Symbol:
LTB
Name:
lymphotoxin beta
RGD ID:
1353964
HGNC Page
HGNC:6711
Description:
Predicted to enable cytokine activity. Predicted to be involved in cell surface receptor signaling pathway; positive regulation of interleukin-12 production; and positive regulation of signal transduction. Predicted to act upstream of or within gene expression; lymph node development; and skin development. Predicted to be located in plasma membrane. Predicted to be active in extracellular space.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
LT-beta; lymphotoxin beta (TNF superfamily, member 3); lymphotoxin-beta; p33; TNF superfamily member 3; TNF-C; TNFC; TNFSF3; TNLG1C; tumor necrosis factor C; tumor necrosis factor ligand 1C; tumor necrosis factor ligand superfamily member 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Ltb (lymphotoxin B)
HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ltb (lymphotoxin beta)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Chinchilla lanigera (long-tailed chinchilla):
Ltb (lymphotoxin beta)
NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
LTB (lymphotoxin beta)
NCBI
Ortholog
Canis lupus familiaris (dog):
LTB (lymphotoxin beta)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ltb (lymphotoxin beta)
NCBI
Ortholog
Sus scrofa (pig):
LTB (lymphotoxin beta)
HGNC
Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
LTB (lymphotoxin beta)
NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Ltb (lymphotoxin beta)
NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ltb (lymphotoxin beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ltb (lymphotoxin B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
ltb.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
ltb
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
ltb.S
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 31,580,558 - 31,582,425 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 31,580,525 - 31,582,522 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 31,548,335 - 31,550,202 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 31,656,314 - 31,658,181 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 31,656,313 - 31,658,181 NCBI Celera 6 33,146,550 - 33,148,417 (-) NCBI Celera Cytogenetic Map 6 p21.33 NCBI HuRef 6 31,335,069 - 31,336,936 (-) NCBI HuRef CHM1_1 6 31,550,467 - 31,552,334 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 31,433,610 - 31,435,477 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
LTB Human (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of LTB mRNA CTD PMID:18247414 LTB Human 1,2-dimethylhydrazine increases expression ISO RGD:1551006 6480464 1,2-Dimethylhydrazine results in increased expression of LTB mRNA CTD PMID:22206623 LTB Human 1-chloro-2,4-dinitrobenzene increases expression ISO RGD:1551006 6480464 Dinitrochlorobenzene results in increased expression of LTB mRNA CTD PMID:19647056 LTB Human 1-naphthyl isothiocyanate increases expression ISO RGD:1303162 6480464 1-Naphthylisothiocyanate results in increased expression of LTB mRNA CTD PMID:25380136 LTB Human 1-nitropyrene increases expression EXP 6480464 1-nitropyrene results in increased expression of LTB mRNA CTD PMID:19428942|PMID:19879285 LTB Human 17alpha-ethynylestradiol multiple interactions ISO RGD:1551006 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LTB mRNA CTD PMID:17942748 LTB Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of LTB mRNA CTD PMID:23373633 LTB Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1551006 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LTB mRNA CTD PMID:17942748 LTB Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LTB mRNA CTD PMID:28351761 LTB Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1303162 6480464 Tetrachlorodibenzodioxin affects the expression of LTB mRNA CTD PMID:22298810 LTB Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1551006 6480464 Tetrachlorodibenzodioxin affects the expression of LTB mRNA CTD PMID:26377647 LTB Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1551006 6480464 Tetrachlorodibenzodioxin results in increased expression of LTB mRNA CTD PMID:21851831 LTB Human 2,4-dinitrotoluene affects expression ISO RGD:1303162 6480464 2,4-dinitrotoluene affects the expression of LTB mRNA CTD PMID:21346803 LTB Human 2,6-dinitrotoluene affects expression ISO RGD:1303162 6480464 2,6-dinitrotoluene affects the expression of LTB mRNA CTD PMID:21346803 LTB Human 2-butoxyethanol decreases expression ISO RGD:1551006 6480464 n-butoxyethanol results in decreased expression of LTB mRNA CTD PMID:19812364 LTB Human 2-naphthylamine decreases expression EXP 6480464 2-Naphthylamine results in decreased expression of LTB mRNA CTD PMID:18247414 LTB Human 