Symbol:
Arl6ip5
Name:
ADP-ribosylation factor-like 6 interacting protein 5
RGD ID:
1331961
MGI Page
MGI
Description:
Predicted to enable transmembrane transporter binding activity. Involved in negative regulation of L-glutamate import across plasma membrane. Acts upstream of or within with a negative effect on L-glutamate import across plasma membrane and protein localization to plasma membrane. Acts upstream of or within several processes, including L-glutamate transmembrane transport; cellular response to oxidative stress; and glutathione metabolic process. Is active in plasma membrane and presynaptic cytosol. Is expressed in cerebral cortex subventricular zone; cerebral cortex ventricular layer; and cortical plate. Orthologous to human ARL6IP5 (ARF like GTPase 6 interacting protein 5).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
5930404D22Rik; add; addicsin; addiscin; ADP-ribosylation factor-like protein 6-interacting protein 5; ADP-ribosylation-like factor 6 interacting protein 5; Ai; Aip-5; ARL-6-interacting protein 5; AV001879; glutamate transporter EAAC1-interacting protein; Gtrap3; Gtrap3-18; JWa; PRA1 family protein 3; prenylated Rab acceptor protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ARL6IP5 (ARF like GTPase 6 interacting protein 5) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Arl6ip5 (ARF like GTPase 6 interacting protein 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Arl6ip5 (ARF like GTPase 6 interacting protein 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ARL6IP5 (ARF like GTPase 6 interacting protein 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ARL6IP5 (ADP ribosylation factor like GTPase 6 interacting protein 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Arl6ip5 (ARF like GTPase 6 interacting protein 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ARL6IP5 (ADP ribosylation factor like GTPase 6 interacting protein 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ARL6IP5 (ARF like GTPase 6 interacting protein 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Arl6ip5 (ARF like GTPase 6 interacting protein 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Arl6ip5 (ARF like GTPase 6 interacting protein 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ARL6IP5 (ARF like GTPase 6 interacting protein 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
arl6ip5a (ADP-ribosylation factor-like 6 interacting protein 5a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
arl6ip5b (ADP-ribosylation factor-like 6 interacting protein 5b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Jwa
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
praf-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
arl6ip5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 97,187,753 - 97,210,276 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 97,187,650 - 97,210,276 (+) Ensembl GRCm39 Ensembl GRCm38 6 97,210,792 - 97,233,315 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 97,210,689 - 97,233,315 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 97,160,786 - 97,183,309 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 97,176,255 - 97,198,778 (+) NCBI MGSCv36 mm8 Celera 6 99,069,909 - 99,092,703 (+) NCBI Celera Cytogenetic Map 6 D3 NCBI cM Map 6 44.91 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arl6ip5 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ARL6IP5 mRNA CTD PMID:22206623 Arl6ip5 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ARL6IP5 mRNA CTD PMID:22206623 Arl6ip5 Mouse 17beta-estradiol affects expression ISO ARL6IP5 (Homo sapiens) 6480464 Estradiol affects the expression of ARL6IP5 mRNA CTD PMID:14699072 Arl6ip5 Mouse 17beta-estradiol decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Estradiol results in decreased expression of ARL6IP5 mRNA CTD PMID:23019147 Arl6ip5 Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2 more ... CTD PMID:30294300 Arl6ip5 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ARL6IP5 mRNA CTD PMID:21570461 Arl6ip5 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARL6IP5 mRNA CTD PMID:33387578 Arl6ip5 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ARL6IP5 mRNA CTD PMID:34747641 Arl6ip5 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ARL6IP5 mRNA CTD PMID:15034205 more ... Arl6ip5 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of ARL6IP5 mRNA CTD PMID:25975270 Arl6ip5 Mouse 2-hydroxypropanoic acid increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ARL6IP5 mRNA CTD PMID:30851411 Arl6ip5 Mouse 2-methylcholine affects