Advanced Search (OLGA)

Gene: TARS3 (threonyl-tRNA synthetase 3) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

TARS3

Name:

threonyl-tRNA synthetase 3

RGD ID:

1351710

HGNC Page

HGNC:24728

Description:

Predicted to enable threonine-tRNA ligase activity. Predicted to be involved in threonyl-tRNA aminoacylation. Predicted to be located in cytoplasm and nucleus. Predicted to be active in mitochondrion.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

FLJ25005; probable threonine--tRNA ligase 2, cytoplasmic; probable threonyl-tRNA synthetase 2, cytoplasmic; TARSL2; threonine--tRNA ligase; threonine--tRNA ligase 2, cytoplasmic; threonyl-tRNA synthetase; threonyl-tRNA synthetase like 2; threonyl-tRNA synthetase protein 3; threonyl-tRNA synthetase-like 2; threonyl-tRNA synthetase-like protein 2; thrRS; ThrRS-L

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Tars3 (threonyl-tRNA synthetase 3)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Tars3 (threonyl-tRNA synthetase 3)	HGNC	Ensembl, HomoloGene, NCBI, OMA, Panther, PhylomeDB
Chinchilla lanigera (long-tailed chinchilla):	Tars3 (threonyl-tRNA synthetase 3)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	TARS3 (threonyl-tRNA synthetase 3)	NCBI	Ortholog
Canis lupus familiaris (dog):	TARS3 (threonyl-tRNA synthetase 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tars3 (threonyl-tRNA synthetase 3)	NCBI	Ortholog
Sus scrofa (pig):	TARS3 (threonyl-tRNA synthetase 3)	HGNC	Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):	TARS3 (threonyl-tRNA synthetase 3)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Tars3 (threonyl-tRNA synthetase 3)	NCBI	Ortholog
Other homologs ²
Mus musculus (house mouse):	Tars1 (threonyl-tRNA synthetase 1)	HGNC	OrthoMCL
Mus musculus (house mouse):	Tars2 (threonyl-tRNA synthetase 2, mitochondrial (putative))	HGNC	OrthoMCL
Rattus norvegicus (Norway rat):	Cmpk2 (cytidine/uridine monophosphate kinase 2)	HGNC	OMA
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Tars3 (threonyl-tRNA synthetase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|OMA\|OrthoFinder\|PhylomeDB)
Mus musculus (house mouse):	Tars3 (threonyl-tRNA synthetase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tarsl2 (threonyl-tRNA synthetase-like 2)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB\|ZFIN)
Drosophila melanogaster (fruit fly):	ThrRS	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	THS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tars-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tars3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	tars3.L	Alliance	DIOPT (Xenbase)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	101,653,596 - 101,724,473 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	101,653,596 - 101,724,473 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	102,193,799 - 102,264,676 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	100,011,478 - 100,082,168 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	100,011,477 - 100,082,168	NCBI
Celera	15	78,607,580 - 78,678,213 (-)	NCBI		Celera
Cytogenetic Map	15	q26.3	NCBI
HuRef	15	78,317,749 - 78,388,310 (-)	NCBI		HuRef
CHM1_1	15	102,035,085 - 102,105,711 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	99,411,600 - 99,482,344 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TARS3	Human	1,2-dimethylhydrazine	affects expression	ISO	Tars3 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine affects the expression of TARS3 mRNA	CTD	PMID:22206623
TARS3	Human	17beta-estradiol	multiple interactions	EXP		6480464	[Estradiol co-treated with TGFB1 protein] results in increased expression of TARS3 mRNA	CTD	PMID:30165855
TARS3	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Tars3 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of TARS3 mRNA	CTD	PMID:21570461
TARS3	Human	aflatoxin B1	decreases expression	ISO	Tars3 (Mus musculus)	6480464	Aflatoxin B1 results in decreased expression of TARS3 mRNA	CTD	PMID:19770486
TARS3	Human	all-trans-retinoic acid	decreases expression	EXP		6480464	Tretinoin results in decreased expression of TARS3 mRNA	CTD	PMID:33167477
TARS3	Human	arsenite(3-)	increases expression	ISO	Tars3 (Mus musculus)	6480464	arsenite results in increased expression of TARS3 protein	CTD	PMID:37955338
TARS3	Human	benzo[a]pyrene	increases methylation	EXP		6480464	Benzo(a)pyrene results in increased methylation of TARS3 3' UTR	CTD	PMID:27901495
TARS3	Human	benzo[a]pyrene	affects methylation	EXP		6480464	Benzo(a)pyrene affects the methylation of TARS3 promoter	CTD	PMID:27901495
TARS3	Human	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TARS3 mRNA	CTD	PMID:22576693 and PMID:31715268
TARS3	Human	bisphenol A	increases expression	ISO	Tars3 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of TARS3 mRNA	CTD	PMID:34947998
TARS3	Human	bisphenol A	increases methylation	ISO	Tars3 (Rattus norvegicus)	6480464	bisphenol A results in increased methylation of TARS3 gene	CTD	PMID:28505145
TARS3	Human	bisphenol A	decreases expression	ISO	Tars3 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of TARS3 mRNA	CTD	PMID:25181051
TARS3	Human	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of TARS3 gene	CTD	PMID:22576693
TARS3	Human	bisphenol F	increases expression	ISO	Tars3 (Mus musculus)	6480464	bisphenol F results in increased expression of TARS3 mRNA	CTD	PMID:38685157
TARS3	Human	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TARS3 mRNA	CTD	PMID:35301059
TARS3	Human	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of TARS3 mRNA	CTD	PMID:38568856
TARS3	Human	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TARS3 mRNA	CTD	PMID:35301059
TARS3	Human	choline	multiple interactions	ISO	Tars3 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of TARS3 mRNA	CTD	PMID:20938992
TARS3	Human	cisplatin	multiple interactions	EXP		6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of TARS3 mRNA	CTD	PMID:27392435
TARS3	Human	copper(II) sulfate	decreases expression	EXP		6480464	Copper Sulfate results in decreased expression of TARS3 mRNA	CTD	PMID:19549813
TARS3	Human	cyclosporin A	decreases expression	ISO	Tars3 (Mus musculus)	6480464	Cyclosporine results in decreased expression of TARS3 mRNA	CTD	PMID:19770486
TARS3	Human	dicrotophos	decreases expression	EXP		6480464	dicrotophos results in decreased expression of TARS3 mRNA	CTD	PMID:28302478
TARS3	Human	dorsomorphin	multiple interactions	EXP		6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TARS3 mRNA	CTD	PMID:27188386
TARS3	Human	epoxiconazole	decreases expression	ISO	Tars3 (Mus musculus)	6480464	epoxiconazole results in decreased expression of TARS3 mRNA	CTD	PMID:35436446
TARS3	Human	flutamide	decreases expression	ISO	Tars3 (Rattus norvegicus)	6480464	Flutamide results in decreased expression of TARS3 mRNA	CTD	PMID:24793618
TARS3	Human	folic acid	multiple interactions	ISO	Tars3 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of TARS3 mRNA	CTD	PMID:20938992
TARS3	Human	formaldehyde	increases expression	EXP		6480464	Formaldehyde results in increased expression of TARS3 mRNA	CTD	PMID:23649840
TARS3	Human	gentamycin	increases expression	ISO	Tars3 (Rattus norvegicus)	6480464	Gentamicins results in increased expression of TARS3 mRNA	CTD	PMID:33387578
TARS3	Human	L-methionine	multiple interactions	ISO	Tars3 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of TARS3 mRNA	CTD	PMID:20938992
TARS3	Human	methyl methanesulfonate	increases expression	EXP		6480464	Methyl Methanesulfonate results in increased expression of TARS3 mRNA	CTD	PMID:23649840
TARS3	Human	N-methyl-4-phenylpyridinium	increases expression	ISO	Tars3 (Rattus norvegicus)	6480464	1-Methyl-4-phenylpyridinium results in increased expression of TARS3 mRNA	CTD	PMID:28801915
TARS3	Human	paracetamol	increases expression	ISO	Tars3 (Rattus norvegicus)	6480464	Acetaminophen results in increased expression of TARS3 mRNA	CTD	PMID:33387578
TARS3	Human	paracetamol	affects expression	ISO	Tars3 (Mus musculus)	6480464	Acetaminophen affects the expression of TARS3 mRNA	CTD	PMID:17562736
TARS3	Human	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of TARS3 mRNA	CTD	PMID:21420995
TARS3	Human	potassium dichromate	increases expression	ISO	Tars3 (Mus musculus)	6480464	Potassium Dichromate results in increased expression of TARS3 mRNA	CTD	PMID:23608068
TARS3	Human	SB 431542	multiple interactions	EXP		6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TARS3 mRNA	CTD	PMID:27188386
TARS3	Human	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of TARS3 mRNA	CTD	PMID:38568856
TARS3	Human	tetrachloroethene	increases expression	ISO	Tars3 (Mus musculus)	6480464	Tetrachloroethylene results in increased expression of TARS3 mRNA	CTD	PMID:28973375
TARS3	Human	thioacetamide	increases expression	ISO	Tars3 (Rattus norvegicus)	6480464	Thioacetamide results in increased expression of TARS3 mRNA	CTD	PMID:34492290
TARS3	Human	trichostatin A	decreases expression	EXP		6480464	trichostatin A results in decreased expression of TARS3 mRNA	CTD	PMID:26272509
TARS3	Human	trichostatin A	multiple interactions	EXP		6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TARS3 mRNA	CTD	PMID:27188386
TARS3	Human	trovafloxacin	decreases expression	ISO	Tars3 (Mus musculus)	6480464	trovafloxacin results in decreased expression of TARS3 mRNA	CTD	PMID:35537566
TARS3	Human	valproic acid	increases expression	ISO	Tars3 (Mus musculus)	6480464	Valproic Acid results in increased expression of TARS3 mRNA	CTD	PMID:21427059
TARS3	Human	vinclozolin	increases expression	ISO	Tars3 (Rattus norvegicus)	6480464	vinclozolin results in increased expression of TARS3 mRNA	CTD	PMID:23869203

