Symbol:
Alyref
Name:
Aly/REF export factor
RGD ID:
1322670
MGI Page
MGI
Description:
Enables several functions, including RNA binding activity; RNA folding chaperone; and single-stranded DNA binding activity. Predicted to be involved in mRNA export from nucleus. Predicted to be located in cytoplasm. Predicted to be part of catalytic step 2 spliceosome; exon-exon junction complex; and transcription export complex. Predicted to be active in nucleus. Predicted to colocalize with chromosome, telomeric region. Is expressed in several structures, including branchial arch; central nervous system; future brain; genitourinary system; and sensory organ. Orthologous to human ALYREF (Aly/REF export factor).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ally of AML-1 and LEF-1; ALY; REF; REF1; REF1-I; Refb; Refbp1; RNA and export factor binding protein 1; RNA and export factor-binding protein 1; Tcra enhancer-binding factor interacting protein 1; THO complex 4; THO complex subunit 4; tho4; Thoc; Thoc4; transcriptional coactivator Aly/REF
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ALYREF (Aly/REF export factor) HGNC
Ensembl, HGNC, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Alyref (Aly/REF export factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Alyref (Aly/REF export factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ALYREF (Aly/REF export factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ALYREF (Aly/REF export factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Alyref (Aly/REF export factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ALYREF (Aly/REF export factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ALYREF (Aly/REF export factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Alyref (Aly/REF export factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ALYREF (Aly/REF export factor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Alyref (Aly/REF export factor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
alyref (Aly/REF export factor)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Ref1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
aly-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
aly-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
alyref
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Alyreffm12
Alyreffm3
Gm4310
Gm4781
Gm4850
Gm4898
Gm5699
Gm8384
Gm8391
Gm8689
Gm8701
Gm8711
Gm8723
Gm9476
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 120,485,330 - 120,489,342 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 120,482,947 - 120,489,191 (-) Ensembl GRCm39 Ensembl GRCm38 11 120,594,504 - 120,598,399 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 120,592,121 - 120,598,365 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 120,455,830 - 120,459,679 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 120,410,606 - 120,414,455 (-) NCBI MGSCv36 mm8 Celera 11 132,329,807 - 132,333,656 (-) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 84.31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Alyref Mouse (+)-schisandrin B multiple interactions ISO Alyref (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ALYREF mRNA] CTD PMID:31150632 Alyref Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ALYREF mRNA CTD PMID:22206623 Alyref Mouse 17beta-estradiol increases expression ISO Alyref (Rattus norvegicus) 6480464 Estradiol results in increased expression of ALYREF mRNA CTD PMID:32145629 Alyref Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ALYREF mRNA CTD PMID:39298647 Alyref Mouse 17beta-hydroxy-5alpha-androstan-3-one increases expression EXP 6480464 Dihydrotestosterone results in increased expression of ALYREF mRNA CTD PMID:17023530 Alyref Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ALYREF mRNA CTD PMID:21570461 Alyref Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Alyref (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ALYREF mRNA CTD PMID:34747641 Alyref Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ALYREF mRNA CTD PMID:20188158 Alyref Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of ALYREF mRNA CTD PMID:20188158 Alyref Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ALYREF (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ALYREF mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of ALYREF mRNA CTD PMID:28628672 Alyref Mouse 4,4'-sulfonyldiphenol multiple interactions ISO ALYREF (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of