26194646 Acot9 Rat furfural multiple interactions ISO RGD:1606811 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of ACOT9 protein CTD PMID:38598786 Acot9 Rat genistein increases methylation EXP 6480464 Genistein results in increased methylation of ACOT9 gene CTD PMID:28505145 Acot9 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ACOT9 mRNA CTD PMID:33387578 Acot9 Rat heptanal increases methylation ISO RGD:1606811 6480464 heptanal results in increased methylation of ACOT9 gene CTD PMID:30002397 Acot9 Rat hexanal increases methylation ISO RGD:1606811 6480464 n-hexanal results in increased methylation of ACOT9 gene CTD PMID:30002397 Acot9 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of ACOT9 mRNA CTD PMID:21396975 Acot9 Rat ivermectin decreases expression ISO RGD:1606811 6480464 Ivermectin results in decreased expression of ACOT9 protein CTD PMID:32959892 Acot9 Rat L-methionine multiple interactions ISO RGD:1620856 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression more ... CTD PMID:20938992|PMID:29127188 Acot9 Rat N-nitrosodiethylamine multiple interactions ISO RGD:1620856 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of ACOT9 mRNA CTD PMID:24535843 Acot9 Rat nickel atom increases expression ISO RGD:1606811 6480464 Nickel results in increased expression of ACOT9 mRNA CTD PMID:25583101 Acot9 Rat nonanal increases methylation ISO RGD:1606811 6480464 nonanal results in increased methylation of ACOT9 gene CTD PMID:30002397 Acot9 Rat obeticholic acid increases expression ISO RGD:1606811 6480464 obeticholic acid results in increased expression of ACOT9 mRNA CTD PMID:27939613 Acot9 Rat octanal increases methylation ISO RGD:1606811 6480464 caprylic aldehyde results in increased methylation of ACOT9 gene CTD PMID:30002397 Acot9 Rat ozone increases expression ISO RGD:1620856 6480464 Ozone results in increased expression of ACOT9 mRNA CTD PMID:17095637 Acot9 Rat paracetamol affects expression ISO RGD:1620856 6480464 Acetaminophen affects the expression of ACOT9 mRNA CTD PMID:17562736 Acot9 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ACOT9 mRNA CTD PMID:33387578 Acot9 Rat pentanal increases methylation ISO RGD:1606811 6480464 pentanal results in increased methylation of ACOT9 gene CTD PMID:30002397 Acot9 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1620856 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ACOT9 mRNA CTD PMID:36331819 Acot9 Rat perfluorooctanoic acid increases expression ISO RGD:1606811 6480464 perfluorooctanoic acid results in increased expression of ACOT9 protein CTD PMID:26879310 Acot9 Rat phenobarbital multiple interactions ISO RGD:1620856 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of ACOT9 mRNA CTD PMID:24535843 Acot9 Rat pirinixic acid multiple interactions ISO RGD:1620856 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of ACOT9 mRNA] CTD PMID:17950772 Acot9 Rat pirinixic acid increases expression ISO RGD:1620856 6480464 pirinixic acid results in increased expression of ACOT9 mRNA CTD PMID:17950772|PMID:18301758|PMID:20813756|PMID:23811191 Acot9 Rat prochloraz multiple interactions EXP 6480464 [cyproconazole co-treated with epoxiconazole co-treated with prochloraz] results in increased expression of ACOT9 mRNA CTD PMID:29038839 Acot9 Rat progesterone affects expression ISO RGD:1620856 6480464 Progesterone affects the expression of ACOT9 mRNA CTD PMID:17251523 Acot9 Rat propanal increases methylation ISO RGD:1606811 6480464 propionaldehyde results in increased methylation of ACOT9 gene CTD PMID:30002397 Acot9 Rat resveratrol increases expression ISO RGD:1620856 6480464 resveratrol results in increased expression of ACOT9 protein CTD PMID:25505154 Acot9 Rat resveratrol multiple interactions ISO RGD:1606811 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of ACOT9 mRNA CTD PMID:23557933 Acot9 Rat sodium chloride multiple interactions ISO RGD:1606811 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of ACOT9 protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 Acot9 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of ACOT9 mRNA CTD PMID:25993096 Acot9 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of ACOT9 mRNA CTD PMID:19281266 Acot9 Rat streptozocin multiple interactions ISO RGD:1620856 