Symbol:
Rab22a
Name:
RAB22A, member RAS oncogene family
RGD ID:
1323683
MGI Page
MGI
Description:
Enables GTP binding activity and GTPase activity. Predicted to be involved in endocytosis; intracellular protein transport; and regulation of vesicle size. Located in actin cytoskeleton. Orthologous to human RAB22A (RAB22A, member RAS oncogene family).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
3732413A17Rik; AI662177; AW319644; AW550514; E130120E14Rik; Rab; rab-14; rab-22; Rab22; RAB22, member RAS oncogene family; ras-related protein Rab-22A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RAB22A (RAB22A, member RAS oncogene family) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Rab22a (RAB22A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rab22a (RAB22A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RAB22A (RAB22A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RAB22A (RAB22A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rab22a (RAB22A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RAB22A (RAB22A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RAB22A (RAB22A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rab22a (RAB22A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RAB31 (RAB31, member RAS oncogene family) HGNC
OrthoDB
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Rab22a (RAB22A, member RAS oncogene family)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
RAB22A (RAB22A, member RAS oncogene family)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rab22a (RAB22A, member RAS oncogene family)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 173,501,638 - 173,543,975 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 173,501,553 - 173,549,136 (+) Ensembl GRCm39 Ensembl GRCm38 2 173,659,836 - 173,702,186 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 173,659,760 - 173,707,343 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 173,485,346 - 173,527,683 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 173,302,800 - 173,347,611 (+) NCBI MGSCv36 mm8 Celera 2 179,627,701 - 179,670,031 (+) NCBI Celera Cytogenetic Map 2 H4 NCBI cM Map 2 97.26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rab22a Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of RAB22A mRNA CTD PMID:22206623 Rab22a Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of RAB22A mRNA CTD PMID:22206623 Rab22a Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RAB22A mRNA CTD PMID:17942748 Rab22a Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with AHR gene mutant form] results in decreased expression of RAB22A mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RAB22A mRNA CTD PMID:17942748 and PMID:19465110 Rab22a Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Rab22a (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RAB22A mRNA CTD PMID:34747641 Rab22a Mouse 2,4-dinitrotoluene affects expression ISO Rab22a (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of RAB22A mRNA CTD PMID:21346803 Rab22a Mouse 2-hydroxypropanoic acid decreases expression ISO RAB22A (Homo sapiens) 6480464 Lactic Acid results in decreased expression of RAB22A mRNA CTD PMID:30851411 Rab22a Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Rab22a (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RAB22A mRNA CTD PMID:36041667 Rab22a Mouse aflatoxin B1 increases methylation ISO RAB22A (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of RAB22A intron CTD PMID:30157460 Rab22a Mouse aristolochic acid A increases expression ISO RAB22A (Homo sapiens) 6480464 aristolochic acid I results in increased expression of RAB22A mRNA CTD PMID:33212167 Rab22a Mouse atrazine decreases expression ISO RAB22A (Homo sapiens) 6480464 Atrazine results in decreased expression of RAB22A mRNA CTD PMID:22378314 Rab22a Mouse benzene increases expression ISO RAB22A (Homo sapiens) 6480464 Benzene results in increased expression of RAB22A mRNA CTD PMID:19162166 Rab22a Mouse benzene-1,2,4-triol increases expression ISO RAB22A (Homo sapiens) 6480464 hydroxyhydroquinone results in increased expression of RAB22A mRNA CTD PMID:17572062 Rab22a Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of RAB22A mRNA CTD PMID:19770486 Rab22a Mouse benzo[a]pyrene affects methylation ISO RAB22A (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RAB22A promoter CTD PMID:27901495 Rab22a Mouse bisphenol A increases expression ISO Rab22a (Rattus norvegicus) 6480464 bisphenol A results in increased expression of RAB22A mRNA CTD PMID:30816183 more ... Rab22a Mouse bisphenol A multiple interactions ISO Rab22a (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RAB22A mRNA CTD PMID:36041667 Rab22a Mouse bisphenol F multiple interactions ISO Rab22a (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RAB22A mRNA CTD PMID:36041667 Rab22a Mouse butanal decreases expression ISO RAB22A (Homo sapiens) 6480464 butyraldehyde results in decreased expression of RAB22A mRNA CTD PMID:26079696 Rab22a Mouse cadmium dichloride increases expression ISO RAB22A (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of RAB22A mRNA and Cadmium Chloride results in increased expression of RAB22A protein CTD PMID:24527689 and PMID:27510461 