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of LTB mRNA CTD PMID:28351761 LTB Human 3-Nitrofluoranthene increases expression EXP 6480464 3-nitrofluoranthene results in increased expression of LTB mRNA CTD PMID:19879285 LTB Human 4,4'-diaminodiphenylmethane increases expression ISO RGD:1303162 6480464 4,4'-diaminodiphenylmethane results in increased expression of LTB mRNA CTD PMID:25380136 LTB Human 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1551006 6480464 4,4'-diaminodiphenylmethane results in decreased expression of LTB mRNA CTD PMID:18648102 LTB Human 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1551006 6480464 bisphenol S results in decreased methylation of LTB promoter CTD PMID:33297965 LTB Human 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO RGD:1551006 6480464 Oxazolone results in increased expression of LTB mRNA CTD PMID:19647056 LTB Human 4-amino-2,6-dinitrotoluene affects expression ISO RGD:1303162 6480464 4-amino-2,6-dinitrotoluene affects the expression of LTB mRNA CTD PMID:21346803 LTB Human 4-hydroxynon-2-enal decreases expression ISO RGD:1551006 6480464 4-hydroxy-2-nonenal results in decreased expression of LTB mRNA CTD PMID:19191707 LTB Human 5'-S-methyl-5'-thioadenosine multiple interactions ISO RGD:1551006 6480464 5'-methylthioadenosine inhibits the reaction [fumonisin B1 results in increased expression of LTB mRNA] CTD PMID:17080400 LTB Human 6-propyl-2-thiouracil increases expression ISO RGD:1303162 6480464 Propylthiouracil results in increased expression of LTB mRNA CTD PMID:24780913 LTB Human all-trans-retinoic acid decreases expression ISO RGD:1551006 6480464 Tretinoin results in decreased expression of LTB mRNA CTD PMID:16604517 LTB Human alpha-Zearalanol increases expression ISO RGD:1303162 6480464 Zeranol results in increased expression of LTB mRNA CTD PMID:35163327 LTB Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of LTB mRNA CTD PMID:24449571 LTB Human aripiprazole multiple interactions EXP 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of LTB mRNA CTD PMID:31476115 LTB Human arsane affects expression EXP 6480464 Arsenic affects the expression of LTB protein CTD PMID:24675094 LTB Human arsane multiple interactions EXP 6480464 [Arsenic co-treated with Fluorides] results in decreased expression of LTB mRNA CTD PMID:19962721 LTB Human arsenic atom multiple interactions EXP 6480464 [Arsenic co-treated with Fluorides] results in decreased expression of LTB mRNA CTD PMID:19962721 LTB Human arsenic atom affects expression EXP 6480464 Arsenic affects the expression of LTB protein CTD PMID:24675094 LTB Human arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of LTB mRNA CTD PMID:24345465 LTB Human arsenous acid multiple interactions EXP 6480464 [sanguinarine co-treated with Arsenic Trioxide] results in increased expression of LTB mRNA CTD PMID:24345465 LTB Human asperentin increases expression ISO RGD:1551006 6480464 cladosporin results in increased expression of LTB mRNA CTD PMID:19818335 LTB Human benzalkonium chloride multiple interactions ISO RGD:1551006 6480464 [IL6 protein affects the susceptibility to Benzalkonium Compounds] which affects the expression of LTB mRNA CTD PMID:30171875 LTB Human benzene decreases expression ISO RGD:1551006 6480464 Benzene results in decreased expression of LTB mRNA CTD PMID:15120971 LTB Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of LTB mRNA CTD PMID:18247414|PMID:32234424 LTB Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of LTB promoter CTD PMID:27901495 LTB Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of LTB mRNA CTD PMID:28351761 LTB Human benzo[a]pyrene decreases expression ISO RGD:1551006 6480464 Benzo(a)pyrene results in decreased expression of LTB mRNA CTD PMID:21569818|PMID:22610609|PMID:25908611 LTB Human beta-naphthoflavone increases expression EXP 6480464 beta-Naphthoflavone results in increased expression of LTB mRNA CTD PMID:32151702 LTB Human bisphenol A affects expression ISO RGD:1303162 6480464 bisphenol A affects the expression of LTB mRNA CTD PMID:25181051 LTB Human bisphenol A increases expression ISO RGD:1551006 6480464 bisphenol A results in increased expression of LTB mRNA CTD PMID:32156529|PMID:38701888 LTB Human bisphenol A multiple interactions ISO RGD:1551006 6480464 [NR1H4 gene mutant form affects the susceptibility to bisphenol A] which results in decreased expression more ... CTD PMID:30245210 LTB Human bisphenol A decreases expression ISO RGD:1303162 6480464 bisphenol A results in decreased expression of LTB mRNA CTD PMID:30816183|PMID:32528016 LTB Human bisphenol F increases expression ISO RGD:1551006 6480464 bisphenol F results in increased expression of LTB mRNA CTD PMID:30951980 LTB Human bisphenol F decreases expression ISO RGD:1551006 