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of ACOT9 mRNA CTD PMID:29127188 Acot9 Rat sunitinib decreases expression ISO RGD:1606811 6480464 Sunitinib results in decreased expression of ACOT9 mRNA CTD PMID:31533062 Acot9 Rat testosterone decreases expression ISO RGD:1606811 6480464 Testosterone results in decreased expression of ACOT9 mRNA CTD PMID:33359661 Acot9 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ACOT9 mRNA CTD PMID:21784091|PMID:31150632 Acot9 Rat tetrachloromethane increases expression ISO RGD:1620856 6480464 Carbon Tetrachloride results in increased expression of ACOT9 mRNA CTD PMID:31919559 Acot9 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ACOT9 mRNA] CTD PMID:31150632 Acot9 Rat tetrahydropalmatine decreases expression ISO RGD:1606811 6480464 tetrahydropalmatine results in decreased expression of ACOT9 protein CTD PMID:20109541 Acot9 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ACOT9 mRNA CTD PMID:21784091|PMID:23411599|PMID:34492290 Acot9 Rat thiram increases expression ISO RGD:1606811 6480464 Thiram results in increased expression of ACOT9 mRNA CTD PMID:38568856 Acot9 Rat titanium dioxide decreases methylation ISO RGD:1620856 6480464 titanium dioxide results in decreased methylation of ACOT9 gene CTD PMID:35295148 Acot9 Rat triphenyl phosphate affects expression ISO RGD:1606811 6480464 triphenyl phosphate affects the expression of ACOT9 mRNA CTD PMID:37042841 Acot9 Rat Triptolide increases expression ISO RGD:1620856 6480464 triptolide results in increased expression of ACOT9 mRNA CTD PMID:32835833 Acot9 Rat valproic acid decreases expression ISO RGD:1606811 6480464 Valproic Acid results in decreased expression of ACOT9 mRNA CTD PMID:29154799 Acot9 Rat vancomycin decreases expression ISO RGD:1620856 6480464 Vancomycin results in decreased expression of ACOT9 mRNA CTD PMID:18930951
(+)-dexrazoxane (ISO) (+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,6-dimethoxyphenol (ISO) 2-acetamidofluorene (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (ISO) acetamide (EXP) aconitine (EXP) aristolochic acid A (EXP) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[k]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (ISO) cefaloridine (EXP) choline (ISO) clofibrate (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) cyproconazole (EXP) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) doxorubicin (ISO) enzyme inhibitor (ISO) epoxiconazole (EXP,ISO) ethanol (ISO) flutamide (EXP) folic acid (ISO) furan (EXP) furfural (ISO) genistein (EXP) gentamycin (EXP) heptanal (ISO) hexanal (ISO) indole-3-methanol (EXP) ivermectin (ISO) L-methionine (ISO) N-nitrosodiethylamine (ISO) nickel atom (ISO) nonanal (ISO) obeticholic acid (ISO) octanal (ISO) ozone (ISO) paracetamol (EXP,ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) prochloraz (EXP) progesterone (ISO) propanal (ISO) resveratrol (ISO) sodium chloride (ISO) sodium dichromate (EXP) Soman (EXP) streptozocin (ISO) sunitinib (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) tetrahydropalmatine (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) Triptolide (ISO) valproic acid (ISO) vancomycin (ISO)
Acot9 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 43,922,943 - 43,973,311 (-) NCBI GRCr8 mRatBN7.2 X 40,073,197 - 40,123,573 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 40,064,810 - 40,123,559 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 41,332,153 - 41,371,197 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 44,799,449 - 44,838,500 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 42,484,036 - 42,523,088 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 43,543,069 - 43,592,200 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 43,543,070 - 43,592,200 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 43,846,064 - 43,895,821 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 61,548,318 - 61,600,120 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 61,601,787 - 61,653,589 (-) NCBI Celera X 40,701,964 - 40,751,523 (-) NCBI Celera Cytogenetic Map X q21 NCBI