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TARS3	Human	threonyl-tRNA aminoacylation	involved_in	IEA	InterPro:IPR002320	150520179		InterPro	GO_REF:0000002
TARS3	Human	threonyl-tRNA aminoacylation	involved_in	IBA	MGI:106314 more ...	150520179		GO_Central	GO_REF:0000033
TARS3	Human	threonyl-tRNA aminoacylation	involved_in	IEA	UniProtKB:Q8BLY2 and ensembl:ENSMUSP00000032728	150520179		Ensembl	GO_REF:0000107
TARS3	Human	threonyl-tRNA aminoacylation	involved_in	ISS	UniProtKB:Q8BLY2	150520179		UniProt	GO_REF:0000024
TARS3	Human	translation	involved_in	IEA	UniProtKB-KW:KW-0648	150520179		UniProt	GO_REF:0000043
TARS3	Human	tRNA aminoacylation	involved_in	IEA	InterPro:IPR012947	150520179		InterPro	GO_REF:0000002
TARS3	Human	tRNA aminoacylation for protein translation	involved_in	IEA	ARBA:ARBA00027121	150520179		UniProt	GO_REF:0000117
TARS3	Human	tRNA aminoacylation for protein translation	involved_in	IEA	InterPro:IPR002314	150520179		InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TARS3	Human	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	150520179		UniProt	GO_REF:0000044
TARS3	Human	cytoplasm	located_in	IEA	UniProtKB:Q8BLY2 and ensembl:ENSMUSP00000032728	150520179		Ensembl	GO_REF:0000107
TARS3	Human	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043
TARS3	Human	cytoplasm	located_in	ISS	UniProtKB:Q8BLY2	150520179		UniProt	GO_REF:0000024
TARS3	Human	cytoplasm	located_in	IEA	InterPro:IPR002320	150520179		InterPro	GO_REF:0000002
TARS3	Human	mitochondrion	is_active_in	IBA	PANTHER:PTN000154975 more ...	150520179		GO_Central	GO_REF:0000033
TARS3	Human	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	150520179		UniProt	GO_REF:0000044
TARS3	Human	nucleus	located_in	ISS	UniProtKB:Q8BLY2	150520179		UniProt	GO_REF:0000024
TARS3	Human	nucleus	located_in	IEA	UniProtKB:Q8BLY2 and ensembl:ENSMUSP00000032728	150520179		Ensembl	GO_REF:0000107
TARS3	Human	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TARS3	Human	aminoacyl-tRNA ligase activity	enables	IEA	UniProtKB-KW:KW-0030	150520179		UniProt	GO_REF:0000043
TARS3	Human	aminoacyl-tRNA ligase activity	enables	IEA	InterPro:IPR002314 and InterPro:IPR012947	150520179		InterPro	GO_REF:0000002
TARS3	Human	aminoacyl-tRNA ligase activity	enables	IEA	ARBA:ARBA00026908	150520179		UniProt	GO_REF:0000117
TARS3	Human	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	150520179		UniProt	GO_REF:0000043
TARS3	Human	ATP binding	enables	IEA	InterPro:IPR002314 more ...	150520179		InterPro	GO_REF:0000002
TARS3	Human	ligase activity	enables	IEA	UniProtKB-KW:KW-0436	150520179		UniProt	GO_REF:0000043
TARS3	Human	ligase activity	enables	IEA	ARBA:ARBA00028597	150520179		UniProt	GO_REF:0000117
TARS3	Human	nucleotide binding	enables	IEA	InterPro:IPR002314 and InterPro:IPR018163	150520179		InterPro	GO_REF:0000002
TARS3	Human	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	150520179		UniProt	GO_REF:0000043
TARS3	Human	protein binding	enables	IPI	UniProtKB:P07814 more ...	150520179	PMID:24312579	UniProt	PMID:24312579
TARS3	Human	protein binding	enables	IPI	UniProtKB:B2RDX5 and UniProtKB:P26639	150520179	PMID:25416956	IntAct	PMID:25416956
TARS3	Human	protein binding	enables	IPI	UniProtKB:O15145 more ...	150520179	PMID:32296183	IntAct	PMID:32296183
TARS3	Human	threonine-tRNA ligase activity	enables	IEA	InterPro:IPR002320	150520179		InterPro	GO_REF:0000002
TARS3	Human	threonine-tRNA ligase activity	enables	IBA	CGD:CAL0000183181 more ...	150520179		GO_Central	GO_REF:0000033
TARS3	Human	threonine-tRNA ligase activity	enables	IEA	RHEA:24624	150520179		RHEA	GO_REF:0000116
TARS3	Human	threonine-tRNA ligase activity	enables	IEA	UniProtKB:Q8BLY2 and ensembl:ENSMUSP00000032728	150520179		Ensembl	GO_REF:0000107
TARS3	Human	threonine-tRNA ligase activity	enables	ISS	UniProtKB:Q8BLY2	150520179		UniProt	GO_REF:0000024
TARS3	Human	threonine-tRNA ligase activity	enables	IEA	EC:6.1.1.3	150520179		UniProt	GO_REF:0000003

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TARS3	Human	Schizophrenia		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:12477932	PMID:14702039	PMID:20379614	PMID:21873635	PMID:24312579	PMID:25416956	PMID:25732088	PMID:26186194	PMID:26344197	PMID:26496610	PMID:28380382
PMID:28514442	PMID:29507755	PMID:29579307	PMID:31091453	PMID:31287872	PMID:31615875	PMID:32296183	PMID:32707033	PMID:32807901	PMID:33961781	PMID:34024034	PMID:35256949
PMID:35914814	PMID:36215168	PMID:37723588	PMID:38334954

TARS3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	101,653,596 - 101,724,473 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	101,653,596 - 101,724,473 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	102,193,799 - 102,264,676 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	100,011,478 - 100,082,168 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	100,011,477 - 100,082,168	NCBI
Celera	15	78,607,580 - 78,678,213 (-)	NCBI		Celera
Cytogenetic Map	15	q26.3	NCBI
HuRef	15	78,317,749 - 78,388,310 (-)	NCBI		HuRef
CHM1_1	15	102,035,085 - 102,105,711 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	99,411,600 - 99,482,344 (-)	NCBI		T2T-CHM13v2.0

Tars3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	65,294,610 - 65,341,841 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	65,294,646 - 65,341,839 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	65,644,898 - 65,692,093 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	65,644,898 - 65,692,091 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	72,789,784 - 72,836,979 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	65,523,864 - 65,571,041 (+)	NCBI		MGSCv36	mm8
Celera	7	63,058,449 - 63,105,370 (+)	NCBI		Celera
Cytogenetic Map	7	C	NCBI
cM Map	7	35.23	NCBI

Tars3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	128,623,678 - 128,675,978 (+)	NCBI		GRCr8
mRatBN7.2	1	119,213,189 - 119,265,492 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	119,213,213 - 119,265,488 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	127,202,236 - 127,254,088 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	134,373,659 - 134,425,513 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	127,187,106 - 127,239,384 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	126,523,169 - 126,559,493 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	126,523,169 - 126,559,489 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	127,615,710 - 127,674,850 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	120,050,878 - 120,087,520 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	120,129,220 - 120,165,862 (+)	NCBI
Celera	1	111,429,067 - 111,465,708 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

Tars3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	28,510,217 - 28,553,979 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	28,509,229 - 28,554,050 (-)	NCBI	ChiLan1.0	ChiLan1.0

TARS3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	91,259,961 - 91,348,760 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	94,960,503 - 95,033,817 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	80,394,050 - 80,463,568 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	99,667,608 - 99,737,480 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	99,667,608 - 99,737,300 (-)	Ensembl	panpan1.1		panPan2

TARS3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	39,346,694 - 39,419,900 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	39,241,010 - 39,419,899 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	42,037,522 - 42,110,659 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	39,735,762 - 39,812,035 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	39,735,791 - 39,812,008 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	39,272,713 - 39,345,817 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	39,509,408 - 39,582,532 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	39,710,921 - 39,784,061 (+)	NCBI		UU_Cfam_GSD_1.0