expression ISO ARL6IP5 (Homo sapiens) 6480464 beta-methylcholine affects the expression of ARL6IP5 mRNA CTD PMID:21179406 Arl6ip5 Mouse 3-methylcholanthrene increases expression EXP 6480464 Methylcholanthrene results in increased expression of ARL6IP5 mRNA CTD PMID:20713471 Arl6ip5 Mouse 4,4'-sulfonyldiphenol increases expression ISO ARL6IP5 (Homo sapiens) 6480464 bisphenol S results in increased expression of ARL6IP5 protein CTD PMID:34186270 Arl6ip5 Mouse 4-hydroxyphenyl retinamide affects expression ISO ARL6IP5 (Homo sapiens) 6480464 Fenretinide affects the expression of ARL6IP5 CTD PMID:16720286 Arl6ip5 Mouse 5-aza-2'-deoxycytidine affects expression ISO ARL6IP5 (Homo sapiens) 6480464 Decitabine affects the expression of ARL6IP5 mRNA CTD PMID:23300844 Arl6ip5 Mouse 5-fluorouracil multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 ARL6IP5 protein affects the susceptibility to [Fluorouracil co-treated with Leucovorin co-treated with Cisplatin] and ARL6IP5 protein affects the susceptibility to [Fluorouracil co-treated with Leucovorin co-treated with oxaliplatin] CTD PMID:22452940 Arl6ip5 Mouse 5-formyltetrahydrofolic acid multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 ARL6IP5 protein affects the susceptibility to [Fluorouracil co-treated with Leucovorin co-treated with Cisplatin] and ARL6IP5 protein affects the susceptibility to [Fluorouracil co-treated with Leucovorin co-treated with oxaliplatin] CTD PMID:22452940 Arl6ip5 Mouse 6-propyl-2-thiouracil decreases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of ARL6IP5 mRNA CTD PMID:24780913 Arl6ip5 Mouse 7,12-dimethyltetraphene multiple interactions EXP 6480464 [9 more ... CTD PMID:32553695 Arl6ip5 Mouse 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:32553695 Arl6ip5 Mouse acetylsalicylic acid increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Aspirin results in increased expression of ARL6IP5 mRNA CTD PMID:15928584 Arl6ip5 Mouse all-trans-retinoic acid multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 [Tretinoin co-treated with arsenic trioxide] results in increased expression of ARL6IP5 mRNA more ... CTD PMID:16468075 and PMID:16922813 Arl6ip5 Mouse all-trans-retinoic acid increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Tretinoin results in increased expression of ARL6IP5 mRNA and Tretinoin results in increased expression of ARL6IP5 protein CTD PMID:16430862 more ... Arl6ip5 Mouse all-trans-retinoic acid affects expression ISO ARL6IP5 (Homo sapiens) 6480464 Tretinoin affects the expression of ARL6IP5 CTD PMID:16720286 Arl6ip5 Mouse all-trans-retinoic acid increases response to substance ISO ARL6IP5 (Homo sapiens) 6480464 ARL6IP5 protein results in increased susceptibility to Tretinoin CTD PMID:16922813 Arl6ip5 Mouse ammonium chloride affects expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of ARL6IP5 mRNA CTD PMID:16483693 Arl6ip5 Mouse Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of ARL6IP5 mRNA CTD PMID:25270620 Arl6ip5 Mouse arsenite(3-) increases expression EXP 6480464 arsenite results in increased expression of ARL6IP5 mRNA CTD PMID:15894712 Arl6ip5 Mouse arsenite(3-) multiple interactions EXP 6480464 [arsenite co-treated with Benzo(a)pyrene] results in increased expression of ARL6IP5 mRNA CTD PMID:15894712 Arl6ip5 Mouse arsenous acid increases response to substance ISO ARL6IP5 (Homo sapiens) 6480464 ARL6IP5 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:18387645 Arl6ip5 Mouse arsenous acid multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 [Arsenic Trioxide results in increased abundance of Hydrogen Peroxide] which results in increased expression of ARL6IP5 protein more ... CTD PMID:16468075 and PMID:18387645 Arl6ip5 Mouse arsenous acid increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ARL6IP5 protein CTD PMID:16430862 Arl6ip5 Mouse benzene-1,2,4-triol decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 hydroxyhydroquinone results in decreased expression of ARL6IP5 mRNA CTD PMID:17572062 Arl6ip5 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [arsenite co-treated with Benzo(a)pyrene] results in increased expression of ARL6IP5 mRNA and [Benzo(a)pyrene results in increased activity of AHR protein] which results in increased expression of ARL6IP5 mRNA CTD PMID:15894712 and PMID:32553695 Arl6ip5 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene metabolite results in increased expression of ARL6IP5 mRNA and Benzo(a)pyrene results in increased expression of ARL6IP5 mRNA CTD PMID:15034205 more ... Arl6ip5 Mouse beta-lapachone decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of ARL6IP5 mRNA CTD PMID:38218311 Arl6ip5 Mouse bexarotene increases expression ISO ARL6IP5 (Homo sapiens) 6480464 bexarotene results in increased expression of ARL6IP5 mRNA CTD PMID:17178900 Arl6ip5 Mouse bisphenol A affects expression ISO Arl6ip5 (Rattus norvegicus) 6480464 bisphenol A affects the expression of ARL6IP5 mRNA CTD PMID:25181051 Arl6ip5 Mouse bisphenol A decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ARL6IP5 protein CTD PMID:37664457 Arl6ip5 Mouse bisphenol A increases expression ISO ARL6IP5 (Homo sapiens) 6480464 bisphenol A results in increased expression of ARL6IP5 protein CTD PMID:33376534 more ... Arl6ip5 Mouse bisphenol A decreases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of ARL6IP5 mRNA CTD PMID:30816183 and PMID:32528016 Arl6ip5 Mouse bisphenol AF increases expression ISO ARL6IP5 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ARL6IP5 protein CTD PMID:34186270 Arl6ip5 Mouse Bisphenol B increases expression ISO ARL6IP5 (Homo sapiens) 6480464 bisphenol B results in increased expression of ARL6IP5 protein CTD PMID:34186270 Arl6ip5 Mouse bisphenol F increases expression ISO ARL6IP5 (Homo sapiens) 6480464 bisphenol F results in increased expression of ARL6IP5 protein CTD PMID:34186270 Arl6ip5 Mouse Brodifacoum increases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 bromfenacoum results in increased expression of ARL6IP5 protein CTD PMID:28903499 Arl6ip5 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Arl6ip5 Mouse chloropicrin increases expression ISO ARL6IP5 (Homo sapiens) 6480464 chloropicrin results in increased expression of ARL6IP5 mRNA CTD PMID:26352163 Arl6ip5 Mouse chromium(6+) multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of ARL6IP5 mRNA CTD PMID:38479592 Arl6ip5 Mouse cisplatin affects expression ISO ARL6IP5 (Homo sapiens) 6480464 Cisplatin affects the expression of ARL6IP5 mRNA CTD PMID:23300844 Arl6ip5 Mouse cisplatin multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 ARL6IP5 protein affects the susceptibility to [Fluorouracil co-treated with Leucovorin co-treated with Cisplatin] CTD PMID:22452940 Arl6ip5 Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of ARL6IP5 mRNA CTD PMID:17585979 Arl6ip5 Mouse copper atom decreases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Copper results in decreased expression of ARL6IP5 mRNA CTD PMID:30556269 Arl6ip5 Mouse copper(0) decreases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Copper results in decreased expression of ARL6IP5 mRNA CTD PMID:30556269 Arl6ip5 Mouse copper(II) sulfate decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ARL6IP5 mRNA CTD PMID:19549813 Arl6ip5 Mouse Cuprizon decreases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of ARL6IP5 mRNA CTD PMID:26577399 Arl6ip5 Mouse cyclosporin A decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ARL6IP5 mRNA CTD PMID:20106945 and PMID:25562108 Arl6ip5 Mouse cytarabine increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Cytarabine results in increased expression of ARL6IP5 protein CTD PMID:16430862 Arl6ip5 Mouse diarsenic trioxide increases response to substance ISO ARL6IP5 (Homo sapiens) 6480464 ARL6IP5 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:18387645 Arl6ip5 Mouse diarsenic trioxide increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ARL6IP5 protein CTD PMID:16430862 Arl6ip5 Mouse diarsenic trioxide multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 [Arsenic Trioxide results in increased abundance of Hydrogen Peroxide] which results in increased expression of ARL6IP5 protein more ... CTD PMID:16468075 and PMID:18387645 Arl6ip5 Mouse Dibutyl phosphate affects expression ISO ARL6IP5 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ARL6IP5 mRNA CTD PMID:37042841 Arl6ip5 Mouse dibutyl phthalate decreases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of ARL6IP5 mRNA CTD PMID:21266533 Arl6ip5 Mouse dicrotophos decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 dicrotophos results in decreased expression of ARL6IP5 mRNA CTD PMID:28302478 Arl6ip5 Mouse diuron decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Diuron results in decreased expression of ARL6IP5 mRNA CTD PMID:35967413 Arl6ip5 Mouse doxorubicin increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Doxorubicin results in increased expression of ARL6IP5 protein CTD PMID:16430862 Arl6ip5 Mouse etoposide decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Etoposide results in decreased expression of ARL6IP5 CTD PMID:19492242 