ALYREF mRNA CTD PMID:28628672 Alyref Mouse 4,4'-sulfonyldiphenol increases expression ISO ALYREF (Homo sapiens) 6480464 bisphenol S results in increased expression of ALYREF mRNA and bisphenol S results in increased expression of ALYREF protein CTD PMID:34186270 and PMID:38568856 Alyref Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of ALYREF mRNA CTD PMID:39298647 Alyref Mouse 6-propyl-2-thiouracil increases expression ISO Alyref (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of THOC4 mRNA CTD PMID:24780913 Alyref Mouse acrylamide decreases expression ISO Alyref (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of THOC4 mRNA CTD PMID:28959563 Alyref Mouse actinomycin D multiple interactions ISO ALYREF (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ALYREF protein CTD PMID:38460933 Alyref Mouse amitrole decreases expression ISO Alyref (Rattus norvegicus) 6480464 Amitrole results in decreased expression of ALYREF mRNA CTD PMID:38685447 Alyref Mouse atrazine decreases expression ISO ALYREF (Homo sapiens) 6480464 Atrazine results in decreased expression of THOC4 mRNA CTD PMID:22378314 Alyref Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of ALYREF mRNA CTD PMID:20504355 Alyref Mouse bis(2-chloroethyl) sulfide increases expression EXP 6480464 Mustard Gas results in increased expression of ALYREF mRNA CTD PMID:15674843 Alyref Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of ALYREF mRNA CTD PMID:33754040 Alyref Mouse bisphenol A decreases expression ISO Alyref (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of THOC4 mRNA CTD PMID:25181051 Alyref Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ALYREF mRNA CTD PMID:33221593 Alyref Mouse bisphenol A increases expression ISO Alyref (Rattus norvegicus) 6480464 bisphenol A results in increased expression of ALYREF mRNA CTD PMID:32145629 and PMID:34947998 Alyref Mouse bisphenol A increases expression ISO ALYREF (Homo sapiens) 6480464 bisphenol A results in increased expression of ALYREF mRNA CTD PMID:38568856 Alyref Mouse bisphenol A decreases expression ISO ALYREF (Homo sapiens) 6480464 bisphenol A results in decreased expression of ALYREF mRNA CTD PMID:29275510 Alyref Mouse bisphenol A increases methylation ISO Alyref (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of THOC4 gene CTD PMID:28505145 Alyref Mouse bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of THOC4 promoter CTD PMID:27312807 Alyref Mouse bisphenol AF increases expression ISO ALYREF (Homo sapiens) 6480464 bisphenol AF results in increased expression of ALYREF protein CTD PMID:34186270 Alyref Mouse Bisphenol B increases expression ISO ALYREF (Homo sapiens) 6480464 bisphenol B results in increased expression of ALYREF protein CTD PMID:34186270 Alyref Mouse bisphenol F multiple interactions ISO ALYREF (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ALYREF mRNA CTD PMID:28628672 Alyref Mouse bisphenol F increases expression ISO ALYREF (Homo sapiens) 6480464 bisphenol F results in increased expression of ALYREF mRNA and bisphenol F results in increased expression of ALYREF protein CTD PMID:34186270 and PMID:38568856 Alyref Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of ALYREF mRNA CTD PMID:38685157 Alyref Mouse caffeine increases phosphorylation ISO ALYREF (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of ALYREF protein CTD PMID:35688186 Alyref Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Alyref Mouse CGP 52608 multiple interactions ISO ALYREF (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to THOC4 gene] CTD PMID:28238834 Alyref Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of ALYREF mRNA CTD PMID:28472532 Alyref Mouse clozapine decreases expression ISO ALYREF (Homo sapiens) 6480464 Clozapine results in decreased expression of ALYREF protein CTD PMID:34122009 Alyref Mouse copper(II) chloride increases expression ISO ALYREF (Homo sapiens) 6480464 cupric chloride results in increased expression of ALYREF mRNA CTD PMID:38568856 Alyref Mouse coumarin increases phosphorylation ISO ALYREF (Homo sapiens) 6480464 coumarin results in increased phosphorylation of ALYREF protein CTD PMID:35688186 Alyref Mouse coumestrol increases expression ISO ALYREF (Homo sapiens) 6480464 Coumestrol results in increased expression of ALYREF mRNA CTD PMID:19167446 Alyref Mouse cyclophosphamide decreases expression EXP 6480464 Cyclophosphamide results in decreased expression of ALYREF mRNA CTD PMID:21041162 Alyref Mouse cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of ALYREF mRNA CTD PMID:19770486 Alyref Mouse DDE increases expression ISO ALYREF (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of ALYREF mRNA CTD PMID:38568856 Alyref Mouse DDT increases methylation ISO Alyref (Rattus norvegicus) 6480464 DDT results in increased methylation of ALYREF gene CTD PMID:30207508 Alyref Mouse dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of ALYREF mRNA CTD PMID:21041162 Alyref Mouse dexamethasone multiple interactions ISO ALYREF (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ALYREF mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of ALYREF mRNA CTD PMID:28628672 Alyref Mouse diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of ALYREF mRNA CTD PMID:21041162 Alyref Mouse dioxygen decreases expression ISO ALYREF (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of ALYREF mRNA CTD PMID:26516004 Alyref Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ALYREF mRNA CTD PMID:22206623 Alyref Mouse FR900359 decreases phosphorylation ISO ALYREF (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of ALYREF protein CTD PMID:37730182 Alyref Mouse gentamycin increases expression ISO Alyref (Rattus norvegicus) 6480464 Gentamicins results in increased expression of ALYREF mRNA CTD PMID:33387578 Alyref Mouse indometacin multiple interactions ISO ALYREF (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ALYREF mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of ALYREF mRNA CTD PMID:28628672 Alyref Mouse ivermectin decreases expression ISO ALYREF (Homo sapiens) 6480464 Ivermectin results in decreased expression of ALYREF protein CTD PMID:32959892 Alyref Mouse lead diacetate increases expression ISO ALYREF (Homo sapiens) 6480464 lead acetate results in increased expression of ALYREF mRNA CTD PMID:38568856 Alyref Mouse lipopolysaccharide multiple interactions ISO ALYREF (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of ALYREF mRNA CTD PMID:35877022 Alyref Mouse menadione affects expression ISO ALYREF (Homo sapiens) 6480464 Vitamin K 3 affects the expression of ALYREF mRNA CTD PMID:20044591 Alyref Mouse methapyrilene increases expression ISO Alyref (Rattus norvegicus) 6480464 Methapyrilene results in increased expression of ALYREF mRNA CTD PMID:30467583 Alyref Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of ALYREF mRNA CTD PMID:34813904 Alyref Mouse methimazole decreases expression ISO Alyref (Rattus norvegicus) 6480464 Methimazole results in decreased expression of ALYREF mRNA CTD PMID:38685447 Alyref Mouse methylparaben increases expression ISO ALYREF (Homo sapiens) 6480464 methylparaben results in increased expression of ALYREF mRNA CTD PMID:38568856 Alyref Mouse microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of THOC4 protein CTD PMID:26984711 Alyref Mouse nickel atom increases expression ISO ALYREF (Homo sapiens) 6480464 Nickel results in increased expression of ALYREF mRNA CTD PMID:24768652 and PMID:25583101 Alyref Mouse nickel sulfate increases expression ISO ALYREF (Homo sapiens) 6480464 nickel sulfate results in increased expression of THOC4 mRNA CTD PMID:22714537 Alyref Mouse Nutlin-3 multiple interactions ISO ALYREF (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ALYREF protein CTD PMID:38460933 Alyref Mouse oxaliplatin multiple interactions ISO Alyref (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ALYREF mRNA CTD PMID:25729387 Alyref Mouse paracetamol affects response to substance ISO ALYREF (Homo sapiens) 6480464 ALYREF gene polymorphism affects the susceptibility to Acetaminophen CTD PMID:26104854 Alyref Mouse perfluorodecanoic acid increases expression ISO ALYREF (Homo sapiens) 6480464 perfluorodecanoic acid results in increased expression of ALYREF mRNA CTD PMID:38568856 Alyref Mouse perfluorooctane-1-sulfonic acid increases expression ISO ALYREF (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of ALYREF mRNA CTD PMID:38568856 Alyref Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of ALYREF mRNA CTD PMID:36331819 Alyref Mouse phenanthrene decreases expression ISO ALYREF (Homo sapiens) 6480464 phenanthrene results in decreased expression of ALYREF mRNA CTD PMID:38568856 Alyref Mouse propylparaben increases expression ISO ALYREF (Homo sapiens) 6480464 propylparaben results in increased expression of ALYREF mRNA CTD PMID:38568856 Alyref Mouse quercetin decreases phosphorylation ISO ALYREF (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of