Tars3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	144,124,653 - 144,179,394 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936483	2,155,195 - 2,208,820 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936483	2,155,094 - 2,209,821 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TARS3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	145,302,278 - 145,357,778 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	145,302,336 - 145,357,762 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	311,022,126 - 311,076,802 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TARS3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	20,106,215 - 20,198,227 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	20,105,747 - 20,185,159 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	26,355,277 - 26,433,521 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tars3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624768	3,126,695 - 3,182,133 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624768	3,126,637 - 3,183,094 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in TARS3
77 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 15q26.3(chr15:101642152-101843270)x3	copy number gain	See cases [RCV000050845]	Chr15:101642152..101843270 [GRCh38] Chr15:102182355..102383473 [GRCh37] Chr15:99999878..100200996 [NCBI36] Chr15:15q26.3	benign
GRCh38/hg38 15q26.2-26.3(chr15:94033008-101843270)x3	copy number gain	See cases [RCV000050851]	Chr15:94033008..101843270 [GRCh38] Chr15:94576237..102383473 [GRCh37] Chr15:92377241..100200996 [NCBI36] Chr15:15q26.2-26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:101666117-101723215)x3	copy number gain	See cases [RCV000050651]	Chr15:101666117..101723215 [GRCh38] Chr15:102206320..102263418 [GRCh37] Chr15:100023843..100080941 [NCBI36] Chr15:15q26.3	benign
GRCh38/hg38 15q26.1-26.3(chr15:89679237-101978958)x3	copy number gain	See cases [RCV000052354]	Chr15:89679237..101978958 [GRCh38] Chr15:90222468..102519161 [GRCh37] Chr15:88023472..100336684 [NCBI36] Chr15:15q26.1-26.3	pathogenic
GRCh38/hg38 15q24.2-26.3(chr15:75307767-101723215)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052346]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052346]\|See cases [RCV000052346]	Chr15:75307767..101723215 [GRCh38] Chr15:75600108..102263418 [GRCh37] Chr15:73387161..100080941 [NCBI36] Chr15:15q24.2-26.3	pathogenic
GRCh38/hg38 15q24.3-26.3(chr15:77543797-101843411)x3	copy number gain	See cases [RCV000052347]	Chr15:77543797..101843411 [GRCh38] Chr15:77836139..102383614 [GRCh37] Chr15:75623194..100201137 [NCBI36] Chr15:15q24.3-26.3	pathogenic
GRCh38/hg38 15q25.2-26.3(chr15:84169153-101904929)x3	copy number gain	See cases [RCV000052352]	Chr15:84169153..101904929 [GRCh38] Chr15:84837905..102445132 [GRCh37] Chr15:82628909..100262655 [NCBI36] Chr15:15q25.2-26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:101500777-101843270)x1	copy number loss	See cases [RCV000051975]	Chr15:101500777..101843270 [GRCh38] Chr15:102040980..102383473 [GRCh37] Chr15:99858503..100200996 [NCBI36] Chr15:15q26.3	uncertain significance
GRCh38/hg38 15q26.2-26.3(chr15:96069425-101849578)x1	copy number loss	See cases [RCV000053228]	Chr15:96069425..101849578 [GRCh38] Chr15:96612654..102389781 [GRCh37] Chr15:94413658..100207304 [NCBI36] Chr15:15q26.2-26.3	pathogenic
GRCh38/hg38 15q26.2-26.3(chr15:96329791-101849578)x1	copy number loss	See cases [RCV000053244]	Chr15:96329791..101849578 [GRCh38] Chr15:96873020..102389781 [GRCh37] Chr15:94674024..100207304 [NCBI36] Chr15:15q26.2-26.3	pathogenic
GRCh38/hg38 15q26.2-26.3(chr15:96913979-101843411)x1	copy number loss	See cases [RCV000053245]	Chr15:96913979..101843411 [GRCh38] Chr15:97457209..102383614 [GRCh37] Chr15:95258213..100201137 [NCBI36] Chr15:15q26.2-26.3	pathogenic
GRCh38/hg38 15q26.2-26.3(chr15:97735430-101810992)x1	copy number loss	See cases [RCV000053246]	Chr15:97735430..101810992 [GRCh38] Chr15:98278660..102351195 [GRCh37] Chr15:96079664..100168718 [NCBI36] Chr15:15q26.2-26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:98845807-101843270)x1	copy number loss	See cases [RCV000053247]	Chr15:98845807..101843270 [GRCh38] Chr15:99389036..102383473 [GRCh37] Chr15:97206559..100200996 [NCBI36] Chr15:15q26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:98926805-101843270)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053248]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053248]\|See cases [RCV000053248]	Chr15:98926805..101843270 [GRCh38] Chr15:99470034..102383473 [GRCh37] Chr15:97287557..100200996 [NCBI36] Chr15:15q26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:100126374-101843270)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053249]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053249]\|See cases [RCV000053249]	Chr15:100126374..101843270 [GRCh38] Chr15:100666579..102383473 [GRCh37] Chr15:98484102..100200996 [NCBI36] Chr15:15q26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:100222791-101843270)x1	copy number loss	See cases [RCV000053250]	Chr15:100222791..101843270 [GRCh38] Chr15:100762996..102383473 [GRCh37] Chr15:98580519..100200996 [NCBI36] Chr15:15q26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:101621277-101666176)x3	copy number gain	See cases [RCV000133782]	Chr15:101621277..101666176 [GRCh38] Chr15:102161480..102206379 [GRCh37] Chr15:99979003..100023902 [NCBI36] Chr15:15q26.3	benign
GRCh38/hg38 15q26.1-26.3(chr15:93198717-101843270)x1	copy number loss	See cases [RCV000133733]	Chr15:93198717..101843270 [GRCh38] Chr15:93741946..102383473 [GRCh37] Chr15:91542950..100200996 [NCBI36] Chr15:15q26.1-26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:101621277-101708810)x3	copy number gain	See cases [RCV000133748]	Chr15:101621277..101708810 [GRCh38] Chr15:102161480..102249013 [GRCh37] Chr15:99979003..100066536 [NCBI36] Chr15:15q26.3	benign
GRCh38/hg38 15q26.3(chr15:101621303-101711860)x3	copy number gain	See cases [RCV000134052]	Chr15:101621303..101711860 [GRCh38] Chr15:102161506..102252063 [GRCh37] Chr15:99979029..100069586 [NCBI36] Chr15:15q26.3	benign\|likely benign\|conflicting data from submitters
GRCh38/hg38 15q26.3(chr15:101500643-101716531)x3	copy number gain	See cases [RCV000134020]	Chr15:101500643..101716531 [GRCh38] Chr15:102040846..102256734 [GRCh37] Chr15:99858369..100074257 [NCBI36] Chr15:15q26.3	benign
GRCh38/hg38 15q26.2-26.3(chr15:97014065-101843270)x1	copy number loss	See cases [RCV000135397]	Chr15:97014065..101843270 [GRCh38] Chr15:97557295..102383473 [GRCh37] Chr15:95358299..100200996 [NCBI36] Chr15:15q26.2-26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:99155987-101843270)x1	copy number loss	See cases [RCV000134969]	Chr15:99155987..101843270 [GRCh38] Chr15:99696192..102383473 [GRCh37] Chr15:97513715..100200996 [NCBI36] Chr15:15q26.3	pathogenic
GRCh38/hg38 15q25.2-26.3(chr15:83711377-101843270)x3	copy number gain	See cases [RCV000135858]	Chr15:83711377..101843270 [GRCh38] Chr15:84380129..102383473 [GRCh37] Chr15:82171133..100200996 [NCBI36] Chr15:15q25.2-26.3	pathogenic
GRCh38/hg38 15q25.3-26.3(chr15:87904735-101843270)x3	copy number gain	See cases [RCV000135568]	Chr15:87904735..101843270 [GRCh38] Chr15:88447966..102383473 [GRCh37] Chr15:86248970..100200996 [NCBI36] Chr15:15q25.3-26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:101474129-101716545)x3	copy number gain	See cases [RCV000136481]	Chr15:101474129..101716545 [GRCh38] Chr15:102014334..102256748 [GRCh37] Chr15:99831857..100074271 [NCBI36] Chr15:15q26.3	benign
GRCh38/hg38 15q26.3(chr15:101500777-101723215)x3	copy number gain	See cases [RCV000136490]	Chr15:101500777..101723215 [GRCh38] Chr15:102040980..102263418 [GRCh37] Chr15:99858503..100080941 [NCBI36] Chr15:15q26.3	benign
GRCh38/hg38 15q26.3(chr15:101694128-101723186)x3	copy number gain	See cases [RCV000136339]	Chr15:101694128..101723186 [GRCh38] Chr15:102234331..102263389 [GRCh37] Chr15:100051854..100080912 [NCBI36] Chr15:15q26.3	benign
GRCh38/hg38 15q25.2-26.3(chr15:82859676-101810992)x3	copy number gain	See cases [RCV000136849]	Chr15:82859676..101810992 [GRCh38] Chr15:83528428..102351195 [GRCh37] Chr15:81325482..100168718 [NCBI36] Chr15:15q25.2-26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:101686039-101723215)x3	copy number gain	See cases [RCV000137051]	Chr15:101686039..101723215 [GRCh38] Chr15:102226242..102263418 [GRCh37] Chr15:100043765..100080941 [NCBI36] Chr15:15q26.3	conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 15q26.2-26.3(chr15:95770627-101810992)x1	copy number loss	See cases [RCV000136864]	Chr15:95770627..101810992 [GRCh38] Chr15:96313856..102351195 [GRCh37] Chr15:94114860..100168718 [NCBI36] Chr15:15q26.2-26.3	pathogenic
GRCh38/hg38 15q25.3-26.3(chr15:85826665-101920998)x4	copy number gain	See cases [RCV000137264]	Chr15:85826665..101920998 [GRCh38] Chr15:86369896..102461201 [GRCh37] Chr15:84170900..100278724 [NCBI36] Chr15:15q25.3-26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:101395560-101843276)x3	copy number gain	See cases [RCV000138383]	Chr15:101395560..101843276 [GRCh38] Chr15:101935765..102383479 [GRCh37] Chr15:99753288..100201002 [NCBI36] Chr15:15q26.3	likely benign
GRCh38/hg38 15q26.3(chr15:101608448-101716531)x3	copy number gain	See cases [RCV000138968]	Chr15:101608448..101716531 [GRCh38] Chr15:102148651..102256734 [GRCh37] Chr15:99966174..100074257 [NCBI36] Chr15:15q26.3	likely benign
GRCh38/hg38 15q26.2-26.3(chr15:97941427-101797926)x1	copy number loss	See cases [RCV000139666]	Chr15:97941427..101797926 [GRCh38] Chr15:98484657..102338129 [GRCh37] Chr15:96285661..100155652 [NCBI36] Chr15:15q26.2-26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:101685919-101843276)x1	copy number loss	See cases [RCV000139541]	Chr15:101685919..101843276 [GRCh38] Chr15:102226122..102383479 [GRCh37] Chr15:100043645..100201002 [NCBI36] Chr15:15q26.3	likely benign
GRCh38/hg38 15q26.2-26.3(chr15:97172754-101920998)x1	copy number loss	See cases [RCV000141263]	Chr15:97172754..101920998 [GRCh38] Chr15:97715984..102461201 [GRCh37] Chr15:95516988..100278724 [NCBI36] Chr15:15q26.2-26.3	pathogenic
GRCh38/hg38 15q26.1-26.3(chr15:93041524-101941326)x3	copy number gain	See cases [RCV000141431]	Chr15:93041524..101941326 [GRCh38] Chr15:93584754..102481529 [GRCh37] Chr15:91385758..100299052 [NCBI36] Chr15:15q26.1-26.3	pathogenic
GRCh38/hg38 15q26.2-26.3(chr15:97283711-101920998)x3	copy number gain	See cases [RCV000140658]	Chr15:97283711..101920998 [GRCh38] Chr15:97826941..102461201 [GRCh37] Chr15:95627945..100278724 [NCBI36] Chr15:15q26.2-26.3	likely pathogenic
GRCh38/hg38 15q26.3(chr15:101621199-101888909)x1	copy number loss	See cases [RCV000141907]	Chr15:101621199..101888909 [GRCh38] Chr15:102161402..102429112 [GRCh37] Chr15:99978925..100246635 [NCBI36] Chr15:15q26.3	likely benign\|uncertain significance
GRCh38/hg38 15q25.3-26.3(chr15:85397539-101888909)x3	copy number gain	See cases [RCV000141899]	Chr15:85397539..101888909 [GRCh38] Chr15:85940770..102429112 [GRCh37] Chr15:83741774..100246635 [NCBI36] Chr15:15q25.3-26.3	pathogenic
GRCh38/hg38 15q23-26.3(chr15:72154949-101920998)x3	copy number gain	See cases [RCV000143019]	Chr15:72154949..101920998 [GRCh38] Chr15:72447290..102461201 [GRCh37] Chr15:70234344..100278724 [NCBI36] Chr15:15q23-26.3	pathogenic
GRCh38/hg38 15q22.2-26.3(chr15:59828460-101920998)x3	copy number gain	See cases [RCV000142915]	Chr15:59828460..101920998 [GRCh38] Chr15:60120659..102461201 [GRCh37] Chr15:57907951..100278724 [NCBI36] Chr15:15q22.2-26.3	pathogenic
GRCh38/hg38 15q26.2-26.3(chr15:96024127-101920998)x1	copy number loss	See cases [RCV000143088]	Chr15:96024127..101920998 [GRCh38] Chr15:96567356..102461201 [GRCh37] Chr15:94368360..100278724 [NCBI36] Chr15:15q26.2-26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:101552822-101843270)x1	copy number loss	See cases [RCV000142767]	Chr15:101552822..101843270 [GRCh38] Chr15:102093025..102383473 [GRCh37] Chr15:99910548..100200996 [NCBI36] Chr15:15q26.3	likely benign
GRCh38/hg38 15q26.3(chr15:99338283-101843270)x3	copy number gain	See cases [RCV000142579]	Chr15:99338283..101843270 [GRCh38] Chr15:99878488..102383473 [GRCh37] Chr15:97696011..100200996 [NCBI36] Chr15:15q26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:98467297-101843270)x1	copy number loss	See cases [RCV000142728]	Chr15:98467297..101843270 [GRCh38] Chr15:99010526..102383473 [GRCh37] Chr15:96828049..100200996 [NCBI36] Chr15:15q26.3	pathogenic
GRCh38/hg38 15q26.2-26.3(chr15:97681713-101920998)x1	copy number loss	See cases [RCV000143176]	Chr15:97681713..101920998 [GRCh38] Chr15:98224943..102461201 [GRCh37] Chr15:96025947..100278724 [NCBI36] Chr15:15q26.2-26.3	pathogenic
GRCh38/hg38 15q26.3(chr15:98280297-101888909)x3	copy number gain	See cases [RCV000143526]	Chr15:98280297..101888909 [GRCh38] Chr15:98823526..102429112 [GRCh37] Chr15:96641049..100246635 [NCBI36] Chr15:15q26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:102251993-102461162)x3	copy number gain	Premature ovarian failure [RCV000225208]	Chr15:102251993..102461162 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q26.2-26.3(chr15:98458265-102354857)x1	copy number loss	See cases [RCV000239905]	Chr15:98458265..102354857 [GRCh37] Chr15:15q26.2-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:101645331-102263418)x3	copy number gain	See cases [RCV000239911]	Chr15:101645331..102263418 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.1-26.3(chr15:92197136-102354857)x1	copy number loss	See cases [RCV000240535]	Chr15:92197136..102354857 [GRCh37] Chr15:15q26.1-26.3	pathogenic