Rab22a Mouse carbamazepine affects expression ISO RAB22A (Homo sapiens) 6480464 Carbamazepine affects the expression of RAB22A mRNA CTD PMID:25979313 Rab22a Mouse CGP 52608 multiple interactions ISO RAB22A (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to RAB22A gene] CTD PMID:28238834 Rab22a Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of RAB22A mRNA CTD PMID:37019170 Rab22a Mouse cobalt dichloride increases expression ISO RAB22A (Homo sapiens) 6480464 cobaltous chloride results in increased expression of RAB22A mRNA CTD PMID:19376846 Rab22a Mouse copper(II) sulfate increases expression ISO RAB22A (Homo sapiens) 6480464 Copper Sulfate results in increased expression of RAB22A mRNA CTD PMID:19549813 Rab22a Mouse crotonaldehyde decreases expression ISO RAB22A (Homo sapiens) 6480464 2-butenal results in decreased expression of RAB22A mRNA CTD PMID:20471460 Rab22a Mouse cyclosporin A increases expression ISO RAB22A (Homo sapiens) 6480464 Cyclosporine results in increased expression of RAB22A mRNA CTD PMID:20106945 and PMID:25562108 Rab22a Mouse Dibutyl phosphate affects expression ISO RAB22A (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RAB22A mRNA CTD PMID:37042841 Rab22a Mouse doxorubicin decreases expression ISO RAB22A (Homo sapiens) 6480464 Doxorubicin results in decreased expression of RAB22A mRNA CTD PMID:29803840 Rab22a Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of RAB22A mRNA CTD PMID:22206623 Rab22a Mouse formaldehyde increases expression ISO RAB22A (Homo sapiens) 6480464 Formaldehyde results in increased expression of RAB22A mRNA CTD PMID:23649840 Rab22a Mouse FR900359 decreases phosphorylation ISO RAB22A (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of RAB22A protein CTD PMID:37730182 Rab22a Mouse gentamycin increases expression ISO Rab22a (Rattus norvegicus) 6480464 Gentamicins results in increased expression of RAB22A mRNA CTD PMID:33387578 Rab22a Mouse hypochlorous acid decreases expression EXP 6480464 Hypochlorous Acid results in decreased expression of RAB22A mRNA CTD PMID:19376150 Rab22a Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of RAB22A mRNA CTD PMID:34813904 Rab22a Mouse methylmercury chloride decreases expression ISO RAB22A (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of RAB22A mRNA CTD PMID:28001369 Rab22a Mouse nickel atom increases expression ISO RAB22A (Homo sapiens) 6480464 Nickel results in increased expression of RAB22A mRNA CTD PMID:25583101 Rab22a Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of RAB22A mRNA CTD PMID:35964746 Rab22a Mouse ozone multiple interactions ISO RAB22A (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of RAB22A mRNA CTD PMID:35430440 Rab22a Mouse rac-lactic acid decreases expression ISO RAB22A (Homo sapiens) 6480464 Lactic Acid results in decreased expression of RAB22A mRNA CTD PMID:30851411 Rab22a Mouse sodium arsenite increases expression ISO RAB22A (Homo sapiens) 6480464 sodium arsenite results in increased expression of RAB22A mRNA CTD PMID:24431212 and PMID:38568856 Rab22a Mouse sunitinib increases expression ISO RAB22A (Homo sapiens) 6480464 Sunitinib results in increased expression of RAB22A mRNA CTD PMID:31533062 Rab22a Mouse temozolomide decreases expression ISO RAB22A (Homo sapiens) 6480464 Temozolomide results in decreased expression of RAB22A mRNA CTD PMID:31758290 Rab22a Mouse tert-butyl hydroperoxide increases expression ISO RAB22A (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of RAB22A mRNA CTD PMID:15336504 Rab22a Mouse testosterone decreases expression ISO RAB22A (Homo sapiens) 6480464 Testosterone results in decreased expression of RAB22A mRNA CTD PMID:33359661 Rab22a Mouse thiram increases expression ISO RAB22A (Homo sapiens) 6480464 Thiram results in increased expression of RAB22A mRNA CTD PMID:38568856 Rab22a Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of RAB22A gene CTD PMID:35295148 Rab22a Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of RAB22A gene CTD PMID:35295148 Rab22a Mouse trichloroethene increases methylation ISO Rab22a (Rattus norvegicus) 6480464 Trichloroethylene results in increased methylation of RAB22A gene CTD PMID:27618143 Rab22a Mouse triphenyl phosphate increases expression ISO Rab22a (Rattus norvegicus) 6480464 triphenyl phosphate results in increased expression of RAB22A mRNA CTD PMID:30589522 Rab22a Mouse troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of RAB22A mRNA CTD PMID:28973697 Rab22a Mouse urethane increases expression ISO RAB22A (Homo sapiens) 6480464 Urethane results in increased expression of RAB22A mRNA CTD PMID:28818685 Rab22a Mouse valproic acid increases methylation ISO RAB22A (Homo sapiens) 6480464 Valproic Acid results in increased methylation of RAB22A gene CTD PMID:29154799 Rab22a Mouse valproic acid decreases expression ISO RAB22A (Homo sapiens) 6480464 Valproic Acid results in decreased expression of RAB22A mRNA CTD PMID:24935251 and PMID:28001369 Rab22a Mouse valproic acid affects expression ISO RAB22A (Homo sapiens) 6480464 Valproic Acid affects the expression of RAB22A mRNA CTD PMID:25979313 Rab22a Mouse valproic acid increases expression ISO RAB22A (Homo sapiens) 6480464 Valproic Acid results