ALYREF protein CTD PMID:35688186 Alyref Mouse resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of ALYREF protein CTD PMID:25505154 Alyref Mouse resveratrol multiple interactions ISO ALYREF (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of THOC4 mRNA CTD PMID:23557933 Alyref Mouse sodium arsenite increases expression ISO ALYREF (Homo sapiens) 6480464 sodium arsenite results in increased expression of ALYREF mRNA CTD PMID:28595984 Alyref Mouse sodium arsenite affects expression ISO ALYREF (Homo sapiens) 6480464 sodium arsenite affects the expression of ALYREF mRNA CTD PMID:34032870 Alyref Mouse sodium arsenite decreases expression ISO ALYREF (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ALYREF mRNA CTD PMID:38568856 Alyref Mouse sunitinib decreases expression ISO ALYREF (Homo sapiens) 6480464 Sunitinib results in decreased expression of ALYREF mRNA CTD PMID:31533062 Alyref Mouse tetrachloromethane increases expression ISO Alyref (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of ALYREF mRNA CTD PMID:31150632 Alyref Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ALYREF mRNA CTD PMID:31919559 Alyref Mouse tetrachloromethane multiple interactions ISO Alyref (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ALYREF mRNA] CTD PMID:31150632 Alyref Mouse thioacetamide increases expression ISO Alyref (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of ALYREF mRNA CTD PMID:34492290 Alyref Mouse thiram decreases expression ISO ALYREF (Homo sapiens) 6480464 Thiram results in decreased expression of ALYREF mRNA CTD PMID:38568856 Alyref Mouse topotecan multiple interactions ISO Alyref (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ALYREF mRNA CTD PMID:25729387 Alyref Mouse trimellitic anhydride increases expression EXP 6480464 trimellitic anhydride results in increased expression of ALYREF mRNA CTD PMID:19042947 Alyref Mouse triphenyl phosphate affects expression ISO ALYREF (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ALYREF mRNA CTD PMID:37042841 Alyref Mouse triticonazole decreases expression ISO Alyref (Rattus norvegicus) 6480464 triticonazole results in decreased expression of ALYREF mRNA CTD PMID:36084822 Alyref Mouse troglitazone decreases expression ISO ALYREF (Homo sapiens) 6480464 troglitazone results in decreased expression of ALYREF mRNA CTD PMID:19140230 Alyref Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of ALYREF mRNA CTD PMID:17292431 Alyref Mouse valproic acid decreases expression ISO ALYREF (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ALYREF mRNA CTD PMID:29154799 Alyref Mouse valproic acid affects expression ISO ALYREF (Homo sapiens) 6480464 Valproic Acid affects the expression of ALYREF mRNA CTD PMID:25979313 Alyref Mouse valproic acid increases methylation ISO ALYREF (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ALYREF gene CTD PMID:29154799 Alyref Mouse versicolorin A increases expression ISO ALYREF (Homo sapiens) 6480464 versicolorin A results in increased expression of ALYREF mRNA CTD PMID:32106047 Alyref Mouse vinclozolin increases expression ISO Alyref (Rattus norvegicus) 6480464 vinclozolin results in increased expression of THOC4 mRNA CTD PMID:23034163 Alyref Mouse Yessotoxin decreases expression ISO ALYREF (Homo sapiens) 6480464 yessotoxin analog results in decreased expression of ALYREF mRNA CTD PMID:30679557
(+)-schisandrin B (ISO) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) actinomycin D (ISO) amitrole (ISO) atrazine (ISO) benzo[a]pyrene (EXP) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) caffeine (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chromium(6+) (EXP) clozapine (ISO) copper(II) chloride (ISO) coumarin (ISO) coumestrol (ISO) cyclophosphamide (EXP) cyclosporin A (EXP) DDE (ISO) DDT (ISO) dexamethasone (EXP,ISO) diethylstilbestrol (EXP) dioxygen (ISO) folic acid (EXP) FR900359 (ISO) gentamycin (ISO) indometacin (ISO) ivermectin (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) menadione (ISO) methapyrilene (ISO) methidathion (EXP) methimazole (ISO) methylparaben (ISO) microcystin-LR (EXP) nickel atom (ISO) nickel sulfate (ISO) Nutlin-3 (ISO) oxaliplatin (ISO) paracetamol (ISO) perfluorodecanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) phenanthrene (ISO) propylparaben (ISO) quercetin (ISO) resveratrol (EXP,ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (EXP,ISO) thioacetamide (ISO) thiram (ISO) topotecan (ISO) trimellitic anhydride (EXP) triphenyl phosphate (ISO) triticonazole (ISO) troglitazone (ISO) valproic acid (EXP,ISO) versicolorin A (ISO) vinclozolin (ISO) Yessotoxin (ISO)