GRCh37/hg19 15q22.31-26.3(chr15:64637227-102509910)x3	copy number gain	See cases [RCV000240602]	Chr15:64637227..102509910 [GRCh37] Chr15:15q22.31-26.3	pathogenic
NM_152334.3(TARS3):c.808G>A (p.Asp270Asn)	single nucleotide variant	not specified [RCV004288297]	Chr15:101711884 [GRCh38] Chr15:102252087 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q22.1-26.3(chr15:59297293-102480888)x3	copy number gain	not provided [RCV000415836]	Chr15:59297293..102480888 [GRCh37] Chr15:15q22.1-26.3	likely pathogenic
GRCh37/hg19 15q25.2-26.3(chr15:85089467-102495441)x3	copy number gain	See cases [RCV000449119]	Chr15:85089467..102495441 [GRCh37] Chr15:15q25.2-26.3	pathogenic
GRCh37/hg19 15q15.1-26.3(chr15:41745084-102354798)x4	copy number gain	See cases [RCV000447123]	Chr15:41745084..102354798 [GRCh37] Chr15:15q15.1-26.3	pathogenic
GRCh37/hg19 15q26.1-26.3(chr15:90346994-102354798)	copy number loss	See cases [RCV000447603]	Chr15:90346994..102354798 [GRCh37] Chr15:15q26.1-26.3	pathogenic
GRCh37/hg19 15q26.2-26.3(chr15:95238218-102429112)x1	copy number loss	See cases [RCV000446457]	Chr15:95238218..102429112 [GRCh37] Chr15:15q26.2-26.3	pathogenic
GRCh37/hg19 15q26.1-26.3(chr15:89924847-102429112)x3	copy number gain	See cases [RCV000445978]	Chr15:89924847..102429112 [GRCh37] Chr15:15q26.1-26.3	pathogenic
GRCh37/hg19 15q26.2-26.3(chr15:94782891-102429112)x1	copy number loss	See cases [RCV000445764]	Chr15:94782891..102429112 [GRCh37] Chr15:15q26.2-26.3	pathogenic
GRCh37/hg19 15q25.1-26.3(chr15:80648093-102429112)x3	copy number gain	See cases [RCV000445705]	Chr15:80648093..102429112 [GRCh37] Chr15:15q25.1-26.3	pathogenic
GRCh37/hg19 15q11.2-26.3(chr15:20733395-102511616)x4	copy number gain	See cases [RCV000447765]	Chr15:20733395..102511616 [GRCh37] Chr15:15q11.2-26.3	pathogenic
GRCh37/hg19 15q25.3-26.3(chr15:86148286-102511616)x3	copy number gain	See cases [RCV000448044]	Chr15:86148286..102511616 [GRCh37] Chr15:15q25.3-26.3	pathogenic
NC_000015.9:g.(?_100885379)_(102399948_?)dup	duplication	Schizophrenia [RCV000416623]	Chr15:100885379..102399948 [GRCh37] Chr15:98702902..100217471 [NCBI36] Chr15:15q26.3	likely pathogenic
GRCh37/hg19 15q26.3(chr15:98818228-102399760)	copy number loss	See cases [RCV000447813]	Chr15:98818228..102399760 [GRCh37] Chr15:15q26.3	pathogenic
GRCh37/hg19 15q26.2-26.3(chr15:97223728-102429112)x1	copy number loss	See cases [RCV000448857]	Chr15:97223728..102429112 [GRCh37] Chr15:15q26.2-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:101124214-102429112)x1	copy number loss	See cases [RCV000510246]	Chr15:101124214..102429112 [GRCh37] Chr15:15q26.3	likely benign
GRCh37/hg19 15q11.2-26.3(chr15:22770422-102429112)x3	copy number gain	See cases [RCV000510717]	Chr15:22770422..102429112 [GRCh37] Chr15:15q11.2-26.3	pathogenic
GRCh37/hg19 15q26.2-26.3(chr15:96913435-102429112)x1	copy number loss	See cases [RCV000510663]	Chr15:96913435..102429112 [GRCh37] Chr15:15q26.2-26.3	pathogenic
GRCh37/hg19 15q11.2-26.3(chr15:22770422-102429112)	copy number gain	See cases [RCV000512019]	Chr15:22770422..102429112 [GRCh37] Chr15:15q11.2-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:101569237-102344434)x3	copy number gain	See cases [RCV000511628]	Chr15:101569237..102344434 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.1-26.3(chr15:93148806-102429112)x3	copy number gain	See cases [RCV000511719]	Chr15:93148806..102429112 [GRCh37] Chr15:15q26.1-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:100564922-102399548)x1	copy number loss	See cases [RCV000511119]	Chr15:100564922..102399548 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1301C>T (p.Thr434Met)	single nucleotide variant	not specified [RCV004292705]	Chr15:101701105 [GRCh38] Chr15:102241308 [GRCh37] Chr15:15q26.3	uncertain significance
Single allele	duplication	not provided [RCV000677926]	Chr15:31115047..102354857 [GRCh37] Chr15:15q13.2-26.3	pathogenic
NM_152334.3(TARS3):c.671A>G (p.Asp224Gly)	single nucleotide variant	not specified [RCV004300693]	Chr15:101714859 [GRCh38] Chr15:102255062 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2350A>G (p.Ile784Val)	single nucleotide variant	not specified [RCV004317348]	Chr15:101654641 [GRCh38] Chr15:102194844 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.2-26.3(chr15:98220018-102429112)x1	copy number loss	See cases [RCV000512353]	Chr15:98220018..102429112 [GRCh37] Chr15:15q26.2-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:101238481-102429112)x1	copy number loss	See cases [RCV000512205]	Chr15:101238481..102429112 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.3(chr15:98737093-102429112)x1	copy number loss	See cases [RCV000512437]	Chr15:98737093..102429112 [GRCh37] Chr15:15q26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:102040980-102310654)x3	copy number gain	not provided [RCV000659200]	Chr15:102040980..102310654 [GRCh37] Chr15:15q26.3	likely benign
GRCh37/hg19 15q26.1-26.3(chr15:89743929-102429112)x3	copy number gain	not provided [RCV000683718]	Chr15:89743929..102429112 [GRCh37] Chr15:15q26.1-26.3	pathogenic
GRCh37/hg19 15q23-26.3(chr15:71329220-102270758)x3	copy number gain	not provided [RCV000683703]	Chr15:71329220..102270758 [GRCh37] Chr15:15q23-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:100526020-102429112)x1	copy number loss	not provided [RCV000683730]	Chr15:100526020..102429112 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.3(chr15:99928623-102429112)x3	copy number gain	not provided [RCV000683726]	Chr15:99928623..102429112 [GRCh37] Chr15:15q26.3	likely pathogenic
GRCh37/hg19 15q26.3(chr15:101734079-102429112)x3	copy number gain	not provided [RCV000683736]	Chr15:101734079..102429112 [GRCh37] Chr15:15q26.3	likely benign\|uncertain significance
GRCh37/hg19 15q24.3-26.3(chr15:77479244-102429112)x3	copy number gain	not provided [RCV000683710]	Chr15:77479244..102429112 [GRCh37] Chr15:15q24.3-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:102006937-102331052)x1	copy number loss	not provided [RCV000683737]	Chr15:102006937..102331052 [GRCh37] Chr15:15q26.3	likely benign
GRCh37/hg19 15q25.3-26.3(chr15:88385150-102461162)x3	copy number gain	not provided [RCV000738864]	Chr15:88385150..102461162 [GRCh37] Chr15:15q25.3-26.3	pathogenic
GRCh37/hg19 15q11.1-26.3(chr15:20071673-102461162)x3	copy number gain	not provided [RCV000751156]	Chr15:20071673..102461162 [GRCh37] Chr15:15q11.1-26.3	pathogenic
GRCh37/hg19 15q26.1-26.3(chr15:90277151-102376761)x3	copy number gain	not provided [RCV000751387]	Chr15:90277151..102376761 [GRCh37] Chr15:15q26.1-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:102035267-102461162)x3	copy number gain	not provided [RCV000751431]	Chr15:102035267..102461162 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q26.3(chr15:102144622-102326466)x3	copy number gain	not provided [RCV000751433]	Chr15:102144622..102326466 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q26.3(chr15:102152042-102210971)x1	copy number loss	not provided [RCV000751434]	Chr15:102152042..102210971 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q26.3(chr15:102157749-102255795)x3	copy number gain	not provided [RCV000751435]	Chr15:102157749..102255795 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q26.3(chr15:102157749-102277592)x3	copy number gain	not provided [RCV000751436]	Chr15:102157749..102277592 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q26.3(chr15:102172952-102258537)x3	copy number gain	not provided [RCV000751437]	Chr15:102172952..102258537 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q26.3(chr15:102219085-102359307)x1	copy number loss	not provided [RCV000751438]	Chr15:102219085..102359307 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q26.3(chr15:102224341-102288471)x3	copy number gain	not provided [RCV000751439]	Chr15:102224341..102288471 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q11.1-26.3(chr15:20016811-102493540)x3	copy number gain	not provided [RCV000751155]	Chr15:20016811..102493540 [GRCh37] Chr15:15q11.1-26.3	pathogenic
GRCh37/hg19 15q26.2-26.3(chr15:96873212-102389423)	copy number loss	not provided [RCV000767761]	Chr15:96873212..102389423 [GRCh37] Chr15:15q26.2-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:102151436-102224341)x1	copy number loss	not provided [RCV000847817]	Chr15:102151436..102224341 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.1-26.3(chr15:90288175-102429112)x3	copy number gain	not provided [RCV000846885]	Chr15:90288175..102429112 [GRCh37] Chr15:15q26.1-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:102151468-102224341)x1	copy number loss	not provided [RCV000845707]	Chr15:102151468..102224341 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.3(chr15:102065746-102429112)x1	copy number loss	not provided [RCV000845723]	Chr15:102065746..102429112 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.3(chr15:101696490-102311245)x3	copy number gain	not provided [RCV000848225]	Chr15:101696490..102311245 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.3(chr15:98686212-102429112)x1	copy number loss	not provided [RCV001006729]	Chr15:98686212..102429112 [GRCh37] Chr15:15q26.3	pathogenic
GRCh37/hg19 15q25.3-26.3(chr15:87189245-102429112)x1	copy number loss	not provided [RCV001006718]	Chr15:87189245..102429112 [GRCh37] Chr15:15q25.3-26.3	pathogenic
GRCh37/hg19 15q26.2-26.3(chr15:96878099-102397836)x1	copy number loss	Chromosome 15q26-qter deletion syndrome [RCV000993689]	Chr15:96878099..102397836 [GRCh37] Chr15:15q26.2-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:98795669-102429112)x1	copy number loss	not provided [RCV001006730]	Chr15:98795669..102429112 [GRCh37] Chr15:15q26.3	pathogenic
NM_152334.3(TARS3):c.1021A>G (p.Lys341Glu)	single nucleotide variant	not specified [RCV004292939]	Chr15:101703912 [GRCh38] Chr15:102244115 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.3(chr15:101683593-102270458)x3	copy number gain	not provided [RCV001259823]	Chr15:101683593..102270458 [GRCh37] Chr15:15q26.3	likely benign
GRCh37/hg19 15q26.2-26.3(chr15:98275761-102358202)x1	copy number loss	not provided [RCV001259819]	Chr15:98275761..102358202 [GRCh37] Chr15:15q26.2-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:100853021-102429112)x1	copy number loss	not provided [RCV001259829]	Chr15:100853021..102429112 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q25.3-26.3(chr15:86962053-102531392)x1	copy number loss	See cases [RCV001263026]	Chr15:86962053..102531392 [GRCh37] Chr15:15q25.3-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:102194980-102278574)x1	copy number loss	not provided [RCV001834206]	Chr15:102194980..102278574 [GRCh37] Chr15:15q26.3	likely benign
GRCh37/hg19 15q26.3(chr15:102151037-102224601)x1	copy number loss	not provided [RCV001834271]	Chr15:102151037..102224601 [GRCh37] Chr15:15q26.3	likely benign
GRCh37/hg19 15q26.3(chr15:101783340-102429112)x3	copy number gain	not provided [RCV001832991]	Chr15:101783340..102429112 [GRCh37] Chr15:15q26.3	likely benign
GRCh37/hg19 15q26.3(chr15:101659856-102429112)x3	copy number gain	not provided [RCV001827780]	Chr15:101659856..102429112 [GRCh37] Chr15:15q26.3	likely benign\|uncertain significance
GRCh37/hg19 15q26.3(chr15:101876976-102209916)x3	copy number gain	not provided [RCV001827695]	Chr15:101876976..102209916 [GRCh37] Chr15:15q26.3	likely benign
GRCh37/hg19 15q26.2-26.3(chr15:97026327-102429112)	copy number loss	not specified [RCV002052490]	Chr15:97026327..102429112 [GRCh37] Chr15:15q26.2-26.3	pathogenic
GRCh37/hg19 15q26.2-26.3(chr15:97223728-102429112)	copy number loss	not specified [RCV002052491]	Chr15:97223728..102429112 [GRCh37] Chr15:15q26.2-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:99258367-102429112)	copy number loss	not specified [RCV002052494]	Chr15:99258367..102429112 [GRCh37] Chr15:15q26.3	pathogenic
NM_152334.3(TARS3):c.823A>G (p.Ser275Gly)	single nucleotide variant	not specified [RCV004248148]	Chr15:101708900 [GRCh38] Chr15:102249103 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1507C>T (p.Pro503Ser)	single nucleotide variant	not specified [RCV004277782]	Chr15:101684218 [GRCh38] Chr15:102224421 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2065G>A (p.Gly689Arg)	single nucleotide variant	not specified [RCV004253672]	Chr15:101661719 [GRCh38] Chr15:102201922 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q25.2-26.3(chr15:84228005-102264590)x3	copy number gain	not provided [RCV003222840]	Chr15:84228005..102264590 [GRCh37] Chr15:15q25.2-26.3	pathogenic
NM_152334.3(TARS3):c.1345A>C (p.Thr449Pro)	single nucleotide variant	not specified [RCV004264242]	Chr15:101686038 [GRCh38] Chr15:102226241 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2380C>G (p.Arg794Gly)	single nucleotide variant	not specified [RCV004319464]	Chr15:101654611 [GRCh38] Chr15:102194814 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q24.1-26.3(chr15:75165490-102520892)x3	copy number gain	See cases [RCV003329502]	Chr15:75165490..102520892 [GRCh37] Chr15:15q24.1-26.3	pathogenic
NM_152334.3(TARS3):c.794A>G (p.Asp265Gly)	single nucleotide variant	not specified [RCV004344622]	Chr15:101711898 [GRCh38] Chr15:102252101 [GRCh37] Chr15:15q26.3	uncertain significance