6480464 bisphenol F results in decreased expression of LTB mRNA CTD PMID:38685157 LTB Human Brevianamide A increases expression ISO RGD:1551006 6480464 brevianamide A results in increased expression of LTB mRNA CTD PMID:19818335 LTB Human buta-1,3-diene decreases expression ISO RGD:1551006 6480464 1,3-butadiene results in decreased expression of LTB mRNA CTD PMID:29038090 LTB Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of LTB mRNA CTD PMID:12160620 LTB Human cadmium dichloride increases expression ISO RGD:1303162 6480464 Cadmium Chloride results in increased expression of LTB mRNA CTD PMID:25993096 LTB Human cadmium dichloride decreases methylation ISO RGD:1303162 6480464 Cadmium Chloride results in decreased methylation of LTB promoter CTD PMID:22457795 LTB Human calcitriol increases expression EXP 6480464 Calcitriol results in increased expression of LTB mRNA CTD PMID:22615136 LTB Human cannabidiol multiple interactions EXP 6480464 Cannabidiol inhibits the reaction [TNF protein results in increased expression of LTB mRNA] CTD PMID:31250491 LTB Human carbon nanotube affects expression ISO RGD:1551006 6480464 Nanotubes, Carbon affects the expression of LTB mRNA; Nanotubes, Carbon analog affects the expression of more ... CTD PMID:25554681 LTB Human chloroprene decreases expression ISO RGD:1551006 6480464 Chloroprene results in decreased expression of LTB mRNA CTD PMID:23125180 LTB Human chloroquine increases expression EXP 6480464 Chloroquine results in increased expression of LTB CTD PMID:15139008 LTB Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of LTB mRNA CTD PMID:27594783 LTB Human clorgyline increases expression EXP 6480464 Clorgyline results in increased expression of LTB mRNA CTD PMID:19691856 LTB Human curcumin increases expression EXP 6480464 Curcumin results in increased expression of LTB mRNA CTD PMID:17198877 LTB Human curcumin decreases expression ISO RGD:1551006 6480464 Curcumin results in decreased expression of LTB mRNA CTD PMID:16751071 LTB Human deoxynivalenol decreases expression ISO RGD:1551006 6480464 deoxynivalenol results in decreased expression of LTB mRNA CTD PMID:22968694 LTB Human dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of LTB mRNA CTD PMID:12782123 LTB Human dexamethasone increases expression ISO RGD:1551006 6480464 Dexamethasone results in increased expression of LTB mRNA CTD PMID:21041162 LTB Human diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of LTB mRNA CTD PMID:24345465 LTB Human diarsenic trioxide multiple interactions EXP 6480464 [sanguinarine co-treated with Arsenic Trioxide] results in increased expression of LTB mRNA CTD PMID:24345465 LTB Human dibenzo[a,l]pyrene decreases expression ISO RGD:1551006 6480464 dibenzo(a,l)pyrene results in decreased expression of LTB mRNA CTD PMID:25908611 LTB Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of LTB mRNA CTD PMID:37042841 LTB Human dimethylarsinic acid multiple interactions ISO RGD:1551006 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 LTB Human dioxygen multiple interactions ISO RGD:1551006 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of LTB mRNA CTD PMID:30529165 LTB Human diquat decreases expression ISO RGD:1551006 6480464 Diquat results in decreased expression of LTB mRNA CTD PMID:36851058 LTB Human disodium selenite decreases expression EXP 6480464 Sodium Selenite results in decreased expression of LTB mRNA CTD PMID:16705456 LTB Human diuron decreases expression EXP 6480464 Diuron results in decreased expression of LTB mRNA CTD PMID:35967413 LTB Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 LTB Human doxorubicin multiple interactions ISO RGD:1303162 6480464 Doxorubicin inhibits the reaction [Fungal Polysaccharides results in increased expression of LTB mRNA] CTD PMID:27181935 LTB Human ethylparaben increases expression EXP 6480464 ethyl-p-hydroxybenzoate results in increased expression of LTB mRNA CTD PMID:37690743 LTB Human fentanyl increases expression ISO RGD:1303162 6480464 Fentanyl results in increased expression of LTB mRNA CTD PMID:36032789 LTB Human fumonisin B1 increases expression ISO RGD:1551006 6480464 fumonisin B1 results in increased expression of LTB mRNA CTD PMID:15590129|PMID:17080400 LTB Human fumonisin B1 multiple interactions ISO RGD:1551006 6480464 5'-methylthioadenosine inhibits the reaction [fumonisin B1 results in increased expression of LTB mRNA]; S-Adenosylmethionine inhibits more ... CTD PMID:17080400 LTB Human furan increases expression ISO RGD:1303162 6480464 furan results in increased expression of LTB mRNA CTD PMID:27387713 LTB Human furosemide affects expression ISO RGD:1303162 6480464 Furosemide affects the expression of LTB mRNA CTD PMID:17497460 LTB Human gadolinium trichloride