Arl6ip5 Mouse etoposide increases response to substance ISO ARL6IP5 (Homo sapiens) 6480464 ARL6IP5 protein results in increased susceptibility to Etoposide CTD PMID:19492242 Arl6ip5 Mouse fipronil increases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 fipronil results in increased expression of ARL6IP5 mRNA CTD PMID:31881178 Arl6ip5 Mouse flutamide increases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Flutamide results in increased expression of ARL6IP5 mRNA CTD PMID:24136188 Arl6ip5 Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ARL6IP5 mRNA CTD PMID:22206623 Arl6ip5 Mouse gentamycin increases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of ARL6IP5 mRNA CTD PMID:22061828 and PMID:33387578 Arl6ip5 Mouse hemin increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Hemin results in increased expression of ARL6IP5 protein CTD PMID:16430862 Arl6ip5 Mouse hydralazine multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ARL6IP5 mRNA CTD PMID:17183730 Arl6ip5 Mouse hydrogen peroxide multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 [arsenic trioxide results in increased abundance of Hydrogen Peroxide] which results in increased expression of ARL6IP5 protein and CAT protein inhibits the reaction [[arsenic trioxide results in increased abundance of Hydrogen Peroxide] which results in increased expression of ARL6IP5 protein] CTD PMID:18387645 Arl6ip5 Mouse ivermectin decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ARL6IP5 protein CTD PMID:32959892 Arl6ip5 Mouse kojic acid increases expression ISO ARL6IP5 (Homo sapiens) 6480464 kojic acid results in increased expression of ARL6IP5 mRNA CTD PMID:16595896 Arl6ip5 Mouse Mesaconitine decreases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 mesaconitine results in decreased expression of ARL6IP5 protein CTD PMID:37182599 Arl6ip5 Mouse methylmercury chloride decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of ARL6IP5 mRNA CTD PMID:23179753 Arl6ip5 Mouse morphine multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 ARL6IP5 mutant form inhibits the reaction [Morphine results in increased expression of OPRD1 protein] more ... CTD PMID:21600884 Arl6ip5 Mouse morphine increases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Morphine results in increased expression of ARL6IP5 protein CTD PMID:21600884 Arl6ip5 Mouse morphine multiple interactions ISO Arl6ip5 (Rattus norvegicus) 6480464 ARL6IP5 mutant form inhibits the reaction [Morphine results in increased expression of OPRD1 protein] more ... CTD PMID:21600884 Arl6ip5 Mouse N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Arl6ip5 (Rattus norvegicus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [ARL6IP5 mutant form inhibits the reaction [Morphine results in increased expression of OPRD1 protein]] CTD PMID:21600884 Arl6ip5 Mouse nickel subsulfide increases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 nickel subsulfide results in increased expression of ARL6IP5 mRNA CTD PMID:21086188 Arl6ip5 Mouse oxaliplatin multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 ARL6IP5 protein affects the susceptibility to [Fluorouracil co-treated with Leucovorin co-treated with oxaliplatin] CTD PMID:22452940 Arl6ip5 Mouse ozone multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ARL6IP5 mRNA CTD PMID:35430440 Arl6ip5 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of ARL6IP5 mRNA CTD PMID:17562736 Arl6ip5 Mouse paracetamol decreases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of ARL6IP5 mRNA CTD PMID:33387578 Arl6ip5 Mouse paracetamol decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ARL6IP5 mRNA CTD PMID:21420995 and PMID:29067470 Arl6ip5 Mouse paraquat increases expression EXP 6480464 Paraquat results in increased expression of ARL6IP5 CTD PMID:28428137 Arl6ip5 Mouse paraquat multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 ARL6IP5 protein affects the reaction [Paraquat affects the expression of NFE2L2 protein] more ... CTD PMID:28428137 Arl6ip5 Mouse paraquat multiple interactions EXP 6480464 ARL6IP5 protein affects the reaction [Paraquat affects the expression of NFE2L2 protein] more ... CTD PMID:28428137 Arl6ip5 Mouse paraquat affects response to substance EXP 6480464 ARL6IP5 protein affects the susceptibility to Paraquat CTD PMID:28428137 Arl6ip5 Mouse paraquat increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Paraquat results in increased expression of ARL6IP5 protein CTD PMID:28428137 Arl6ip5 Mouse parathion decreases expression EXP 6480464 Parathion results in decreased expression of