Single allele	deletion	not provided [RCV003448683]	Chr15:98565904..102400021 [GRCh37] Chr15:15q26.3	pathogenic
NM_152334.3(TARS3):c.587C>T (p.Thr196Met)	single nucleotide variant	not provided [RCV003395072]	Chr15:101714943 [GRCh38] Chr15:102255146 [GRCh37] Chr15:15q26.3	likely benign
GRCh37/hg19 15q26.3(chr15:101919415-102429112)x1	copy number loss	not provided [RCV003483252]	Chr15:101919415..102429112 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.3(chr15:98679543-102429112)x1	copy number loss	not specified [RCV003987093]	Chr15:98679543..102429112 [GRCh37] Chr15:15q26.3	pathogenic
NM_152334.3(TARS3):c.2093G>A (p.Arg698His)	single nucleotide variant	not specified [RCV004469227]	Chr15:101657837 [GRCh38] Chr15:102198040 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1051A>G (p.Ile351Val)	single nucleotide variant	not specified [RCV004469210]	Chr15:101703882 [GRCh38] Chr15:102244085 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1759G>A (p.Glu587Lys)	single nucleotide variant	not specified [RCV004469224]	Chr15:101675629 [GRCh38] Chr15:102215832 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2153G>A (p.Ser718Asn)	single nucleotide variant	not specified [RCV004469230]	Chr15:101657029 [GRCh38] Chr15:102197232 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2303G>A (p.Arg768Gln)	single nucleotide variant	not specified [RCV004469237]	Chr15:101654688 [GRCh38] Chr15:102194891 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.257A>G (p.Glu86Gly)	single nucleotide variant	not specified [RCV004469238]	Chr15:101724131 [GRCh38] Chr15:102264334 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.629G>A (p.Arg210His)	single nucleotide variant	not specified [RCV004469244]	Chr15:101714901 [GRCh38] Chr15:102255104 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2206A>G (p.Thr736Ala)	single nucleotide variant	not specified [RCV004469231]	Chr15:101656976 [GRCh38] Chr15:102197179 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2227A>T (p.Asn743Tyr)	single nucleotide variant	not specified [RCV004469233]	Chr15:101656955 [GRCh38] Chr15:102197158 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.368A>T (p.Glu123Val)	single nucleotide variant	not specified [RCV004469239]	Chr15:101723094 [GRCh38] Chr15:102263297 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.976G>T (p.Ala326Ser)	single nucleotide variant	not specified [RCV004469250]	Chr15:101705702 [GRCh38] Chr15:102245905 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.3(chr15:98615561-102400033)x1	copy number loss	not provided [RCV004577491]	Chr15:98615561..102400033 [GRCh37] Chr15:15q26.3	pathogenic
NM_152334.3(TARS3):c.1103C>T (p.Pro368Leu)	single nucleotide variant	not specified [RCV004469211]	Chr15:101702357 [GRCh38] Chr15:102242560 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1390G>C (p.Ala464Pro)	single nucleotide variant	not specified [RCV004469217]	Chr15:101685993 [GRCh38] Chr15:102226196 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1454T>C (p.Phe485Ser)	single nucleotide variant	not specified [RCV004469218]	Chr15:101685929 [GRCh38] Chr15:102226132 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.146G>T (p.Cys49Phe)	single nucleotide variant	not specified [RCV004469219]	Chr15:101724242 [GRCh38] Chr15:102264445 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2011G>A (p.Ala671Thr)	single nucleotide variant	not specified [RCV004469226]	Chr15:101661773 [GRCh38] Chr15:102201976 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2152A>G (p.Ser718Gly)	single nucleotide variant	not specified [RCV004469229]	Chr15:101657030 [GRCh38] Chr15:102197233 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.227C>T (p.Ala76Val)	single nucleotide variant	not specified [RCV004469236]	Chr15:101724161 [GRCh38] Chr15:102264364 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.370G>T (p.Val124Leu)	single nucleotide variant	not specified [RCV004469240]	Chr15:101721322 [GRCh38] Chr15:102261525 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.391A>G (p.Ile131Val)	single nucleotide variant	not specified [RCV004469241]	Chr15:101721301 [GRCh38] Chr15:102261504 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.628C>A (p.Arg210Ser)	single nucleotide variant	not specified [RCV004469243]	Chr15:101714902 [GRCh38] Chr15:102255105 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1025G>A (p.Gly342Asp)	single nucleotide variant	not specified [RCV004469209]	Chr15:101703908 [GRCh38] Chr15:102244111 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1286C>G (p.Ala429Gly)	single nucleotide variant	not specified [RCV004469212]	Chr15:101701120 [GRCh38] Chr15:102241323 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.131A>G (p.Gln44Arg)	single nucleotide variant	not specified [RCV004469213]	Chr15:101724257 [GRCh38] Chr15:102264460 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1346C>T (p.Thr449Met)	single nucleotide variant	not specified [RCV004469214]	Chr15:101686037 [GRCh38] Chr15:102226240 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.134C>A (p.Ala45Glu)	single nucleotide variant	not specified [RCV004469215]	Chr15:101724254 [GRCh38] Chr15:102264457 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.134C>G (p.Ala45Gly)	single nucleotide variant	not specified [RCV004469216]	Chr15:101724254 [GRCh38] Chr15:102264457 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2095C>A (p.Gln699Lys)	single nucleotide variant	not specified [RCV004469228]	Chr15:101657835 [GRCh38] Chr15:102198038 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2221A>C (p.Ile741Leu)	single nucleotide variant	not specified [RCV004469232]	Chr15:101656961 [GRCh38] Chr15:102197164 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2245T>C (p.Tyr749His)	single nucleotide variant	not specified [RCV004469234]	Chr15:101656937 [GRCh38] Chr15:102197140 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2264T>C (p.Val755Ala)	single nucleotide variant	not specified [RCV004469235]	Chr15:101654727 [GRCh38] Chr15:102194930 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.415G>A (p.Glu139Lys)	single nucleotide variant	not specified [RCV004469242]	Chr15:101721277 [GRCh38] Chr15:102261480 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.817G>A (p.Val273Met)	single nucleotide variant	not specified [RCV004469248]	Chr15:101708906 [GRCh38] Chr15:102249109 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1721A>G (p.Gln574Arg)	single nucleotide variant	not specified [RCV004681954]	Chr15:101675667 [GRCh38] Chr15:102215870 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.370G>A (p.Val124Met)	single nucleotide variant	not specified [RCV004673229]	Chr15:101721322 [GRCh38] Chr15:102261525 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1156A>G (p.Met386Val)	single nucleotide variant	not specified [RCV004673227]	Chr15:101702304 [GRCh38] Chr15:102242507 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q24.2-26.3(chr15:76061144-102429112)x3	copy number gain	See cases [RCV000511332]	Chr15:76061144..102429112 [GRCh37] Chr15:15q24.2-26.3	pathogenic
GRCh37/hg19 15q26.3(chr15:101862163-102215765)x3	copy number gain	not provided [RCV000738902]	Chr15:101862163..102215765 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q26.3(chr15:102028468-102288471)x3	copy number gain	not provided [RCV000738912]	Chr15:102028468..102288471 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q26.3(chr15:102028468-102305129)x3	copy number gain	not provided [RCV000738913]	Chr15:102028468..102305129 [GRCh37] Chr15:15q26.3	benign
GRCh37/hg19 15q26.1-26.3(chr15:92335751-102399741)x1	copy number loss	not provided [RCV001537887]	Chr15:92335751..102399741 [GRCh37] Chr15:15q26.1-26.3	pathogenic
GRCh37/hg19 15q26.1-26.3(chr15:94176550-102429112)x3	copy number gain	not specified [RCV003987113]	Chr15:94176550..102429112 [GRCh37] Chr15:15q26.1-26.3	pathogenic
NM_152334.3(TARS3):c.730A>G (p.Met244Val)	single nucleotide variant	not specified [RCV004469247]	Chr15:101711962 [GRCh38] Chr15:102252165 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1497T>A (p.Phe499Leu)	single nucleotide variant	not specified [RCV004469220]	Chr15:101684228 [GRCh38] Chr15:102224431 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1905T>G (p.His635Gln)	single nucleotide variant	not specified [RCV004469225]	Chr15:101671548 [GRCh38] Chr15:102211751 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.691G>T (p.Val231Leu)	single nucleotide variant	not specified [RCV004469246]	Chr15:101712001 [GRCh38] Chr15:102252204 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.880C>T (p.Pro294Ser)	single nucleotide variant	not specified [RCV004469249]	Chr15:101708843 [GRCh38] Chr15:102249046 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1505G>A (p.Arg502His)	single nucleotide variant	not specified [RCV004469221]	Chr15:101684220 [GRCh38] Chr15:102224423 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1565A>G (p.Asn522Ser)	single nucleotide variant	not specified [RCV004469222]	Chr15:101684160 [GRCh38] Chr15:102224363 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1606C>T (p.Arg536Cys)	single nucleotide variant	not specified [RCV004469223]	Chr15:101684119 [GRCh38] Chr15:102224322 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.605A>G (p.Asn202Ser)	single nucleotide variant	not specified [RCV004673222]	Chr15:101714925 [GRCh38] Chr15:102255128 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1091G>T (p.Trp364Leu)	single nucleotide variant	not specified [RCV004673223]	Chr15:101702369 [GRCh38] Chr15:102242572 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1524A>C (p.Glu508Asp)	single nucleotide variant	not specified [RCV004673224]	Chr15:101684201 [GRCh38] Chr15:102224404 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.356A>C (p.Glu119Ala)	single nucleotide variant	not specified [RCV004673225]	Chr15:101723106 [GRCh38] Chr15:102263309 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.107A>C (p.Gln36Pro)	single nucleotide variant	not specified [RCV004673226]	Chr15:101724281 [GRCh38] Chr15:102264484 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2009G>A (p.Arg670Gln)	single nucleotide variant	not specified [RCV004673228]	Chr15:101661775 [GRCh38] Chr15:102201978 [GRCh37] Chr15:15q26.3	uncertain significance
GRCh37/hg19 15q26.1-26.3(chr15:93918298-102429112)x1	copy number loss	not provided [RCV004819384]	Chr15:93918298..102429112 [GRCh37] Chr15:15q26.1-26.3	pathogenic
NM_152334.3(TARS3):c.367G>A (p.Glu123Lys)	single nucleotide variant	not specified [RCV004866456]	Chr15:101723095 [GRCh38] Chr15:102263298 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.470A>T (p.Asp157Val)	single nucleotide variant	not specified [RCV004866457]	Chr15:101721222 [GRCh38] Chr15:102261425 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2012C>T (p.Ala671Val)	single nucleotide variant	not specified [RCV004866458]	Chr15:101661772 [GRCh38] Chr15:102201975 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1331A>G (p.His444Arg)	single nucleotide variant	not specified [RCV004866459]	Chr15:101686052 [GRCh38] Chr15:102226255 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.808G>T (p.Asp270Tyr)	single nucleotide variant	not specified [RCV004866460]	Chr15:101711884 [GRCh38] Chr15:102252087 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.236G>A (p.Arg79Gln)	single nucleotide variant	not specified [RCV004866461]	Chr15:101724152 [GRCh38] Chr15:102264355 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1915A>G (p.Thr639Ala)	single nucleotide variant	not specified [RCV004866462]	Chr15:101671538 [GRCh38] Chr15:102211741 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1298A>G (p.Asn433Ser)	single nucleotide variant	not specified [RCV004866463]	Chr15:101701108 [GRCh38] Chr15:102241311 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2111C>T (p.Pro704Leu)	single nucleotide variant	not specified [RCV004866464]	Chr15:101657819 [GRCh38] Chr15:102198022 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.287C>A (p.Ala96Asp)	single nucleotide variant	not specified [RCV004866465]	Chr15:101724101 [GRCh38] Chr15:102264304 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1360C>G (p.Pro454Ala)	single nucleotide variant	not specified [RCV004866466]	Chr15:101686023 [GRCh38] Chr15:102226226 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.1272C>G (p.Phe424Leu)	single nucleotide variant	not specified [RCV004866467]	Chr15:101701134 [GRCh38] Chr15:102241337 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.8C>G (p.Ala3Gly)	single nucleotide variant	not specified [RCV004877972]	Chr15:101724380 [GRCh38] Chr15:102264583 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.2126G>A (p.Cys709Tyr)	single nucleotide variant	not specified [RCV004866468]	Chr15:101657804 [GRCh38] Chr15:102198007 [GRCh37] Chr15:15q26.3	uncertain significance
NM_152334.3(TARS3):c.545A>G (p.Tyr182Cys)	single nucleotide variant	not specified [RCV004866469]	Chr15:101721147 [GRCh38] Chr15:102261350 [GRCh37] Chr15:15q26.3	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	1395
Count of miRNA genes:	782
Interacting mature miRNAs:	897
Transcripts:	ENST00000335968, ENST00000539112, ENST00000557811, ENST00000558533, ENST00000559492, ENST00000560150
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597339194	GWAS1435268_H	hypertension QTL GWAS1435268 (human)		0.000003	hypertension		15	101712082	101712083	Human