in increased expression of RAB22A mRNA CTD PMID:23179753 Rab22a Mouse zinc atom multiple interactions ISO RAB22A (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of RAB22A mRNA CTD PMID:18593933 Rab22a Mouse zinc(0) multiple interactions ISO RAB22A (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of RAB22A mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) aristolochic acid A (ISO) atrazine (ISO) benzene (ISO) benzene-1,2,4-triol (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) carbamazepine (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) cobalt dichloride (ISO) copper(II) sulfate (ISO) crotonaldehyde (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) doxorubicin (ISO) folic acid (EXP) formaldehyde (ISO) FR900359 (ISO) gentamycin (ISO) hypochlorous acid (EXP) methidathion (EXP) methylmercury chloride (ISO) nickel atom (ISO) nitrates (EXP) ozone (ISO) rac-lactic acid (ISO) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) thiram (ISO) titanium dioxide (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) troglitazone (EXP) urethane (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Rab22a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 173,501,638 - 173,543,975 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 173,501,553 - 173,549,136 (+) Ensembl GRCm39 Ensembl GRCm38 2 173,659,836 - 173,702,186 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 173,659,760 - 173,707,343 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 173,485,346 - 173,527,683 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 173,302,800 - 173,347,611 (+) NCBI MGSCv36 mm8 Celera 2 179,627,701 - 179,670,031 (+) NCBI Celera Cytogenetic Map 2 H4 NCBI cM Map 2 97.26 NCBI
RAB22A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 58,309,715 - 58,367,507 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 58,309,715 - 58,367,507 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 56,884,771 - 56,942,563 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 56,318,177 - 56,375,969 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 56,318,176 - 56,375,968 NCBI Celera 20 53,625,236 - 53,683,029 (+) NCBI Celera Cytogenetic Map 20 q13.32 NCBI HuRef 20 53,667,419 - 53,725,442 (+) NCBI HuRef CHM1_1 20 56,786,311 - 56,844,104 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 60,090,659 - 60,148,468 (+) NCBI T2T-CHM13v2.0
Rab22a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 182,877,746 - 182,924,400 (+) NCBI GRCr8 mRatBN7.2 3 162,459,727 - 162,506,129 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 162,459,726 - 162,506,137 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 166,258,779 - 166,305,183 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 174,763,858 - 174,810,369 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 172,499,581 - 172,545,983 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 171,743,884 - 171,790,558 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 171,743,929 - 171,790,558 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 177,802,611 - 177,849,268 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 164,556,619 - 164,603,742 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 164,462,654 - 164,500,898 (+) NCBI Celera 3 161,643,762 - 161,690,130 (+) NCBI Celera Cytogenetic Map 3 q42 NCBI
Rab22a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 1,174,817 - 1,225,763 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 1,167,941 - 1,224,932 (-) NCBI ChiLan1.0 ChiLan1.0
RAB22A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 64,066,823 - 64,126,006 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 64,059,943 - 64,119,126 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 54,655,014 - 54,714,349 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 55,929,798 - 55,982,739 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 55,929,801 - 55,983,009 (+) Ensembl panpan1.1 panPan2
RAB22A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 43,109,489 - 43,157,932 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 43,108,918 - 43,157,932 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 42,355,057 - 42,404,621 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 43,974,055 - 44,023,796 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 43,973,367 - 44,024,744 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 43,076,468 - 43,125,967 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 43,197,302 - 43,246,562 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 43,855,771 - 43,905,501 (+) NCBI UU_Cfam_GSD_1.0
Rab22a
RAB22A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 58,514,985 - 58,572,421 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 58,514,985 - 58,572,421 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 65,726,340 - 65,783,779 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RAB22A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 5,761,037 - 5,820,531 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 5,768,840 - 5,820,492 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 53,815,302 - 53,874,745 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rab22a
.