ARL6IP5 mRNA CTD PMID:34813904 Arl6ip5 Mouse perfluorooctanoic acid decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of ARL6IP5 protein CTD PMID:26879310 Arl6ip5 Mouse phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of ARL6IP5 mRNA CTD PMID:19270015 Arl6ip5 Mouse phorbol 13-acetate 12-myristate multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate inhibits the reaction [Tretinoin results in increased expression of ARL6IP5 mRNA] CTD PMID:16468075 Arl6ip5 Mouse phorbol 13-acetate 12-myristate increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of ARL6IP5 protein CTD PMID:16430862 Arl6ip5 Mouse phoxim affects expression ISO ARL6IP5 (Homo sapiens) 6480464 phoxim affects the expression of ARL6IP5 protein CTD PMID:15799245 Arl6ip5 Mouse piroxicam increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Piroxicam results in increased expression of ARL6IP5 mRNA CTD PMID:21858171 Arl6ip5 Mouse potassium chromate decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ARL6IP5 mRNA CTD PMID:22714537 Arl6ip5 Mouse quercetin decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Quercetin results in decreased expression of ARL6IP5 mRNA CTD PMID:21632981 Arl6ip5 Mouse rac-lactic acid increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ARL6IP5 mRNA CTD PMID:30851411 Arl6ip5 Mouse rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ARL6IP5 mRNA CTD PMID:23186747 Arl6ip5 Mouse SB 431542 multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of ARL6IP5 protein CTD PMID:37664457 Arl6ip5 Mouse temozolomide decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Temozolomide results in decreased expression of ARL6IP5 mRNA CTD PMID:31758290 Arl6ip5 Mouse tert-butyl hydroperoxide decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of ARL6IP5 mRNA CTD PMID:15336504 Arl6ip5 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ARL6IP5 mRNA CTD PMID:27339419 and PMID:31919559 Arl6ip5 Mouse thioacetamide increases expression ISO Arl6ip5 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of ARL6IP5 mRNA CTD PMID:34492290 Arl6ip5 Mouse thiram decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Thiram results in decreased expression of ARL6IP5 mRNA CTD PMID:38568856 Arl6ip5 Mouse triphenyl phosphate affects expression ISO ARL6IP5 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ARL6IP5 mRNA CTD PMID:37042841 Arl6ip5 Mouse trovafloxacin increases expression EXP 6480464 trovafloxacin results in increased expression of ARL6IP5 mRNA CTD PMID:35537566 Arl6ip5 Mouse valproic acid multiple interactions ISO ARL6IP5 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ARL6IP5 mRNA CTD PMID:17183730 Arl6ip5 Mouse valproic acid increases expression ISO ARL6IP5 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ARL6IP5 mRNA CTD PMID:19101580 more ... Arl6ip5 Mouse valproic acid affects expression ISO ARL6IP5 (Homo sapiens) 6480464 Valproic Acid affects the expression of ARL6IP5 mRNA CTD PMID:25979313 Arl6ip5 Mouse zinc atom decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of ARL6IP5 mRNA CTD PMID:22171008 Arl6ip5 Mouse zinc(0) decreases expression ISO ARL6IP5 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of ARL6IP5 mRNA CTD PMID:22171008
1,2-dimethylhydrazine (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3-methylcholanthrene (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 5-formyltetrahydrofolic acid (ISO) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (EXP) acetylsalicylic acid (ISO) all-trans-retinoic acid (ISO) ammonium chloride (ISO) Aroclor 1254 (EXP) arsenite(3-) (EXP) arsenous acid (ISO) benzene-1,2,4-triol (ISO) benzo[a]pyrene (EXP) beta-lapachone (ISO) bexarotene (ISO) bisphenol A (ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Brodifacoum (ISO) carbon nanotube (EXP) chloropicrin (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) Cuprizon (ISO) cyclosporin A (ISO) cytarabine (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diuron (ISO) doxorubicin (ISO) etoposide (ISO) fipronil (ISO) flutamide (ISO) folic acid (EXP) gentamycin (ISO) hemin (ISO) hydralazine (ISO) hydrogen peroxide (ISO) ivermectin (ISO) kojic acid (ISO) Mesaconitine (ISO) methylmercury chloride (ISO) morphine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel subsulfide (ISO) oxaliplatin (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) parathion (EXP) perfluorooctanoic acid (ISO) phenobarbital (EXP) phorbol 13-acetate 12-myristate (ISO) phoxim (ISO) piroxicam (ISO) potassium chromate (ISO) quercetin (ISO) rac-lactic acid (ISO) rotenone (EXP) SB 