increases expression ISO RGD:1551006 6480464 gadolinium chloride results in increased expression of LTB mRNA CTD PMID:15590129 LTB Human glafenine increases expression ISO RGD:1303162 6480464 Glafenine results in increased expression of LTB mRNA CTD PMID:24136188 LTB Human GSK-J4 decreases expression EXP 6480464 GSK-J4 results in decreased expression of LTB mRNA CTD PMID:29301935 LTB Human hydrogen peroxide multiple interactions EXP 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of LTB protein CTD PMID:18951874 LTB Human leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of LTB mRNA CTD PMID:28988120 LTB Human lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of LTB mRNA CTD PMID:19428942|PMID:31059760 LTB Human lipopolysaccharide multiple interactions EXP 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of LTB mRNA CTD PMID:31059760 LTB Human lipopolysaccharide increases expression ISO RGD:1551006 6480464 Lipopolysaccharides results in increased expression of LTB mRNA; Lipopolysaccharides results in increased expression of LTB more ... CTD PMID:14644621|PMID:21135813 LTB Human methylarsonic acid multiple interactions ISO RGD:1551006 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 LTB Human Muraglitazar affects expression ISO RGD:1303162 6480464 muraglitazar affects the expression of LTB mRNA CTD PMID:21515302 LTB Human mycophenolic acid increases expression ISO RGD:1551006 6480464 Mycophenolic Acid results in increased expression of LTB mRNA CTD PMID:19818335 LTB Human mycotoxin increases expression ISO RGD:1551006 6480464 Mycotoxins results in increased expression of LTB mRNA CTD PMID:19818335 LTB Human N-methyl-N-nitrosourea decreases response to substance ISO RGD:1551006 6480464 LTB protein results in decreased susceptibility to Methylnitrosourea CTD PMID:15240709 LTB Human N-nitrosodiethylamine increases expression ISO RGD:1551006 6480464 Diethylnitrosamine results in increased expression of LTB mRNA CTD PMID:15765122|PMID:24535843 LTB Human N-nitrosodimethylamine increases expression ISO RGD:1303162 6480464 Dimethylnitrosamine results in increased expression of LTB mRNA CTD PMID:25380136 LTB Human neoechinulin A increases expression ISO RGD:1551006 6480464 neoechinulin A results in increased expression of LTB mRNA CTD PMID:19818335 LTB Human nickel atom increases expression EXP 6480464 Nickel results in increased expression of LTB mRNA CTD PMID:25583101 LTB Human nickel dichloride increases expression EXP 6480464 nickel chloride results in increased expression of LTB mRNA CTD PMID:17312168 LTB Human nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of LTB mRNA CTD PMID:18247414 LTB Human nitrates multiple interactions ISO RGD:1551006 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of LTB more ... CTD PMID:35964746 LTB Human oxaliplatin increases expression ISO RGD:1303162 6480464 oxaliplatin results in increased expression of LTB mRNA CTD PMID:25729387 LTB Human oxaliplatin multiple interactions ISO RGD:1303162 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LTB mRNA CTD PMID:25729387 LTB Human ozone decreases expression ISO RGD:1551006 6480464 Ozone results in decreased expression of LTB mRNA CTD PMID:12763052|PMID:26342085|PMID:30848106 LTB Human ozone multiple interactions EXP 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of LTB mRNA CTD PMID:31476115 LTB Human ozone increases expression EXP 6480464 Ozone results in increased expression of LTB mRNA CTD PMID:31476115 LTB Human ozone multiple interactions ISO RGD:1551006 6480464 [[LTA gene mutant form co-treated with TNF gene mutant form co-treated with LTB gene mutant more ... CTD PMID:20032013|PMID:34911549 LTB Human paracetamol affects expression ISO RGD:1551006 6480464 Acetaminophen affects the expression of LTB mRNA CTD PMID:17562736 LTB Human paracetamol multiple interactions EXP 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of LTB mRNA CTD PMID:31059760 LTB Human paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of LTB mRNA CTD PMID:31059760 LTB Human perfluorohexanesulfonic acid decreases expression EXP 6480464 perfluorohexanesulfonic acid results in decreased expression of LTB mRNA CTD PMID:25812627 LTB Human perfluorononanoic acid decreases expression EXP 6480464 perfluoro-n-nonanoic acid results in decreased expression of LTB mRNA CTD PMID:25812627 LTB Human perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of LTB mRNA CTD PMID:25812627 LTB Human perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of LTB mRNA CTD PMID:25812627 LTB Human PF-3758309 increases expression EXP 6480464 PF 3758309 results in increased expression of LTB mRNA CTD PMID:29048629 LTB Human progesterone increases expression EXP 6480464 Progesterone results in