ACOT9 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 23,701,055 - 23,743,276 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 23,701,055 - 23,766,475 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 23,719,172 - 23,761,393 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 23,631,698 - 23,671,328 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera X 27,842,554 - 27,882,190 (-) NCBI Celera Cytogenetic Map X p22.11 NCBI HuRef X 21,460,810 - 21,501,317 (-) NCBI HuRef CHM1_1 X 23,752,695 - 23,792,269 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 23,284,668 - 23,326,884 (-) NCBI T2T-CHM13v2.0
Acot9 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 154,045,439 - 154,080,650 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 154,045,439 - 154,080,650 (+) Ensembl GRCm39 Ensembl GRCm38 X 155,262,443 - 155,297,654 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 155,262,443 - 155,297,654 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 151,697,043 - 151,732,050 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 150,603,226 - 150,638,364 (+) NCBI MGSCv36 mm8 Celera X 138,566,044 - 138,601,000 (+) NCBI Celera Cytogenetic Map X F3 NCBI cM Map X 72.38 NCBI
Acot9 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955509 4,143,586 - 4,167,128 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955509 4,143,246 - 4,167,129 (-) NCBI ChiLan1.0 ChiLan1.0
ACOT9 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 25,504,426 - 25,544,539 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 25,503,513 - 25,547,923 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 16,300,116 - 16,365,713 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 23,678,071 - 23,717,092 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 23,676,669 - 23,717,092 (-) Ensembl panpan1.1 panPan2
ACOT9 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 19,395,763 - 19,460,945 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 19,395,762 - 19,551,198 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 X 19,350,059 - 19,415,885 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 19,342,343 - 19,374,457 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 19,389,633 - 19,455,007 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 19,422,682 - 19,488,508 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 19,479,032 - 19,544,221 (-) NCBI UU_Cfam_GSD_1.0
Acot9 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
ACOT9 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 19,834,614 - 19,864,660 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 19,835,674 - 19,864,570 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 21,205,864 - 21,234,787 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACOT9 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 22,152,651 - 22,190,536 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 22,151,384 - 22,190,505 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666056 24,048,616 - 24,087,263 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Acot9 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 39 Count of miRNA genes: 35 Interacting mature miRNAs: 38 Transcripts: ENSRNOT00000005033 Prediction methods: Miranda, Pita, Rnahybrid Result types: miRGate_prediction
1598873 Memor2 Memory QTL 2 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) X 20990947 41052531 Rat 1298071 Edpm12 Estrogen-dependent pituitary mass QTL 12 3.2 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) X 2927898 47927898 Rat 2290375 Gluco34 Glucose level QTL 34 2.75 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) X 20990947 41203591 Rat 731181 Uae27 Urinary albumin excretion QTL 27 2.7 0.0059 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) X 1 43491017 Rat 61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 10755455 Coatc13 Coat color QTL 13 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 4406000 49406000 Rat 631666 Iddm5 Insulin dependent diabetes mellitus QTL 5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) X 4494549 49494549 Rat 71116 Niddm16 Non-insulin dependent diabetes mellitus QTL 16 7.81 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) X 15297802 60297802 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005033 ⟹ ENSRNOP00000005033