431542 (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) thioacetamide (ISO) thiram (ISO) triphenyl phosphate (ISO) trovafloxacin (EXP) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Arl6ip5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 97,187,753 - 97,210,276 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 97,187,650 - 97,210,276 (+) Ensembl GRCm39 Ensembl GRCm38 6 97,210,792 - 97,233,315 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 97,210,689 - 97,233,315 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 97,160,786 - 97,183,309 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 97,176,255 - 97,198,778 (+) NCBI MGSCv36 mm8 Celera 6 99,069,909 - 99,092,703 (+) NCBI Celera Cytogenetic Map 6 D3 NCBI cM Map 6 44.91 NCBI
ARL6IP5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 69,084,937 - 69,106,092 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 69,084,937 - 69,106,092 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 69,134,088 - 69,155,243 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 69,216,780 - 69,237,929 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 69,216,779 - 69,237,927 NCBI Celera 3 69,062,198 - 69,083,349 (+) NCBI Celera Cytogenetic Map 3 p14.1 NCBI HuRef 3 69,135,165 - 69,156,317 (+) NCBI HuRef CHM1_1 3 69,085,302 - 69,106,451 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 69,121,729 - 69,142,904 (+) NCBI T2T-CHM13v2.0
Arl6ip5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 131,365,320 - 131,395,311 (+) NCBI GRCr8 mRatBN7.2 4 129,810,650 - 129,838,628 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 129,810,645 - 129,838,608 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 135,240,121 - 135,262,313 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 131,021,163 - 131,043,358 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 129,639,108 - 129,661,304 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 129,574,363 - 129,598,240 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 129,574,264 - 129,598,915 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 194,077,777 - 194,099,732 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 131,929,503 - 131,953,033 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 132,174,335 - 132,198,662 (+) NCBI Celera 4 118,691,862 - 118,713,984 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
Arl6ip5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955421 18,747,729 - 18,766,408 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955421 18,747,729 - 18,766,559 (-) NCBI ChiLan1.0 ChiLan1.0
ARL6IP5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 69,036,483 - 69,061,507 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 69,044,998 - 69,065,627 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 69,020,908 - 69,042,065 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 70,387,605 - 70,408,909 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 70,387,581 - 70,408,909 (+) Ensembl panpan1.1 panPan2
ARL6IP5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 22,632,613 - 22,653,894 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 22,633,808 - 22,653,870 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 22,607,070 - 22,628,807 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 22,658,421 - 22,679,823 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 22,657,809 - 22,679,724 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 22,352,356 - 22,373,877 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 22,695,566 - 22,717,292 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 22,765,439 - 22,787,039 (-) NCBI UU_Cfam_GSD_1.0
Arl6ip5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404942 1,525,497 - 1,549,923 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936603 1,524,625 - 1,549,923 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936603 1,524,959 - 1,549,923 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARL6IP5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 50,509,519 - 50,538,966 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 50,509,777 - 50,538,004 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 55,664,791 - 55,668,851 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARL6IP5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 30,110,881 - 30,132,186 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 30,111,017 - 30,135,240 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 136,659,968 - 136,681,967 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arl6ip5
.