increased expression of LTB mRNA CTD PMID:22615136 LTB Human raloxifene decreases expression EXP 6480464 Raloxifene Hydrochloride results in decreased expression of LTB mRNA CTD PMID:19429434 LTB Human S-adenosyl-L-methioninate multiple interactions ISO RGD:1551006 6480464 S-Adenosylmethionine inhibits the reaction [fumonisin B1 results in increased expression of LTB mRNA] CTD PMID:17080400 LTB Human S-adenosyl-L-methionine multiple interactions ISO RGD:1551006 6480464 S-Adenosylmethionine inhibits the reaction [fumonisin B1 results in increased expression of LTB mRNA] CTD PMID:17080400 LTB Human sanguinarine multiple interactions EXP 6480464 [sanguinarine co-treated with arsenic trioxide] results in increased expression of LTB mRNA CTD PMID:24345465 LTB Human sanguinarine increases expression EXP 6480464 sanguinarine results in increased expression of LTB mRNA CTD PMID:24345465 LTB Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 LTB Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of LTB mRNA; Silicon Dioxide results in increased more ... CTD PMID:19428942|PMID:23806026 LTB Human silicon dioxide increases expression ISO RGD:1303162 6480464 Silicon Dioxide results in increased expression of LTB mRNA CTD PMID:22431001 LTB Human silicon dioxide increases expression ISO RGD:1551006 6480464 Silicon Dioxide results in increased expression of LTB mRNA CTD PMID:23221170|PMID:29341224 LTB Human silver atom decreases expression ISO RGD:1551006 6480464 Silver results in decreased expression of LTB mRNA CTD PMID:27131904 LTB Human silver(0) decreases expression ISO RGD:1551006 6480464 Silver results in decreased expression of LTB mRNA CTD PMID:27131904 LTB Human simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of LTB mRNA CTD PMID:17428261 LTB Human sodium arsenate multiple interactions ISO RGD:1551006 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 LTB Human sodium arsenite increases expression ISO RGD:1551006 6480464 sodium arsenite results in increased expression of LTB mRNA CTD PMID:21911445|PMID:37682722 LTB Human sodium arsenite multiple interactions ISO RGD:1551006 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 LTB Human succimer multiple interactions ISO RGD:1551006 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of LTB mRNA CTD PMID:21641980 LTB Human testosterone multiple interactions ISO RGD:1551006 6480464 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane inhibits the reaction [Testosterone deficiency results in increased expression of LTB mRNA] CTD PMID:33848595 LTB Human testosterone increases expression ISO RGD:1551006 6480464 Testosterone deficiency results in increased expression of LTB mRNA CTD PMID:33848595 LTB Human tetrachloromethane multiple interactions ISO RGD:1551006 6480464 CCL2 gene mutant form inhibits the reaction [Carbon Tetrachloride results in increased expression of LTB more ... CTD PMID:17125873|PMID:18395288 LTB Human tetrachloromethane increases expression ISO RGD:1551006 6480464 Carbon Tetrachloride results in increased expression of LTB mRNA CTD PMID:17125873|PMID:18395288 LTB Human theophylline multiple interactions EXP 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of LTB protein CTD PMID:18951874 LTB Human titanium dioxide decreases expression ISO RGD:1551006 6480464 titanium dioxide results in decreased expression of LTB mRNA CTD PMID:27760801 LTB Human titanium dioxide decreases methylation ISO RGD:1551006 6480464 titanium dioxide results in decreased methylation of LTB gene CTD PMID:35295148 LTB Human titanium dioxide increases expression ISO RGD:1303162 6480464 titanium dioxide results in increased expression of LTB mRNA CTD PMID:30012374 LTB Human TMC-120A decreases expression ISO RGD:1551006 6480464 TMC 120A results in decreased expression of LTB mRNA CTD PMID:19818335 LTB Human toluene 2,4-diisocyanate multiple interactions ISO RGD:1551006 6480464 TNF protein affects the reaction [Toluene 2,4-Diisocyanate results in increased expression of LTB mRNA] CTD PMID:12356572 LTB Human toluene 2,4-diisocyanate increases expression ISO RGD:1551006 6480464 Toluene 2,4-Diisocyanate results in increased expression of LTB mRNA CTD PMID:11467998|PMID:12356572|PMID:19647056 LTB Human topotecan multiple interactions ISO RGD:1303162 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LTB mRNA CTD PMID:25729387 LTB Human topotecan increases expression ISO RGD:1303162 6480464 Topotecan results in increased expression of LTB mRNA CTD PMID:25729387 LTB Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of LTB mRNA CTD PMID:24935251|PMID:26272509 LTB Human trichostatin A multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 LTB Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of LTB mRNA CTD PMID:37042841 