Predicted Target Of
Count of predictions: 4375 Count of miRNA genes: 855 Interacting mature miRNAs: 1141 Transcripts: ENSMUST00000029024, ENSMUST00000109110, ENSMUST00000142820 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300688 Nidd2k_m Nidd2 on KK-A (mouse) Not determined 2 158078337 178442452 Mouse 1301783 Bhr1_m bronchial hyperresponsiveness 1 (mouse) Not determined 2 142593476 178442452 Mouse 12790983 Bwq12_m body weight QTL 12 (mouse) 2 148238204 181755017 Mouse 11038701 Ltpr2e_m Leishmania tropica response 2e (mouse) 2 150212221 181755017 Mouse 1301019 Bmd6_m bone mineral density 6 (mouse) Not determined 2 151778297 181755017 Mouse 4142450 Lmr16_m leishmaniasis resistance 16 (mouse) Not determined 2 150212221 181755017 Mouse 1301085 Lrnx10_m learning-contextual 10 (mouse) Not determined 2 150212221 181755017 Mouse 11353826 Bdln10_m body length 10 (mouse) 2 140441482 174441482 Mouse 1300867 Lore2_m loss of righting induced by ethanol 2 (mouse) Not determined 2 144515861 180896594 Mouse 1558917 Gct8_m granulosa cell tumorigenesis 8 (mouse) Not determined 2 149236907 181755017 Mouse 1300806 Aod4_m autoimmune ovarian dysgenesis 4 (mouse) Not determined 2 145228719 179228841 Mouse 1300676 Prdt2_m prion disease incubation time 2 (mouse) Not determined 2 164515154 181755017 Mouse 1558991 Tailq4_m tail length QTL 4 (mouse) Not determined 2 162736926 178442452 Mouse 14747002 Mancz3_m mandible centroid size 3 (mouse) 2 152329820 181755017 Mouse 1300751 Bdt1_m bone density traits 1 (mouse) Not determined 2 149988902 181755017 Mouse 1300622 Cfld1_m cystic fibrosis lung disease 1 (mouse) Not determined 2 155823920 181755017 Mouse 12910811 Pwbwq3_m pre-weaning body weight QTL 3 (mouse) 2 169794802 178920791 Mouse 1302003 Sluc17_m susceptibility to lung cancer 17 (mouse) Not determined 2 162433493 181755017 Mouse 1301618 Bglu1_m blood glucose level 1 (mouse) Not determined 2 117942930 174324863 Mouse 12738409 Lfibq1_m liver fibrosis QTL 1 (mouse) 2 167716420 179207088 Mouse 1302013 Tbbmd3_m total body bone mineral density 3 (mouse) Not determined 2 145196949 179197085 Mouse 5491196 Mobq6_m multigenic obesity QTL 6 (mouse) Not determined 2 85724269 180896594 Mouse 1357435 Epfq2_m epididymal fat pad weight QTL 2 (mouse) Not determined 2 162736926 178442452 Mouse 12801456 Intmrm1_m intima/media ratio modifier 1 (mouse) 2 142428347 176428450 Mouse 1357537 Lith12_m lithogenic gene 12 (mouse) Not determined 2 156196464 181755017 Mouse 12801461 Intim1_m intima modifier 1 (mouse) 2 142428347 176428450 Mouse 1301348 Alcp5_m alcohol preference locus 5 (mouse) Not determined 2 163486407 181755017 Mouse 1301865 Hdlq19_m HDL QTL 19 (mouse) Not determined 2 145518775 179518926 Mouse 4142211 Nilac3_m nicotine induced locomotor activity 3 (mouse) Not determined 2 148664893 181755017 Mouse 12910520 Scgq3_m spontaneous crescentic glomerulonephritis QTL 3 (mouse) 2 151709273 174389124 Mouse 1301677 Alcp6_m alcohol preference locus 6 (mouse) Not determined 2 163486407 181755017 Mouse
AW319644
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 173,701,870 - 173,702,018 UniSTS GRCm38 MGSCv37 2 173,527,371 - 173,527,519 UniSTS GRCm37 Celera 2 179,669,719 - 179,669,867 UniSTS Cytogenetic Map 2 H4 UniSTS cM Map 2 100.5 UniSTS Whitehead/MRC_RH 2 1937.44 UniSTS