Alyref Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 120,485,330 - 120,489,342 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 120,482,947 - 120,489,191 (-) Ensembl GRCm39 Ensembl GRCm38 11 120,594,504 - 120,598,399 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 120,592,121 - 120,598,365 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 120,455,830 - 120,459,679 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 120,410,606 - 120,414,455 (-) NCBI MGSCv36 mm8 Celera 11 132,329,807 - 132,333,656 (-) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 84.31 NCBI
ALYREF Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 81,887,835 - 81,891,587 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 81,887,835 - 81,891,586 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 79,845,711 - 79,849,463 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 77,439,016 - 77,442,758 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 77,439,016 - 77,442,758 NCBI Celera 17 76,449,564 - 76,453,306 (-) NCBI Celera Cytogenetic Map 17 q25.3 NCBI HuRef 17 75,247,636 - 75,251,146 (-) NCBI HuRef CHM1_1 17 79,931,915 - 79,935,666 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 82,754,997 - 82,758,749 (-) NCBI T2T-CHM13v2.0
Alyref Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 106,369,750 - 106,373,395 (-) NCBI GRCr8 mRatBN7.2 10 105,871,424 - 105,875,076 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 105,871,306 - 105,875,069 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 110,975,253 - 110,978,898 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 110,438,281 - 110,441,926 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 105,791,877 - 105,795,522 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 109,768,593 - 109,774,639 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 109,770,876 - 109,774,639 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 109,363,929 - 109,367,692 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 109,984,500 - 109,988,263 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 104,414,714 - 104,418,477 (-) NCBI Celera Cytogenetic Map 10 q32.3 NCBI
Alyref Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955506 1,278,471 - 1,281,772 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955506 1,278,230 - 1,282,064 (+) NCBI ChiLan1.0 ChiLan1.0
ALYREF Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 98,423,928 - 98,427,689 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 103,324,715 - 103,328,469 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 76,293,410 - 76,297,171 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 81,995,578 - 82,000,836 (-) NCBI panpan1.1 PanPan1.1 panPan2
ALYREF Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 398,207 - 402,787 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 399,072 - 402,721 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 1,001,232 - 1,004,942 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 992,434 - 996,142 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 992,429 - 996,076 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 1,017,597 - 1,021,306 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 1,144,188 - 1,147,898 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 1,222,843 - 1,226,552 (+) NCBI UU_Cfam_GSD_1.0
Alyref
ALYREF
ALYREF Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 73,761,763 - 73,765,560 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 73,757,072 - 73,765,531 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 45,213,965 - 45,217,836 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Alyref
.
Predicted Target Of