LTB Human triptonide increases expression ISO RGD:1551006 6480464 triptonide results in increased expression of LTB mRNA CTD PMID:33045310 LTB Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of LTB mRNA CTD PMID:29154799 LTB Human vinclozolin increases methylation ISO RGD:1303162 6480464 vinclozolin results in increased methylation of LTB gene CTD PMID:31079544 LTB Human vitamin E increases expression EXP 6480464 Vitamin E results in increased expression of LTB mRNA CTD PMID:19244175 LTB Human zaragozic acid A increases expression ISO RGD:1303162 6480464 squalestatin 1 results in increased expression of LTB mRNA CTD PMID:27225895 LTB Human zaragozic acid A decreases expression ISO RGD:1551006 6480464 squalestatin 1 results in decreased expression of LTB mRNA CTD PMID:27225895 LTB Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of LTB mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
(S)-nicotine (EXP) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (ISO) 1-nitropyrene (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-butoxyethanol (ISO) 2-naphthylamine (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-Nitrofluoranthene (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-amino-2,6-dinitrotoluene (ISO) 4-hydroxynon-2-enal (ISO) 5'-S-methyl-5'-thioadenosine (ISO) 6-propyl-2-thiouracil (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (ISO) antirheumatic drug (EXP) aripiprazole (EXP) arsane (EXP) arsenic atom (EXP) arsenous acid (EXP) asperentin (ISO) benzalkonium chloride (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) beta-naphthoflavone (EXP) bisphenol A (ISO) bisphenol F (ISO) Brevianamide A (ISO) buta-1,3-diene (ISO) cadmium dichloride (EXP,ISO) calcitriol (EXP) cannabidiol (EXP) carbon nanotube (ISO) chloroprene (ISO) chloroquine (EXP) cisplatin (EXP) clorgyline (EXP) curcumin (EXP,ISO) deoxynivalenol (ISO) dexamethasone (EXP,ISO) diarsenic trioxide (EXP) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (EXP) dimethylarsinic acid (ISO) dioxygen (ISO) diquat (ISO) disodium selenite (EXP) diuron (EXP) dorsomorphin (EXP) doxorubicin (ISO) ethylparaben (EXP) fentanyl (ISO) fumonisin B1 (ISO) furan (ISO) furosemide (ISO) gadolinium trichloride (ISO) glafenine (ISO) GSK-J4 (EXP) hydrogen peroxide (EXP) leflunomide (EXP) lipopolysaccharide (EXP,ISO) methylarsonic acid (ISO) Muraglitazar (ISO) mycophenolic acid (ISO) mycotoxin (ISO) N-methyl-N-nitrosourea (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) neoechinulin A (ISO) nickel atom (EXP) nickel dichloride (EXP) nicotine (EXP) nitrates (ISO) oxaliplatin (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (EXP) perfluorononanoic acid (EXP) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (EXP) PF-3758309 (EXP) progesterone (EXP) raloxifene (EXP) S-adenosyl-L-methioninate (ISO) S-adenosyl-L-methionine (ISO) sanguinarine (EXP) SB 431542 (EXP) silicon dioxide (EXP,ISO) silver atom (ISO) silver(0) (ISO) simvastatin (EXP) sodium arsenate (ISO) sodium arsenite (ISO) succimer (ISO) testosterone (ISO) tetrachloromethane (ISO) theophylline (EXP) titanium dioxide (ISO) TMC-120A (ISO) toluene 2,4-diisocyanate (ISO) topotecan (ISO) trichostatin A (EXP) triphenyl phosphate (EXP) triptonide (ISO) valproic acid (EXP) vinclozolin (ISO) vitamin E (EXP) zaragozic acid A (ISO) zoledronic acid (EXP)
LTB (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 31,580,558 - 31,582,425 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 31,580,525 - 31,582,522 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 31,548,335 - 31,550,202 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 31,656,314 - 31,658,181 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 31,656,313 - 31,658,181 NCBI Celera 6 33,146,550 - 33,148,417 (-) NCBI Celera Cytogenetic Map 6 p21.33 NCBI HuRef 6 31,335,069 - 31,336,936 (-) NCBI HuRef CHM1_1 6 31,550,467 - 31,552,334 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 31,433,610 - 31,435,477 (-) NCBI T2T-CHM13v2.0
Ltb (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 35,413,483 - 35,415,281 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 35,413,415 - 35,415,296 (+) Ensembl GRCm39 Ensembl GRCm38 17 35,194,507 - 35,196,305 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 35,194,439 - 35,196,320 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 35,331,452 - 35,333,250 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 34,802,574 - 34,804,354 (+) NCBI MGSCv36 mm8 Celera 17 38,291,216 - 38,293,014 (+) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 18.59 NCBI