NIB466

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	15	102,238,588 - 102,238,737	UniSTS	GRCh37
Build 36	15	100,056,111 - 100,056,260	RGD	NCBI36
Celera	15	78,652,142 - 78,652,291	RGD
Cytogenetic Map	15	q26.3	UniSTS
HuRef	15	78,362,241 - 78,362,390	UniSTS
GeneMap99-GB4 RH Map	15	356.82	UniSTS
Whitehead-RH Map	15	391.3	UniSTS
NCBI RH Map	15	733.7	UniSTS

G20505

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	15	102,240,040 - 102,240,214	UniSTS	GRCh37
Build 36	15	100,057,563 - 100,057,737	RGD	NCBI36
Celera	15	78,653,594 - 78,653,768	RGD
Cytogenetic Map	15	q26.3	UniSTS
HuRef	15	78,363,693 - 78,363,867	UniSTS

A005U16

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	15	102,240,040 - 102,240,214	UniSTS	GRCh37
Build 36	15	100,057,563 - 100,057,737	RGD	NCBI36
Celera	15	78,653,594 - 78,653,768	RGD
Cytogenetic Map	15	q26.3	UniSTS
HuRef	15	78,363,693 - 78,363,867	UniSTS
GeneMap99-GB4 RH Map	15	355.82	UniSTS
NCBI RH Map	15	733.7	UniSTS

RH75749

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	15	102,194,442 - 102,194,690	UniSTS	GRCh37
Build 36	15	100,011,965 - 100,012,213	RGD	NCBI36
Celera	15	78,608,067 - 78,608,315	RGD
Cytogenetic Map	15	q26.3	UniSTS
HuRef	15	78,318,236 - 78,318,484	UniSTS

RH94107

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	15	102,194,166 - 102,194,314	UniSTS	GRCh37
Build 36	15	100,011,689 - 100,011,837	RGD	NCBI36
Celera	15	78,607,791 - 78,607,939	RGD
Cytogenetic Map	15	q26.3	UniSTS
HuRef	15	78,317,960 - 78,318,108	UniSTS
GeneMap99-GB4 RH Map	15	360.43	UniSTS

STS-Z40661

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	15	102,238,733 - 102,238,797	UniSTS	GRCh37
Build 36	15	100,056,256 - 100,056,320	RGD	NCBI36
Celera	15	78,652,287 - 78,652,351	RGD
Cytogenetic Map	15	q26.3	UniSTS
HuRef	15	78,362,386 - 78,362,450	UniSTS
GeneMap99-GB4 RH Map	15	358.49	UniSTS
NCBI RH Map	15	733.7	UniSTS

SHGC-57685

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	15	102,222,063 - 102,222,152	UniSTS	GRCh37
Build 36	15	100,039,586 - 100,039,675	RGD	NCBI36
Celera	15	78,635,688 - 78,635,777	RGD
Cytogenetic Map	15	q26.3	UniSTS
HuRef	15	78,345,850 - 78,345,939	UniSTS

WI-14285

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	15	102,238,594 - 102,238,743	UniSTS	GRCh37
Build 36	15	100,056,117 - 100,056,266	RGD	NCBI36
Celera	15	78,652,148 - 78,652,297	RGD
Cytogenetic Map	15	q26.3	UniSTS
HuRef	15	78,362,247 - 78,362,396	UniSTS
GeneMap99-GB4 RH Map	15	359.17	UniSTS
Whitehead-RH Map	15	393.4	UniSTS
NCBI RH Map	15	733.7	UniSTS

A004I39

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	15	102,238,680 - 102,238,813	UniSTS	GRCh37
Build 36	15	100,056,203 - 100,056,336	RGD	NCBI36
Celera	15	78,652,234 - 78,652,367	RGD
Cytogenetic Map	15	q26.3	UniSTS
HuRef	15	78,362,333 - 78,362,466	UniSTS
GeneMap99-GB4 RH Map	15	357.37	UniSTS
NCBI RH Map	15	733.7	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
1204	2432	2788	2245	4942	1723	2345	4	622	1947	464	2268	7280	6453	52	3708	847	1731	1612	170


RefSeq Transcripts	NM_152334	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006720386	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017021912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_024449836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_047432140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_047432142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054377266	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001751082	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001751083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001751084	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_007064422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_931748	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_931749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC027559	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC090164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK056653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK057734	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL833188	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW161214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC035827	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069346	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC074887	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC132671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC136315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC143943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BE856588	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BU677165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068263	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000335968 ⟹ ENSP00000338093

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	15	101,653,596 - 101,724,473 (-)	Ensembl

Ensembl Acc Id:

ENST00000539112 ⟹ ENSP00000439899

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	15	101,654,394 - 101,724,410 (-)	Ensembl

Ensembl Acc Id:

ENST00000557811

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	15	101,695,760 - 101,701,165 (-)	Ensembl

Ensembl Acc Id:

ENST00000558533 ⟹ ENSP00000452740

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	15	101,654,213 - 101,708,828 (-)	Ensembl

Ensembl Acc Id:

ENST00000559492

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	15	101,654,469 - 101,664,442 (-)	Ensembl

Ensembl Acc Id:

ENST00000560150

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	15	101,714,678 - 101,721,174 (-)	Ensembl

Ensembl Acc Id:

ENST00000615656 ⟹ ENSP00000478827

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	15	101,655,980 - 101,724,442 (-)	Ensembl

RefSeq Acc Id:

NM_152334 ⟹ NP_689547

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	15	101,653,596 - 101,724,473 (-)	NCBI
GRCh37	15	102,193,955 - 102,264,807 (-)	NCBI
Build 36	15	100,011,478 - 100,082,168 (-)	NCBI Archive
Celera	15	78,607,580 - 78,678,213 (-)	RGD
HuRef	15	78,317,749 - 78,388,310 (-)	ENTREZGENE
CHM1_1	15	102,035,085 - 102,105,711 (-)	NCBI
T2T-CHM13v2.0	15	99,411,600 - 99,482,344 (-)	NCBI

Sequence:

show sequence

GTCTTCTGCCGTGCGCTGAGTGTCCGCGTCGCCCTCGCCGCAGTCGCGGGCACCCCGCTCGGCGTCGGTGCCTGAGGGAGGCCGCGATGGCGGCCGAGGCCCTGGCGGCGGAGGCCGTGGCGTCGCGC
CTGGAGCGGCAGGAGGAGGACATCCGCTGGCTGTGGTCGGAGGTCGAGCGCCTGAGGGACGAGCAGCTGAACGCGCCCTACAGCTGCCAGGCGGAGGGGCCGTGCCTCACGCGGGAGGTGGCGCAGCT
CCGGGCCGAGAACTGCGACCTGCGCCACCGCCTGTGCAGCCTGCGGCTGTGCCTCGCCGAGGAGCGGAGCCGCCAGGCCACGCTGGAGAGCGCGGAGCTAGAGGCGGCGCAGGAGGCCGGCGCACAGC
CTCCTCCTAGTCAAAGCCAAGACAAGGACATGAAAAAGAAGAAAATGAAGGAAAGCGAGGCTGACAGCGAGGTGAAGCATCAACCAATTTTCATAAAAGAAAGATTGAAGCTTTTTGAAATACTGAAG
AAAGACCATCAGCTCTTACTTGCCATTTATGGAAAAAAGGGGGATACAAGCAACATCATCACAGTAAGAGTGGCTGATGGGCAAACAGTGCAAGGGGAAGTCTGGAAAACAACGCCTTACCAAGTGGC
TGCTGAAATTAGTCAGGAACTGGCTGAAAGCACGGTAATAGCCAAAGTCAATGGTGAACTGTGGGACCTGGACCGCCCATTGGAAGGGGACTCTTCTCTAGAGCTGCTTACATTTGATAATGAGGAAG
CTCAAGCTGTGTACTGGCACTCCAGTGCTCACATTCTTGGGGAGGCCATGGAGCTTTACTATGGAGGCCACCTGTGCTACGGTCCGCCCATTGAAAATGGATTTTATTATGACATGTTCATTGAAGAC
AGAGCAGTGTCCAGCACAGAATTGTCAGCCCTGGAGAATATATGTAAAGCCATCATAAAAGAAAAGCAACCTTTTGAAAGACTAGAAGTCAGCAAGGAAATCCTCCTGGAAATGTTTAAGTACAATAA
ATTTAAATGCCGCATTCTGAATGAGAAAGTTAACACTGCAACTACCACCGTGTACAGGTGCGGTCCATTAATTGACCTTTGCAAAGGTCCACATGTAAGACACACTGGAAAAATTAAAACCATCAAAA
TTTTTAAGAATTCCTCAACATATTGGGAGGGCAATCCGGAAATGGAAACATTGCAGAGGATCTATGGAATATCCTTTCCTGATAACAAGATGATGAGAGACTGGGAAAAGTTCCAAGAGGAAGCAAAG
AACCGAGATCACAGGAAGATCGGGAAGGAACAAGAACTTTTCTTTTTCCACGATTTGAGTCCTGGAAGCTGTTTTTTCCTTCCCAGAGGAGCCTTCATTTATAATACGCTTACAGATTTCATACGAGA
GGAATATCACAAACGGGACTTCACGGAGGTGCTCTCTCCCAATATGTACAACAGTAAACTCTGGGAAGCCTCAGGCCACTGGCAGCATTACAGCGAGAACATGTTTACCTTTGAGATTGAAAAGGACA
CTTTTGCCCTCAAACCCATGAATTGTCCAGGGCACTGTCTAATGTTTGCCCATCGTCCACGATCTTGGAGGGAAATGCCTATTAGATTTGCTGATTTTGGAGTTCTGCATAGAAATGAACTGTCGGGG
ACTCTCAGCGGCTTGACCAGAGTGAGGCGCTTCCAGCAGGACGATGCTCACATTTTTTGCACAGTGGAGCAGATTGAAGAAGAAATAAAGGGGTGTTTGCAGTTTTTGCAATCTGTTTACTCAACATT
TGGCTTCTCCTTTCAATTAAACCTGTCAACAAGGCCGGAAAACTTCCTAGGAGAGATTGAGATGTGGAATGAGGCTGAGAAGCAACTGCAGAACAGCTTGATGGACTTTGGAGAACCGTGGAAAATGA
ACCCAGGAGATGGAGCATTTTATGGCCCTAAAATTGACATAAAAATCAAGGATGCTATTGGCAGATACCATCAATGTGCTACAATTCAGCTGGACTTCCAACTGCCTATTAGATTTAATCTCACATAT
GTTAGTAAGGATGGGGATGATAAGAAGAGACCTGTGATCATTCATCGAGCCATTTTGGGATCAGTGGAAAGAATGATAGCCATTCTTTCAGAAAACTATGGCGGAAAATGGCCTTTCTGGCTATCTCC
TCGTCAGGTGATGGTCATCCCTGTGGGGCCAACTTGTGAAAAATATGCACTTCAGGTATCCAGTGAATTTTTTGAAGAAGGATTTATGGCTGACGTTGACTTGGATCACAGTTGTACACTAAATAAGA
AAATACGAAATGCACAGCTGGCTCAGTATAATTTTATTTTGGTGGTTGGAGAAAAGGAAAAGATAGATAATGCTGTAAACGTGCGAACAAGAGACAACAAAATTCATGGAGAGATTTTAGTAACTTCT
GCCATTGATAAACTGAAGAATCTCAGGAAGACACGGACACTCAATGCTGAGGAGGCCTTTTGAAGTCCTTCCCTGATATTTGCTTCTGTGTAACTTTGTTTTGACCCTTAAAAATGTATTTTTCTTAA
CATGTTAGTACTTCTACGACTTTGGAGCCACTGATGGGTCCACTCATGGCCTCAGCTGAGAAAGGAGACGATGAACGTGTAGCTGACATGCACGAAGTTTAATTTACTCATGTCCACGGGGGACGTTT
AGAGGGCACGTGGGAAATTTTCCAGCAATCAATGCCTTGAGAAACTTAAATGGGGAAATATTATTCATCGAGAAAGTGAAACAAAACACTAGGAAATGATTATGAAATGTTAGTGATTTTCAAAAGAT
GGGCTTCAAATAAAAGTCTGCAGAGTTTTTTTTAAATAGGAGGGAAAATCTTATTTTCTAATATGTCTCAGGTATTTTTATGACTTCTACTAAAATTCACACTGAAACTTTATCTTCTAAACTGGAAT
CATTACTTAATTTTAACTAACCAACAACCACAAAAGCAGCAGCTACTGCTAAATATTGGATTACTGACAAAGGAATTCAGTTTTGTGGAATCTGGTGTTTGCACTATAGGTTAAGAGTTGCCATTTAA
ATGTTTCTTATTCATAATTAGGTTTTGTTCCGCTTTAGAAAAAAATAAATTCCCAAATGAATTGCATCAGTGTTTCCAGCGTTTCAGCTGTGGGCTTCTACCACCACTAAGCCGCTCACCTAGAGTTG
TTACTTTTTTGATGGGATGACATTCCATGGATTTATGTACTGAAATGGATTTCAGATTTTAAAGAGAGGAATGCTCTACGTGCTCAGAACTGAATTAAAATGGCATTATGTCAATAGAGAATTCAGCT
ACCAAACAAGAAGTATTGTTTATTTTGCGATATGCTGTGAAATTCAAAAGAAATGTAAGAAATAATCTCTTTTCAATATACTGATCATTTAGTTAACTTCCTGAGGGATGTGAACAGTGAAACAGTTG
GCAAACAAAACAATATATATCAGGC