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 40,073,205 - 40,123,559 (-) Ensembl Rnor_6.0 Ensembl X 43,543,070 - 43,592,200 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111580 ⟹ ENSRNOP00000089191
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 40,073,198 - 40,116,798 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113538 ⟹ ENSRNOP00000091656
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 40,064,810 - 40,123,559 (-) Ensembl
RefSeq Acc Id:
NM_001013960 ⟹ NP_001013982
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 43,922,943 - 43,973,205 (-) NCBI mRatBN7.2 X 40,073,197 - 40,123,465 (-) NCBI Rnor_6.0 X 43,543,069 - 43,592,200 (-) NCBI Rnor_5.0 X 43,846,064 - 43,895,821 (-) NCBI RGSC_v3.4 X 61,548,318 - 61,600,120 (-) RGD Celera X 40,701,964 - 40,751,523 (-) RGD
Sequence:
CTCACGCTCACGCTCTTCTGTCTCCCGTTTGTCTCTCTATACGGGAGGACGTTGGTTGTCCTCCCGTGGGTAGGCAGTGGAGTGCCATGAAGCGGGCAGCGATGCGTCTTTGGACCTTGAACAAGGGG CTTCTTACACATGGCAGAGGACTGGCTTACGGATCTGAAAACAAAATATGTAAACCTTTACACATACAGGAAGTTCGAAATAAGCTGCGGGAGATCGTAGGCGTATCCACAATCTGGAGAGACCATGT AAAAGCAATGGAGGAAAGGAAGTTACTTCATAATTTTTTGGCTACATCACAGAAAGCCCTACCACCGAGGAAAATGAAGGACAGTTACATTGAAGTCCTCCTGCCTTTGGGTTCTGACCCTGATCTAC GAGACAAATATTTGACTGTTCAAAATACAGTGAGATTTGGCAGGATTCTTGAGGACCTTGATAGCTTAGGAGTTCTTGTTTGCTACATGCACAACCAAAATCATTCTACCAAGATGTCTCCATTATCA ATCGTTACAGTCCTGGTGGACAAGATTGATATGTGTAAATACAGCTTAAGCCCTGAACAGGACATTAAGTTCACTGGCCATGTTAGCTGGGTTGGAAAGACTTCCATGGAAGTGAAGATGAAAATGTT TCAGATGCACAGTGATGATAAATTTTGGCCTGTTTTGGATGCAACCTTTGTAATGGTGGCTCGAGATTCTGAAAATAAAGGGCCTGCATTTGTAAATCCACTTGTTCCTGAAAATAAAGAAGAAGAAG AACTTATTACACAAGGAGAATTGAACAAGAGCCGAAGGATTGCTTTTAGCACCACTTCATTACTGAAAGTAGCTCCTAATTCTGAGGAGAGGAATGTCATACATGAACTGTTTCTTAACACACTGGAT CCAAAGACTATAAGTTTTCAGAGTCGAATTTTGCCTCCTAAGGCAGTGTGGATGGAGGATACAAAACTCAAGAGCTTGGATATTTGTCACCCTCAGGAGCGAAACATTTTCAATAGGATTTTTGGTGG TTTTCTTATGAGAAAAGCATATGAACTTGCATGGGCTACAGCTTGTAGTTTTGGTGGTTCCCGGCCATATGTGGTAACAGTAGATGATATCATGTTTCAGAAACCTGTTGAAGTTGGCTCATTGCTCT TTCTTTCTTCACAGGTATGCTTCACCCAGGACAATTACATTCAAGTCAGAGTCCATAGTGAAGTGGCCTCTCTTGACAGTCGTGAGCATATGACCACCAATGTCTTTCATTTTACATTCATGTCAGAA AAAGAAGTACCCTTGATTTTCCCCAAAACATATGGAGAGTCCATGTTGTATTTAGATGGACAGCGGCATTTCAAGTCCATGAGTACCCCAGTGATCTTGAAAAAGAACTACACTGTGGAGCCCTAGGA AAAATCTCACTTGTTGCAAATCAGCACTTCAGGCACAGTGACATAGTGCCTAATAAAGGCATGCTGAGAAATATTGATGTTCACATTGCTTTTTTATCTTCCATAGAGGGGACTATATTCAACTTTTA GAATGATCAGAAAAGCAGAACAAGTGACTGAATGGGGCTAAGGGGTGAAAGAATGATTAAACAATAAAACCTTTTATAGTAATGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_039099644 ⟹ XP_038955572
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 43,922,943 - 43,973,311 (-) NCBI mRatBN7.2 X 40,073,197 - 40,123,573 (-) NCBI
RefSeq Acc Id:
XM_039099645 ⟹ XP_038955573
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 43,922,943 - 43,973,311 (-) NCBI mRatBN7.2 X 40,073,197 - 40,123,573 (-) NCBI
RefSeq Acc Id:
NP_001013982 ⟸ NM_001013960
- UniProtKB:
Q5U2X8 (UniProtKB/TrEMBL), F7ETS0 (UniProtKB/TrEMBL)
- Sequence:
MKRAAMRLWTLNKGLLTHGRGLAYGSENKICKPLHIQEVRNKLREIVGVSTIWRDHVKAMEERKLLHNFLATSQKALPPRKMKDSYIEVLLPLGSDPDLRDKYLTVQNTVRFGRILEDLDSLGVLVCY MHNQNHSTKMSPLSIVTVLVDKIDMCKYSLSPEQDIKFTGHVSWVGKTSMEVKMKMFQMHSDDKFWPVLDATFVMVARDSENKGPAFVNPLVPENKEEEELITQGELNKSRRIAFSTTSLLKVAPNSE ERNVIHELFLNTLDPKTISFQSRILPPKAVWMEDTKLKSLDICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSSQVCFTQDNYIQVRVHSEVASLDSRE HMTTNVFHFTFMSEKEVPLIFPKTYGESMLYLDGQRHFKSMSTPVILKKNYTVEP
hide sequence
Ensembl Acc Id:
ENSRNOP00000005033 ⟸ ENSRNOT00000005033
RefSeq Acc Id:
XP_038955573 ⟸ XM_039099645
- Peptide Label:
isoform X1
- UniProtKB:
A6IPR3 (UniProtKB/TrEMBL), F7ETS0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955572 ⟸ XM_039099644
- Peptide Label:
isoform X1
- UniProtKB:
A6IPR3 (UniProtKB/TrEMBL), F7ETS0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000089191 ⟸ ENSRNOT00000111580
Ensembl Acc Id:
ENSRNOP00000091656 ⟸ ENSRNOT00000113538
RGD ID: 13701818
Promoter ID: EPDNEW_R12342
Type: initiation region
Name: Acot9_1
Description: acyl-CoA thioesterase 9
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 43,592,272 - 43,592,332 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-05
Acot9
acyl-CoA thioesterase 9
LOC302640
similar to acyl-CoA thioesterase
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-07-29
LOC302640
similar to acyl-CoA thioesterase
Symbol and Name status set to provisional
70820
PROVISIONAL