Count of predictions: 1296 Count of miRNA genes: 622 Interacting mature miRNAs: 791 Transcripts: ENSMUST00000026125, ENSMUST00000155325, ENSMUST00000156685 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11251723 Ewc5_m ethanol withdrawal and consumption 5 (mouse) 11 89869251 121973369 Mouse 1302034 Pkccl_m protein kinase C content in lungs (mouse) Not determined 11 91604608 121973369 Mouse 1300944 Alcp20_m alcohol preference locus 20 (mouse) Not determined 11 95403965 121973369 Mouse 15014785 Mvlq1_m macrovesicular liver lesion QTL 1 (mouse) 11 86608320 120608320 Mouse 1301012 Vispl_m visual placing (mouse) Not determined 11 101022590 121973369 Mouse 15039374 Adip29_m adiposity 29 (mouse) 11 86608320 120608320 Mouse 1301983 Berr2_m berghei resistance locus 2 (mouse) Not determined 11 98352609 121973369 Mouse 1300962 Cd8mts4_m CD8 memory T cell subset 4 (mouse) Not determined 11 96137674 121973369 Mouse 10043976 Obq33_m obesity QTL 33 (mouse) Not determined 11 98500469 121973369 Mouse 1301057 Nidd4_m non-insulin-dependent diabetes mellitus 4 (mouse) Not determined 11 96810136 121973369 Mouse 1301095 El6_m epilepsy 6 (mouse) Not determined 11 93229183 121973369 Mouse 11341721 Rvfs2_m Rift Valley fever susceptibility 2 (mouse) 11 100254186 120887165 Mouse 15039376 Bw42_m body weight QTL 42 (mouse) 11 86608320 120608320 Mouse 1301958 Alcp18_m alcohol preference locus 18 (mouse) Not determined 11 95403965 121973369 Mouse 1558753 Ath19_m atherosclerosis 19 (mouse) Not determined 11 91604608 121973369 Mouse 10044001 Alcw8_m alcohol withdrawal 8 (mouse) Not determined 11 99254187 121973369 Mouse 27226789 Feml16_m femur length 16, 10 week (mouse) 11 87490826 121873369 Mouse 11553867 Stmm5_m skin tumor modifier of MSM 5 (mouse) 11 100058103 121973369 Mouse 10044007 Hbnr14_m Heligmosomoides bakeri nematode resistance 14 (mouse) Not determined 11 87502600 121502698 Mouse
Refbp2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 171,503,667 - 171,504,310 UniSTS GRCm38 MGSCv37 1 173,433,798 - 173,434,441 UniSTS GRCm37 Celera 1 173,946,173 - 173,946,816 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 1 H3 UniSTS cM Map 1 UniSTS cM Map 1 79.48 UniSTS
Thoc4
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 171,503,900 - 171,504,298 UniSTS GRCm38 MGSCv37 1 173,434,031 - 173,434,429 UniSTS GRCm37 Celera 1 173,946,406 - 173,946,804 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 1 H3 UniSTS cM Map 11 UniSTS cM Map 11 84.31 UniSTS
UniSTS:236797
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 120,592,193 - 120,592,443 UniSTS GRCm38 MGSCv37 11 120,453,507 - 120,453,757 UniSTS GRCm37 Celera 11 132,327,484 - 132,327,734 UniSTS Cytogenetic Map 11 E2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000026125 ⟹ ENSMUSP00000026125
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 120,482,947 - 120,489,191 (-) Ensembl GRCm38.p6 Ensembl 11 120,592,121 - 120,598,365 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000155325
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 120,485,335 - 120,486,483 (-) Ensembl GRCm38.p6 Ensembl 11 120,594,509 - 120,595,657 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000156685
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 120,486,442 - 120,489,057 (-) Ensembl GRCm38.p6 Ensembl 11 120,595,616 - 120,598,231 (-) Ensembl
RefSeq Acc Id:
NM_011568 ⟹ NP_035698
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 120,485,342 - 120,489,191 (-) NCBI GRCm38 11 120,594,516 - 120,598,365 (-) NCBI MGSCv37 11 120,455,830 - 120,459,679 (-) RGD Celera 11 132,329,807 - 132,333,656 (-) RGD cM Map 11 ENTREZGENE
Sequence:
GATCCGAGGCCCGAATCCGCGCCCGCCATGGCCGACAAAATGGACATGTCTTTGGACGACATCATTAAGCTGAACCGGAGCCAGCGAGGAGGCCGCGGCGGGGGCCGGGGTCGCGGCAGGGCCGGCTC
hide sequence
RefSeq Acc Id:
XR_001779950
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 120,485,330 - 120,489,342 (-) NCBI GRCm38 11 120,594,504 - 120,598,399 (-) NCBI
Sequence:
GAAGTAGCGCCAGCCACCGCGGCGAGCCGTACGCAGGCGCTCTGCGGAATCGCGCGCGCCCAGACCAATCGCCGCTCGCTTCGGGCCCGCGACGCCGGAAGGCAGGGGGAGGCGCCGGAAGTGACGCC
hide sequence
RefSeq Acc Id:
NP_035698 ⟸ NM_011568
- UniProtKB:
Q8CBM4 (UniProtKB/Swiss-Prot), Q0VBL5 (UniProtKB/Swiss-Prot), Q9JJW7 (UniProtKB/Swiss-Prot), O08583 (UniProtKB/Swiss-Prot), Q4KL64 (UniProtKB/TrEMBL)
- Sequence:
MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGAVQAAARVNRGGGPMRNRPAIARGAAGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEF
hide sequence
Ensembl Acc Id:
ENSMUSP00000026125 ⟸ ENSMUST00000026125
RGD ID: 6820395 Promoter ID: MM_KWN:10938 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_001038230, NM_025389, OTTMUST00000009196, OTTMUST00000009198, OTTMUST00000061821 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 120,458,941 - 120,460,062 (+) MPROMDB
RGD ID: 8677698 Promoter ID: EPDNEW_M16880 Type: initiation region Name: Alyref_1 Description: Mus musculus Aly/REF export factor , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 120,598,353 - 120,598,413 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-12-20
Alyref
Aly/REF export factor
Thoc4
THO complex 4
Symbol and/or name change
5135510 APPROVED