Ltb (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,632,209 - 3,634,054 (-) NCBI GRCr8 mRatBN7.2 20 3,627,536 - 3,629,381 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,627,537 - 3,629,381 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 4,327,296 - 4,329,142 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 3,689,354 - 3,691,200 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 4,226,971 - 4,228,817 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 5,184,631 - 5,186,476 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 5,184,515 - 5,186,503 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 4,861,335 - 4,863,198 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 6,941,753 - 6,943,598 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,666,524 - 3,668,369 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,666,751 - 3,668,596 (-) NCBI Celera 20 4,396,109 - 4,397,954 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
Ltb (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955437 120,966 - 123,973 (-) NCBI ChiLan1.0 ChiLan1.0
LTB (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 46,057,500 - 46,060,073 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 42,019,081 - 42,024,574 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 31,241,643 - 31,244,454 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 32,131,607 - 32,133,468 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 32,131,760 - 32,133,467 (-) Ensembl panpan1.1 panPan2
LTB (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 1,079,340 - 1,084,785 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 1,079,358 - 1,081,153 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 1,215,801 - 1,217,596 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 1,224,605 - 1,226,400 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 1,224,605 - 1,226,400 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 1,083,338 - 1,085,125 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 1,151,270 - 1,153,063 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 1,218,053 - 1,219,848 (-) NCBI UU_Cfam_GSD_1.0
Ltb (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 35,628,995 - 35,650,426 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936727 1,910,881 - 1,932,356 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936727 1,929,533 - 1,932,339 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LTB (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 23,704,841 - 23,706,745 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 23,704,842 - 23,707,036 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 27,545,187 - 27,547,163 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LTB (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666044 31,482,890 - 31,485,770 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ltb (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 1005 Count of miRNA genes: 583 Interacting mature miRNAs: 669 Transcripts: ENST00000429299, ENST00000446745, ENST00000482429, ENST00000483972 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358854 MULTSCL4_H Multiple sclerosis susceptibility QTL 4 (human) Multiple sclerosis susceptibility 6 6911960 32911960 Human 1358839 MULTSCL5_H Multiple sclerosis susceptibility QTL 5 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 597503003 GWAS1599077_H trait in response to apixaban QTL GWAS1599077 (human) 6e-08 trait in response to apixaban 6 31581779 31581780 Human 1643377 BW325_H Body weight QTL 325 (human) 2.32 0.0005 Body fat amount 6 6911960 32911960 Human 1643569 GLUCO21_H Glucose level QTL 21 (human) 0.021 Glucose level non-insulin-dependent 6 6911960 32911960 Human 1298458 BW9_H Body weight QTL 9 (human) 2.7 0.0002 Body fat amount 6 6911960 32911960 Human 1298431 RA11_H Rheumatoid arthritis QTL 11 (human) 0.0000024 Joint/bone inflammation rheumatoid arthritis 6 19911883 40191709 Human 1358857 MULTSCL19_H Multiple sclerosis susceptibility QTL 19 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 1643399 BMD5_H Bone mineral density QTL 5 (human) 2.32 0.0005 Bone mineral density 6 6911960 32911960 Human
RH75844
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 31,548,335 - 31,548,490 UniSTS GRCh37 Build 36 6 31,656,314 - 31,656,469 RGD NCBI36 Celera 6 33,146,550 - 33,146,705 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 31,335,069 - 31,335,224 UniSTS
UniSTS:483258
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 31,548,911 - 31,550,200 UniSTS GRCh37 Celera 6 33,147,126 - 33,148,415 UniSTS HuRef 6 31,335,645 - 31,336,934 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2405
2763
2233
4906
1724
2320
5
624
1943
465
2241
7231
6434
36
3691
1
842
1727
1586
173
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000429299 ⟹ ENSP00000410481
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 31,580,558 - 31,582,424 (-) Ensembl