Predicted Target Of
Count of predictions: 272 Count of miRNA genes: 219 Interacting mature miRNAs: 247 Transcripts: ENSMUST00000044681 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11532719 Sluc45_m susceptibility to lung cancer 45 (mouse) 6 92584287 98235894 Mouse 10043864 T2dm4sa_m type 2 diabetes mellitus 4 in SMXA RI mice (mouse) Not determined 6 83690851 146954059 Mouse 1301521 Pas1c_m pulmonary adenoma susceptibility 1c (mouse) Not determined 6 71958006 105958152 Mouse 10412119 Stv_m striatal volumne (mouse) Not determined 6 60026991 100026967 Mouse 1300954 Fcsa1_m femoral cross-sectional area 1 (mouse) Not determined 6 71958006 105958152 Mouse 4141940 W6q5_m weight 6 weeks QTL 5 (mouse) Not determined 96632912 146535124 Mouse 4142259 Tabw2_m tally ho associated body weight 2 (mouse) Not determined 46912919 136400690 Mouse 25314319 Histh6_m histamine hypersensitivity 6 (mouse) 6 48696934 125336963 Mouse 12792979 Fbmd2_m femoral bone mineral density 2, females only (mouse) 6 75026989 115026943 Mouse 25314320 Histh5_m histamine hypersensitivity 5 (mouse) 6 48696934 148351498 Mouse 1300869 Stheal5_m soft tissue heal 5 (mouse) Not determined 6 71552042 105552160 Mouse 1301962 Eila2_m ethanol induced locomotor activity 2 (mouse) Not determined 6 48703490 125333748 Mouse 1301320 Ots1_m ovarian teratoma susceptibility 1 (mouse) Not determined 6 75424566 104480516 Mouse 1301262 Gasa3_m gastritis type A susceptibility locus 3 (mouse) Not determined 6 88982366 122982564 Mouse 11353842 Bmiq4_m body mass index QTL 4 (mouse) 6 92584287 146330736 Mouse 10412157 Fl1n_m fatty liver 1 in NSY (mouse) Not determined 6 45290993 128811995 Mouse 11251720 Ewc4_m ethanol withdrawal and consumption 4 (mouse) 6 84099474 118099474 Mouse 1301744 Hdlq11_m HDL QTL 11 (mouse) Not determined 6 87480321 121480516 Mouse 25440480 Moaq2_m modifier of alien QTL 2 (mouse) 6 3050001 117476961 Mouse 26884414 Bzwq12_m bi-zygomatic width QTL 12, 16 week (mouse) 6 3400000 139076998 Mouse 10043901 Pfat5_m predicted fat percentage 5 (mouse) Not determined 6 75584287 109584431 Mouse 1301687 Mnic2_m macronutrient intake (mouse) Not determined 6 86783787 113521563 Mouse 1301813 Skl3_m skeletal size (tail length) 3 (mouse) Not determined 6 70402880 104403016 Mouse 1357683 Igf1sl1_m IGF-1 serum levels 1 (mouse) Not determined 6 52138693 116132228 Mouse 1301876 Bits2_m bitterness sensitivity 2 (mouse) Not determined 6 70402880 104403016 Mouse 1357875 Pfat2_m predicted fat percentage 2 (mouse) Not determined 6 76440930 110441074 Mouse 1357555 Tesq2_m testis weight QTL 2 (mouse) Not determined 6 96632912 146535124 Mouse 1301369 Im4_m immunoregulatory 4 (mouse) Not determined 6 63461721 97461888 Mouse 10412208 Cypr4_m cytokine production 4 (mouse) Not determined 6 75693484 109693678 Mouse 1301244 Ichs_m