hide sequence

RefSeq Acc Id:

XM_017021912 ⟹ XP_016877401

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	15	101,670,154 - 101,724,473 (-)	NCBI

Sequence:

show sequence

AGTCGCGGGCACCCCGCTCGGCGTCGGTGCCTGAGGGAGGCCGCGATGGCGGCCGAGGCCCTGG
CGGCGGAGGCCGTGGCGTCGCGCCTGGAGCGGCAGGAGGAGGACATCCGCTGGCTGTGGTCGGAGGTCGAGCGCCTGAGGGACGAGCAGCTGAACGCGCCCTACAGCTGCCAGGCGGAGGGGCCGTGC
CTCACGCGGGAGGTGGCGCAGCTCCGGGCCGAGAACTGCGACCTGCGCCACCGCCTGTGCAGCCTGCGGCTGTGCCTCGCCGAGGAGCGGAGCCGCCAGGCCACGCTGGAGAGCGCGGAGCTAGAGGC
GGCGCAGGAGGCCGGCGCACAGCCTCCTCCTAGTCAAAGCCAAGACAAGGACATGAAAAAGAAGAAAATGAAGGAAAGCGAGGCTGACAGCGAGGTGAAGCATCAACCAATTTTCATAAAAGAAAGAT
TGAAGCTTTTTGAAATACTGAAGAAAGACCATCAGCTCTTACTTGCCATTTATGGAAAAAAGGGGGATACAAGCAACATCATCACAGTAAGAGTGGCTGATGGGCAAACAGTGCAAGGGGAAGTCTGG
AAAACAACGCCTTACCAAGTGGCTGCTGAAATTAGTCAGGAACTGGCTGAAAGCACGGTAATAGCCAAAGTCAATGGTGAACTGTGGGACCTGGACCGCCCATTGGAAGGGGACTCTTCTCTAGAGCT
GCTTACATTTGATAATGAGGAAGCTCAAGCTGTGTACTGGCACTCCAGTGCTCACATTCTTGGGGAGGCCATGGAGCTTTACTATGGAGGCCACCTGTGCTACGGTCCGCCCATTGAAAATGGATTTT
ATTATGACATGTTCATTGAAGACAGAGCAGTGTCCAGCACAGAATTGTCAGCCCTGGAGAATATATGTAAAGCCATCATAAAAGAAAAGCAACCTTTTGAAAGACTAGAAGTCAGCAAGGAAATCCTC
CTGGAAATGTTTAAGTACAATAAATTTAAATGCCGCATTCTGAATGAGAAAGTTAACACTGCAACTACCACCGTGTACAGGTGCGGTCCATTAATTGACCTTTGCAAAGGTCCACATGTAAGACACAC
TGGAAAAATTAAAACCATCAAAATTTTTAAGAATTCCTCAACATATTGGGAGGGCAATCCGGAAATGGAAACATTGCAGAGGATCTATGGAATATCCTTTCCTGATAACAAGATGATGAGAGACTGGG
AAAAGTTCCAAGAGGAAGCAAAGAACCGAGATCACAGGAAGATCGGGAAGGAACAAGAACTTTTCTTTTTCCACGATTTGAGTCCTGGAAGCTGTTTTTTCCTTCCCAGAGGAGCCTTCATTTATAAT
ACGCTTACAGATTTCATACGAGAGGAATATCACAAACGGGACTTCACGGAGGTGCTCTCTCCCAATATGTACAACAGTAAACTCTGGGAAGCCTCAGGCCACTGGCAGCATTACAGCGAGAACATGTT
TACCTTTGAGATTGAAAAGGACACTTTTGCCCTCAAACCCATGAATTGTCCAGGGCACTGTCTAATGTTTGCCCATCGTCCACGATCTTGGAGGGAAATGCCTATTAGATTTGCTGATTTTGGAGTTC
TGCATAGAAATGAACTGTCGGGGACTCTCAGCGGCTTGACCAGAGTGAGGCGCTTCCAGCAGGACGATGCTCACATTTTTTGCACAGTGGAGCAGATTGAAGAAGAAATAAAGGGGTGTTTGCAGTTT
TTGCAATCTGTTTACTCAACATTTGGCTTCTCCTTTCAATTAAACCTGTCAACAAGGCCGGAAAACTTCCTAGGAGAGATTGAGATGTGGAATGAGGCTGAGAAGCAACTGCAGAACAGCTTGATGGA
CTTTGGAGAACCGTGGAAAATGAACCCAGGAGATGGAGCATTTTATGGCCCTAAAATTGACATAAAAATCAAGGATGCTATTGGCAGATACCATCAATGTGCTACAATTCAGCTGGACTTCCAACTGC
CTATTAGATTTAATCTCACATATGTTAGAATGTCATGTAAACGGAGCCATGCAGTATCGAGCCTTCTGAGACTGGCTTCTTTCACGTAGCACAGTGCTGTGGAGATTCATCCATGATTCTGCAAGTAT
TGATAGTTTGTTCCTTTCTGTCACTGACTAGTGTGCCATTGTGGATCCAATCTCTCATTGAAGGGTGTTTGGGTTGCTTCCAGTTCTTGGTGATTATGAATAGAACTGCTGTAGATATTAGTGTATAG
GTTTTTGTGTGAATAGAAGTTTTCTTTAGGTTAAATAACTGGGAATGGGTCATATGATAATTAAATATTTAACTTTGTAGAAACTGCCAAACTGTTTTCCAGAGCAGCTGCACCATTTTGCATTCTCA
CCTGCAATGTGTAAAGAGTTCCAGATGTTCCACATCCTTGCCAGTACTTGATATTGTCAGGTTTTGTTTGTTAAGTAGTTCTAATAGGTGTGTAGTAGTATTTCATTATCTTTTGATTTTACATGTTT
TTTAGTGGCTAATGATGTTAACATCTTTTCATGTGCTTACTTGCTATTCATTTATCCTCTTTGGTTAAAAGTCTGCCAAAGTCTTTTTGCTCATTTTTAATTGAGTGATTTGTTTCCTTACTGTTGAG
TTTTGAGAATTCTTTATATATTCTAGATACTAGCCCTTGGAGGAATATATGATTTGCACATATTTTACCCTGGTCTGTAGCTTGCTTTTTCATTTTTTGTAATATCTTTACTTTCCCATTCATCCTGA
GTTATTAAATACAATAAAGTTTAATTTCTCCATTTTTTTCTTTTATGGATCATGCTTTGGCATCATATCTATAAGCTCTGCCTAAGTACAGGCCATGAAGATTTTCTTCTATGTTTTATATTAAAAGT
TTTCTAGTTCTAAGATCTGATGTGAGTTCATTGTTTGTGTAAGATGTGACATTTGGGTCAAGATTCATTGTTTGCATCTAAGTGTCTCATTATTCACACATCAGATGATGTAAGAACAGGCCACTATT
TCACCATCGACTTGCCTTTGGATCTTTGTCAGAAATTAGTTGGACATATATATGTGGGTCTGTTTCTAGATTATAAATTCTGTTCTATGGGACCACTGATTATCCCTTTGTTCACTGTGTGAACATCA
CCGAGTGTGCTTACGCAAACCTGGGTGGTAGAGCCTACTACATACCTAGGCTAATATGGTCTAGACTATTGCTTCTAGGCTACAGACCTGTAAAGCATGTTACTCTAC

hide sequence

RefSeq Acc Id:

XM_047432140 ⟹ XP_047288096

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	15	101,656,969 - 101,724,473 (-)	NCBI

RefSeq Acc Id:

XM_047432142 ⟹ XP_047288098

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	15	101,653,596 - 101,721,197 (-)	NCBI

RefSeq Acc Id:

XM_054377266 ⟹ XP_054233241

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	15	99,411,600 - 99,479,069 (-)	NCBI

RefSeq Acc Id:

XR_007064422

Type:

NON-CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	15	101,685,976 - 101,724,473 (-)	NCBI

RefSeq Acc Id:

XR_931749

Type:

NON-CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	15	101,695,574 - 101,724,473 (-)	NCBI

Sequence:

show sequence

AGTCGCGGGCACCCCGCTCGGCGTCGGTGCCTGAGGGAGGCCGCGATGGCGGCCGAGGCCCTGGCGGCGGAGGCCGTGGCGTCGCGCCTGGAGCGGCAGGAGGAGGACATCCGCTGGCTGTGGTCGGA
GGTCGAGCGCCTGAGGGACGAGCAGCTGAACGCGCCCTACAGCTGCCAGGCGGAGGGGCCGTGCCTCACGCGGGAGGTGGCGCAGCTCCGGGCCGAGAACTGCGACCTGCGCCACCGCCTGTGCAGCC
TGCGGCTGTGCCTCGCCGAGGAGCGGAGCCGCCAGGCCACGCTGGAGAGCGCGGAGCTAGAGGCGGCGCAGGAGGCCGGCGCACAGCCTCCTCCTAGTCAAAGCCAAGACAAGGACATGAAAAAGAAG
AAAATGAAGGAAAGCGAGGCTGACAGCGAGGTGAAGCATCAACCAATTTTCATAAAAGAAAGATTGAAGCTTTTTGAAATACTGAAGAAAGACCATCAGCTCTTACTTGCCATTTATGGAAAAAAGGG
GGATACAAGCAACATCATCACAGTAAGAGTGGCTGATGGGCAAACAGTGCAAGGGGAAGTCTGGAAAACAACGCCTTACCAAGTGGCTGCTGAAATTAGTCAGGAACTGGCTGAAAGCACGGTAATAG
CCAAAGTCAATGGTGAACTGTGGGACCTGGACCGCCCATTGGAAGGGGACTCTTCTCTAGAGCTGCTTACATTTGATAATGAGGAAGCTCAAGCTGTGTACTGGCACTCCAGTGCTCACATTCTTGGG
GAGGCCATGGAGCTTTACTATGGAGGCCACCTGTGCTACGGTCCGCCCATTGAAAATGGATTTTATTATGACATGTTCATTGAAGACAGAGCAGTGTCCAGCACAGAATTGTCAGCCCTGGAGAATAT
ATGTAAAGCCATCATAAAAGAAAAGCAACCTTTTGAAAGACTAGAAGTCAGCAAGGAAATCCTCCTGGAAATGTTTAAGTACAATAAATTTAAATGCCGCATTCTGAATGAGAAAGTTAACACTGCAA
CTACCACCGTGTACAGGTGCGGTCCATTAATTGACCTTTGCAAAGGTCCACATGTAAGACACACTGGAAAAATTAAAACCATCAAAATTTTTAAGAATTCCTCAACATATTGGGAGGGCAATCCGGAA
ATGGAAACATTGCAGAGGATCTATGGAATATCCTTTCCTGATAACAAGATGATGAGAGACTGGGAAAAGTTCCAAGAGGAAGCAAAGAACCGAGATCACAGGAAGATCGGGAAGGAACAAGAACTTTT
CTTTTTCCACGATTTGAGTCCTGGAAGCTGTTTTTTCCTTCCCAGAGGAGCCTTCATTTATAATACGCTTACAGATTTCATACGAATGCAAGACAGATGTGGCTGATGAACAGGAGCAGGGCCTGATT
GTGAGGGTCACCAAACTGTAAAGGCACTTAAATGCACAAACCCAGTGATCTCTTATTCTAAGGGAGCCAAAAATCGGCTGTCATTTTCTACATTCTGCCTGGACGTCTCCCCAGCTAAGTCCATGAGT
TCTTTGGGTACCCTTTCTGTTTTCCATGTTACTTCTGGTGACAGTGTTACCCACCATCTGTTTCTGGCACCTCGTAATAAGAATCCCTTCTAGCTTCTGCCCACCACCTGGCCCCAAAGCTACATGTT
TTAGGTTATTGTTATGTCAACTGAAGAATCATGAGGTTCATAAAATTGTAAAGGAGAGCTTCATTTCTTCTGAGGGGTTGCAGCCTGAAATCTTGCAGGCTAGGAAGCTTCATAGCTTCTGGCAGAAA
CCAGAAGCAGGCATTTCAAGGGAGGGAAAAGTAAGACAGGAATTTATGCTGATGAGATTGGCCAAGTATAAATATTTAACAGGTTATAAGAAGAGCTATGAATATTCACAAAGGGGGGACATTTATAT
ACATAGTAAGCAAACATGCATGTTACATGCATCCCTTGTTCACTTTGGGGTGGAGACAATGCATTTAAATTAGGCTGTATAACCAAAAGGTCAAATGGAGGACACGGAGGCATCCCATGTGCAGCCTT
TATAAACCAACCAGAACCAGTGCATGGTGAGTGGTCTTTTAACAGGAAGAAATGCTGCTCAGTTGTGTAAATCAGTGGTGGAACAAGTCTTTCAAAAGGGCTTGTTTCTGATTAACTCTTAGGAAAGA
AAGCCTAATGGTTGTTAGTGACAGAGTGGGTATAATTAGGCATGTCCAACCTCTTGTCACTGCCAGTAACTCAGTTTTTAAGGTTTCTCTGGGGTCCTTTGGCCAAGAGGGTGTCTGTTCAGTCAGTT
GGGGAGCTTAGGATTTTATTTTTATTTCTCAGTTATAGCAGTACCTACATCCAGTGCAAAATTCTGTTCTGGATGGCTATTGCAACATAGCAAAGTATCCCAGAACTTAATAGTTTAAAACTGCCATT
TCATCATTACTGTCTTTCATAGTTCCAAATTTTAGGCTCCTGTGGGTGGTTCTCGCATTGGGTCCCTTACATGACTGTATTCAGGTAGAGTCTCATGCCAGGGTTATTGATTGAAGAATGTCCCCTTC
CCATCATAGAAAGACTAAAAACATCAGGCATTGGCAAGAATATGAAGCAAGTATAACACTTACTGCTGGTAGGAACGTAAAATGGTAGAACTACTTTGTAGCAGTTTGGCATTTCCTGTAAAGATAAA
CGTGCCCCACTTCTTTTTTTTTTT

hide sequence


Protein RefSeqs	NP_689547	(Get FASTA)	NCBI Sequence Viewer
	XP_016877401	(Get FASTA)	NCBI Sequence Viewer
	XP_047288096	(Get FASTA)	NCBI Sequence Viewer
	XP_047288098	(Get FASTA)	NCBI Sequence Viewer
	XP_054233241	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A2RTX5	(Get FASTA)	NCBI Sequence Viewer
	AAH69346	(Get FASTA)	NCBI Sequence Viewer
	AAH69811	(Get FASTA)	NCBI Sequence Viewer
	AAH74887	(Get FASTA)	NCBI Sequence Viewer
	AAI32672	(Get FASTA)	NCBI Sequence Viewer
	AAI36316	(Get FASTA)	NCBI Sequence Viewer
	AAI43944	(Get FASTA)	NCBI Sequence Viewer
	BAB71241	(Get FASTA)	NCBI Sequence Viewer
	BAB71554	(Get FASTA)	NCBI Sequence Viewer
	EAX02316	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000338093
	ENSP00000338093.3
	ENSP00000478827

RefSeq Acc Id:

NP_689547 ⟸ NM_152334

- UniProtKB:

Q96LW3 (UniProtKB/Swiss-Prot), Q6IS76 (UniProtKB/Swiss-Prot), Q6B0A1 (UniProtKB/Swiss-Prot), B2RMP7 (UniProtKB/Swiss-Prot), Q96MP4 (UniProtKB/Swiss-Prot), A2RTX5 (UniProtKB/Swiss-Prot), B7ZLP8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAEALAAEAVASRLERQEEDIRWLWSEVERLRDEQLNAPYSCQAEGPCLTREVAQLRAENCDLRHRLCSLRLCLAEERSRQATLESAELEAAQEAGAQPPPSQSQDKDMKKKKMKESEADSEVKHQP
IFIKERLKLFEILKKDHQLLLAIYGKKGDTSNIITVRVADGQTVQGEVWKTTPYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGP
PIENGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEVSKEILLEMFKYNKFKCRILNEKVNTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNSSTYWEGNPEMETLQRIYGISFPDN
KMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEIEKDTFALKPMNCPGHCLMFAHRPRSWREMPIR
FADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQNSLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATI
QLDFQLPIRFNLTYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTLNKKIRNAQLAQYNFILVVGEKEKIDNAVNVR
TRDNKIHGEILVTSAIDKLKNLRKTRTLNAEEAF

hide sequence

RefSeq Acc Id:	XP_016877401 ⟸ XM_017021912
- Peptide Label:	isoform X2
- UniProtKB:	B7ZLP8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAEALAAEAVASRLERQEEDIRWLWSEVERLRDEQLNAPYSCQAEGPCLTREVAQLRAENCDL RHRLCSLRLCLAEERSRQATLESAELEAAQEAGAQPPPSQSQDKDMKKKKMKESEADSEVKHQPIFIKERLKLFEILKKDHQLLLAIYGKKGDTSNIITVRVADGQTVQGEVWKTTPYQVAAEISQEL AESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEVSKEILLEMFKYNKFKCRILN EKVNTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNSSTYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLTDFIREEYHKRDF TEVLSPNMYNSKLWEASGHWQHYSENMFTFEIEKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLN LSTRPENFLGEIEMWNEAEKQLQNSLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVRMSCKRSHAVSSLLRLASFT hide sequence

Ensembl Acc Id:

ENSP00000452740 ⟸ ENST00000558533

Ensembl Acc Id:

ENSP00000338093 ⟸ ENST00000335968

Ensembl Acc Id:

ENSP00000478827 ⟸ ENST00000615656

Protein Domains

Aminoacyl-transfer RNA synthetases class-II family TGS Threonyl/alanyl tRNA synthetase SAD

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A2RTX5-F1-model_v2	AlphaFold	A2RTX5	1-802	view protein structure

RGD ID:

6792626

Promoter ID:

HG_KWN:22500

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, Lymphoblastoid, NB4

Transcripts:

ENST00000333018, OTTHUMT00000313619

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	15	100,081,794 - 100,082,294 (-)	MPROMDB

RGD ID:

7230701

Promoter ID:

EPDNEW_H21096

Type:

initiation region

Name:

TARSL2_1

Description:

threonyl-tRNA synthetase like 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	15	101,724,456 - 101,724,516	EPDNEW

Database	Acc Id	Source(s)
COSMIC	TARS3	COSMIC
Ensembl Genes	ENSG00000185418	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000335968	ENTREZGENE
	ENST00000335968.8	UniProtKB/Swiss-Prot
	ENST00000615656	ENTREZGENE
Gene3D-CATH	3.10.20.30	UniProtKB/Swiss-Prot
	3.40.50.800	UniProtKB/Swiss-Prot
	Bira Bifunctional Protein, Domain 2	UniProtKB/Swiss-Prot
	Threonyl-trna Synthetase, Chain A, domain 2	UniProtKB/Swiss-Prot
GTEx	ENSG00000185418	GTEx
HGNC ID	HGNC:24728	ENTREZGENE
Human Proteome Map	TARS3	Human Proteome Map
InterPro	aa-tRNA-synt_IIb	UniProtKB/Swiss-Prot
	aa-tRNA-synth_II	UniProtKB/Swiss-Prot
	aa-tRNA-synth_II/BPL/LPL	UniProtKB/Swiss-Prot
	Anticodon-bd	UniProtKB/Swiss-Prot
	Anticodon-bd_dom_sf	UniProtKB/Swiss-Prot
	Beta-grasp_dom_sf	UniProtKB/Swiss-Prot
	TGS	UniProtKB/Swiss-Prot
	TGS-like	UniProtKB/Swiss-Prot
	Thr-tRNA-ligase_IIa	UniProtKB/Swiss-Prot
	Thr/Ala-tRNA-synth_IIc_edit	UniProtKB/Swiss-Prot
	ThrRS_anticodon	UniProtKB/Swiss-Prot
	ThrRS_core	UniProtKB/Swiss-Prot
	tRNA_SAD	UniProtKB/Swiss-Prot
KEGG Report	hsa:123283	UniProtKB/Swiss-Prot
NCBI Gene	123283	ENTREZGENE
PANTHER	PTHR11451	UniProtKB/Swiss-Prot
	THREONINE--TRNA LIGASE 2, CYTOPLASMIC	UniProtKB/Swiss-Prot
Pfam	HGTP_anticodon	UniProtKB/Swiss-Prot
	TGS	UniProtKB/Swiss-Prot
	tRNA-synt_2b	UniProtKB/Swiss-Prot
	tRNA_SAD	UniProtKB/Swiss-Prot
PharmGKB	PA128394753	PharmGKB
PRINTS	TRNASYNTHTHR	UniProtKB/Swiss-Prot
PROSITE	AA_TRNA_LIGASE_II	UniProtKB/Swiss-Prot
	TGS	UniProtKB/Swiss-Prot
SMART	tRNA_SAD	UniProtKB/Swiss-Prot
Superfamily-SCOP	Class II aaRS ABD-related	UniProtKB/Swiss-Prot
	SSF55186	UniProtKB/Swiss-Prot
	SSF55681	UniProtKB/Swiss-Prot
	SSF81271	UniProtKB/Swiss-Prot
UniProt	A2RTX5	ENTREZGENE
	B2RMP7	ENTREZGENE
	B7ZLP8	ENTREZGENE, UniProtKB/TrEMBL
	H0YKB9_HUMAN	UniProtKB/TrEMBL
	Q6B0A1	ENTREZGENE
	Q6IS76	ENTREZGENE
	Q96LW3	ENTREZGENE
	Q96MP4	ENTREZGENE
	SYTC2_HUMAN	UniProtKB/Swiss-Prot
UniProt Secondary	B2RMP7	UniProtKB/Swiss-Prot
	Q6B0A1	UniProtKB/Swiss-Prot
	Q6IS76	UniProtKB/Swiss-Prot
	Q96LW3	UniProtKB/Swiss-Prot
	Q96MP4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-13	TARS3	threonyl-tRNA synthetase 3	TARSL2	threonyl-tRNA synthetase like 2	Symbol and/or name change	5135510	APPROVED
2016-07-05	TARSL2	threonyl-tRNA synthetase like 2		threonyl-tRNA synthetase-like 2	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Human Phenotype Annotations - ClinVar