Ensembl Acc Id:
ENST00000446745 ⟹ ENSP00000416113
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 31,580,555 - 31,582,427 (-) Ensembl
Ensembl Acc Id:
ENST00000482429
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 31,580,624 - 31,582,406 (-) Ensembl
Ensembl Acc Id:
ENST00000483972
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 31,580,525 - 31,582,522 (-) Ensembl
RefSeq Acc Id:
NM_002341 ⟹ NP_002332
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 31,580,558 - 31,582,424 (-) NCBI GRCh37 6 31,548,335 - 31,550,202 (-) ENTREZGENE Build 36 6 31,656,314 - 31,658,181 (-) NCBI Archive HuRef 6 31,335,069 - 31,336,936 (-) ENTREZGENE CHM1_1 6 31,550,467 - 31,552,334 (-) NCBI T2T-CHM13v2.0 6 31,433,610 - 31,435,476 (-) NCBI
Sequence:
AGTCTCAATGGGGGCACTGGGGCTGGAGGGCAGGGGTGGGAGGCTCCAGGGGAGGGGTTCCCTCCTGCTAGCTGTGGCAGGAGCCACTTCTCTGGTGACCTTGTTGCTGGCGGTGCCTATCACTGTCC TGGCTGTGCTGGCCTTAGTGCCCCAGGATCAGGGAGGACTGGTAACGGAGACGGCCGACCCCGGGGCACAGGCCCAGCAAGGACTGGGGTTTCAGAAGCTGCCAGAGGAGGAGCCAGAAACAGATCTC AGCCCCGGGCTCCCAGCTGCCCACCTCATAGGCGCTCCGCTGAAGGGGCAGGGGCTAGGCTGGGAGACGACGAAGGAACAGGCGTTTCTGACGAGCGGGACGCAGTTCTCGGACGCCGAGGGGCTGGC GCTCCCGCAGGACGGCCTCTATTACCTCTACTGTCTCGTCGGCTACCGGGGCCGGGCGCCCCCTGGCGGCGGGGACCCCCAGGGCCGCTCGGTCACGCTGCGCAGCTCTCTGTACCGGGCGGGGGGCG CCTACGGGCCGGGCACTCCCGAGCTGCTGCTCGAGGGCGCCGAGACGGTGACTCCAGTGCTGGACCCGGCCAGGAGACAAGGGTACGGGCCTCTCTGGTACACGAGCGTGGGGTTCGGCGGCCTGGTG CAGCTCCGGAGGGGCGAGAGGGTGTACGTCAACATCAGTCACCCCGATATGGTGGACTTCGCGAGAGGGAAGACCTTCTTTGGGGCCGTGATGGTGGGGTGAGGGAATATGAGTGCGTGGTGCGAGTG CGTGAATATTGGGGGCCCGGACGCCCAGGACCCCATGGCAGTGGGAAAAATGTAGGAGACTGTTTGGAAATTGATTTTGAACCTGATGAAAATAAAGAATGGAAAGCTTCAGTGCTGCCGATAAA
hide sequence
RefSeq Acc Id:
NM_009588 ⟹ NP_033666
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 31,580,558 - 31,582,425 (-) NCBI GRCh37 6 31,548,335 - 31,550,202 (-) ENTREZGENE Build 36 6 31,656,314 - 31,658,181 (-) NCBI Archive HuRef 6 31,335,069 - 31,336,936 (-) ENTREZGENE CHM1_1 6 31,550,467 - 31,552,334 (-) NCBI T2T-CHM13v2.0 6 31,433,610 - 31,435,477 (-) NCBI
Sequence:
CAGTCTCAATGGGGGCACTGGGGCTGGAGGGCAGGGGTGGGAGGCTCCAGGGGAGGGGTTCCCTCCTGCTAGCTGTGGCAGGAGCCACTTCTCTGGTGACCTTGTTGCTGGCGGTGCCTATCACTGTC CTGGCTGTGCTGGCCTTAGTGCCCCAGGATCAGGGAGGACTGGGTTTCAGAAGCTGCCAGAGGAGGAGCCAGAAACAGATCTCAGCCCCGGGCTCCCAGCTGCCCACCTCATAGGCGCTCCGCTGAAG GGGCAGGGGCTAGGCTGGGAGACGACGAAGGAACAGGCGTTTCTGACGAGCGGGACGCAGTTCTCGGACGCCGAGGGGCTGGCGCTCCCGCAGGACGGCCTCTATTACCTCTACTGTCTCGTCGGCTA CCGGGGCCGGGCGCCCCCTGGCGGCGGGGACCCCCAGGGCCGCTCGGTCACGCTGCGCAGCTCTCTGTACCGGGCGGGGGGCGCCTACGGGCCGGGCACTCCCGAGCTGCTGCTCGAGGGCGCCGAGA CGGTGACTCCAGTGCTGGACCCGGCCAGGAGACAAGGGTACGGGCCTCTCTGGTACACGAGCGTGGGGTTCGGCGGCCTGGTGCAGCTCCGGAGGGGCGAGAGGGTGTACGTCAACATCAGTCACCCC GATATGGTGGACTTCGCGAGAGGGAAGACCTTCTTTGGGGCCGTGATGGTGGGGTGAGGGAATATGAGTGCGTGGTGCGAGTGCGTGAATATTGGGGGCCCGGACGCCCAGGACCCCATGGCAGTGGG AAAAATGTAGGAGACTGTTTGGAAATTGATTTTGAACCTGATGAAAATAAAGAATGGAAAGCTTCAGTGCTGCCGATAAA
hide sequence
RefSeq Acc Id:
NP_033666 ⟸ NM_009588
- Peptide Label:
isoform b
- UniProtKB:
Q06643 (UniProtKB/Swiss-Prot)
- Sequence:
MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLGFRSCQRRSQKQISAPGSQLPTS
hide sequence
RefSeq Acc Id:
NP_002332 ⟸ NM_002341
- Peptide Label:
isoform a
- UniProtKB:
Q52LU8 (UniProtKB/Swiss-Prot), P78370 (UniProtKB/Swiss-Prot), Q99761 (UniProtKB/Swiss-Prot), Q06643 (UniProtKB/Swiss-Prot), Q5STB2 (UniProtKB/TrEMBL), A8MQV6 (UniProtKB/TrEMBL)
- Sequence:
MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALP QDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
hide sequence
Ensembl Acc Id:
ENSP00000410481 ⟸ ENST00000429299
Ensembl Acc Id:
ENSP00000416113 ⟸ ENST00000446745
RGD ID: 6872606
Promoter ID: EPDNEW_H9427
Type: initiation region
Name: LTB_1
Description: lymphotoxin beta
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_H9432
Experiment Methods: Single-end sequencing.
Position: Human Assembly Chr Position (strand) Source GRCh38 6 31,582,424 - 31,582,484 EPDNEW
RGD ID: 6872534
Promoter ID: EPDNEW_H9432
Type: initiation region
Name: LTB_2
Description: lymphotoxin beta
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_H9427
Experiment Methods: Single-end sequencing.; Paired-end sequencing.
Position: Human Assembly Chr Position (strand) Source GRCh38 6 31,586,915 - 31,586,975 EPDNEW
RGD ID: 6804420
Promoter ID: HG_KWN:52938
Type: Non-CpG
SO ACC ID: SO:0000170
Source: MPROMDB
Tissues & Cell Lines: CD4+TCell, CD4+TCell_2Hour, K562, Lymphoblastoid, NB4
Transcripts: OTTHUMT00000076239, OTTHUMT00000076240, OTTHUMT00000259102
Position: Human Assembly Chr Position (strand) Source Build 36 6 31,657,921 - 31,658,567 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-24
LTB
lymphotoxin beta
LTB
lymphotoxin beta (TNF superfamily, member 3)
Symbol and/or name change
5135510
APPROVED