immediate cutaneous hypersensitivity QTL (mouse) Not determined 6 90772571 124772807 Mouse 4142416 Egq11_m early growth QTL 11 (mouse) Not determined 96632912 146535124 Mouse 1300704 Cia3_m collagen induced arthritis QTL 3 (mouse) Not determined 6 96324286 130324483 Mouse 4141578 Obrq1_m obesity resistance QTL 1 (mouse) Not determined 92584287 111981699 Mouse 1300650 Bw18_m body weight QTL 18 (mouse) Not determined 6 66690851 100691013 Mouse 1301034 Egrm2_m early growth rate (mouse) Not determined 6 70402880 104403016 Mouse 14696731 Pairq1_m P. aeruginosa infection resistance QTL 1 (mouse) 6 81476981 102176961 Mouse 13506930 Recrq9_m recombination rate in male meiosis QTL 9 (mouse) 6 73476983 134676963 Mouse 4141376 Dbm1_m diabetes modifier 1 (mouse) Not determined 6 78606487 121092347 Mouse 1301292 Cfbw2_m cystic fibrosis body weight 2 (mouse) Not determined 6 94981612 128981699 Mouse 11040599 Lmr4b_m leishmaniasis resistance 4b (mouse) 6 96324286 130324483 Mouse
AV001879
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 97,232,921 - 97,233,055 UniSTS GRCm38 MGSCv37 6 97,182,915 - 97,183,049 UniSTS GRCm37 Celera 6 99,092,309 - 99,092,443 UniSTS Cytogenetic Map 6 D3 UniSTS Whitehead/MRC_RH 6 987.45 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000044681 ⟹ ENSMUSP00000041503
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 97,187,650 - 97,210,276 (+) Ensembl GRCm38.p6 Ensembl 6 97,210,689 - 97,233,315 (+) Ensembl
RefSeq Acc Id:
NM_022992 ⟹ NP_075368
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 97,187,753 - 97,210,276 (+) NCBI GRCm38 6 97,210,792 - 97,233,315 (+) ENTREZGENE MGSCv37 6 97,160,786 - 97,183,309 (+) RGD Celera 6 99,069,909 - 99,092,703 (+) RGD cM Map 6 ENTREZGENE
Sequence:
CGAAGGCGAAGCTCGCGAAGCAGAGGAACATGGACGTGAACCTCGCCCCGCTCCGTGCCTGGGACGATTTCTTCCCGGGCTCTGATCGTTTCGCCCGGCCGGACTTCAGGGACATTTCCAAATGGAAC
hide sequence
RefSeq Acc Id:
NP_075368 ⟸ NM_022992
- UniProtKB:
Q9DB37 (UniProtKB/Swiss-Prot), Q9D838 (UniProtKB/Swiss-Prot), Q8C2Q1 (UniProtKB/Swiss-Prot), Q9WUG9 (UniProtKB/Swiss-Prot), Q8R5J9 (UniProtKB/Swiss-Prot)
- Sequence:
MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFLSPFNMILGGVIVVLVFMGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVMVFVFGITL
hide sequence
Ensembl Acc Id:
ENSMUSP00000041503 ⟸ ENSMUST00000044681
RGD ID: 6838949 Promoter ID: MM_KWN:47005 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, 3T3L1_Day2, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000056870 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 6 97,160,594 - 97,161,094 (+) MPROMDB
RGD ID: 6890518 Promoter ID: EPDNEW_M8710 Type: initiation region Name: Arl6ip5_1 Description: Mus musculus ADP-ribosylation factor-like 6 interacting protein5 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 6 97,210,795 - 97,210,855 EPDNEW