UniSTS:234620
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 173,701,110 - 173,701,210 UniSTS GRCm38 MGSCv37 2 173,526,611 - 173,526,711 UniSTS GRCm37 Celera 2 179,668,959 - 179,669,059 UniSTS Cytogenetic Map 2 H4 UniSTS cM Map 2 100.5 UniSTS
AI662177
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 173,707,163 - 173,707,262 UniSTS GRCm38 MGSCv37 2 173,532,664 - 173,532,763 UniSTS GRCm37 Celera 2 179,675,012 - 179,675,111 UniSTS Cytogenetic Map 2 H4 UniSTS cM Map 2 100.5 UniSTS Whitehead/MRC_RH 2 1937.83 UniSTS Whitehead/MRC_RH 2 1937.34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000029024 ⟹ ENSMUSP00000029024
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 173,501,553 - 173,549,136 (+) Ensembl GRCm38.p6 Ensembl 2 173,659,760 - 173,707,343 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000109110 ⟹ ENSMUSP00000104738
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 173,501,649 - 173,542,947 (+) Ensembl GRCm38.p6 Ensembl 2 173,659,856 - 173,701,154 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000142820 ⟹ ENSMUSP00000122799
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 173,501,553 - 173,549,108 (+) Ensembl GRCm38.p6 Ensembl 2 173,659,760 - 173,707,315 (+) Ensembl
RefSeq Acc Id:
NM_024436 ⟹ NP_077756
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 173,501,638 - 173,543,975 (+) NCBI GRCm38 2 173,659,845 - 173,702,182 (+) NCBI MGSCv37 2 173,485,346 - 173,527,683 (+) RGD Celera 2 179,627,701 - 179,670,031 (+) RGD cM Map 2 ENTREZGENE
Sequence:
AGGTGACCCAGCTGGCGTCCCAAGATGGCGGCGGCGGTAGCGCCCGGGAGGCCAAGGCGGTGTCCCGGCTGTTGAGGTGACTCCGCCGGACAAGTGACGGGGTCGGCCGGACCGGAGGGCGGCGGCGG
hide sequence
RefSeq Acc Id:
NP_077756 ⟸ NM_024436
- UniProtKB:
Q3UCA7 (UniProtKB/Swiss-Prot), Q91VD4 (UniProtKB/Swiss-Prot), P35285 (UniProtKB/Swiss-Prot), Q0PD34 (UniProtKB/TrEMBL), Q9CXG2 (UniProtKB/TrEMBL)
- Sequence:
MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKCDLTDVREV
hide sequence
Ensembl Acc Id:
ENSMUSP00000029024 ⟸ ENSMUST00000029024
Ensembl Acc Id:
ENSMUSP00000104738 ⟸ ENSMUST00000109110
Ensembl Acc Id:
ENSMUSP00000122799 ⟸ ENSMUST00000142820
RGD ID: 6830796 Promoter ID: MM_KWN:33277 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000109110, NR_027957, OTTMUST00000039406, OTTMUST00000039407, OTTMUST00000039601, OTTMUST00000039602, OTTMUST00000039605, OTTMUST00000039606, OTTMUST00000039607, OTTMUST00000039608, UC008ODW.1, UC008OEA.1, UC008OEB.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 173,484,611 - 173,485,452 (-) MPROMDB
RGD ID: 6830765 Promoter ID: MM_KWN:33279 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_4Hour Transcripts: UC008OEF.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 173,528,181 - 173,528,681 (+) MPROMDB
RGD ID: 6830733 Promoter ID: MM_KWN:33280 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Liver, MEF_B6 Transcripts: UC008OEG.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 173,528,501 - 173,532,582 (+) MPROMDB
RGD ID: 6879930 Promoter ID: EPDNEW_M3416 Type: multiple initiation site Name: Rab22a_1 Description: Mus musculus RAB22A, member RAS oncogene family , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 2 173,659,845 - 173,659,905 EPDNEW
