Advanced Search (OLGA)

Gene: CWF19L2 (CWF19 like cell cycle control factor 2) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

CWF19L2

Name:

CWF19 like cell cycle control factor 2

RGD ID:

1320784

HGNC Page

HGNC:26508

Description:

Predicted to be involved in mRNA splicing, via spliceosome. Predicted to be located in nucleoplasm. Predicted to be part of post-mRNA release spliceosomal complex.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CWF19 like 2, cell cycle control; CWF19 like 2, cell cycle control (S. pombe); CWF19-like 2, cell cycle control (S. pombe); CWF19-like protein 2; FLJ32343

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Cwf19l2 (CWF19 like cell cycle control factor 2)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Cwf19l2 (CWF19 like cell cycle control factor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Cwf19l2 (CWF19 like cell cycle control factor 2)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	CWF19L2 (CWF19 like cell cycle control factor 2)	NCBI	Ortholog
Canis lupus familiaris (dog):	CWF19L2 (CWF19 like cell cycle control factor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cwf19l2 (CWF19 like cell cycle control factor 2)	NCBI	Ortholog
Sus scrofa (pig):	CWF19L2 (CWF19 like cell cycle control factor 2)	HGNC	EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):	CWF19L2 (CWF19 like cell cycle control factor 2)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Cwf19l2 (CWF19 like cell cycle control factor 2)	NCBI	Ortholog
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Cwf19l2 (CWF19 like cell cycle control factor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cwf19l2 (CWF19 like cell cycle control factor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cwf19l2 (CWF19 like cell cycle control factor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	B0361.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9213	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cwf19l2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	cwf19l2.L	Alliance	DIOPT (Xenbase)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	107,326,360 - 107,457,825 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	107,326,360 - 107,457,825 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	107,197,086 - 107,328,551 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	106,702,293 - 106,830,406 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	106,702,292 - 106,830,406	NCBI
Celera	11	104,362,890 - 104,483,437 (-)	NCBI		Celera
Cytogenetic Map	11	q22.3	NCBI
HuRef	11	103,133,370 - 103,254,160 (-)	NCBI		HuRef
CHM1_1	11	107,080,175 - 107,211,650 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	107,333,512 - 107,464,989 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CWF19L2	Human	ataxia telangiectasia		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Ataxia-telangiectasia syndrome	ClinVar	PMID:23807571 more ...
CWF19L2	Human	chromosome 11 partial duplication syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Distal trisomy 11q	ClinVar	PMID:25741868
CWF19L2	Human	intellectual disability		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CWF19L2	Human	1,2-dichloroethane	decreases expression	ISO	Cwf19l2 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of CWF19L2 mRNA	CTD	PMID:28960355
CWF19L2	Human	1,2-dimethylhydrazine	decreases expression	ISO	Cwf19l2 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of CWF19L2 mRNA	CTD	PMID:22206623
CWF19L2	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Cwf19l2 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of CWF19L2 mRNA	CTD	PMID:21215274
CWF19L2	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Cwf19l2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of CWF19L2 mRNA	CTD	PMID:21570461 and PMID:26377647
CWF19L2	Human	2-hydroxypropanoic acid	decreases expression	EXP		6480464	Lactic Acid results in decreased expression of CWF19L2 mRNA	CTD	PMID:30851411
CWF19L2	Human	3,4-methylenedioxymethamphetamine	decreases expression	ISO	Cwf19l2 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of CWF19L2 mRNA	CTD	PMID:26251327
CWF19L2	Human	antirheumatic drug	increases expression	EXP		6480464	Antirheumatic Agents results in increased expression of CWF19L2 mRNA	CTD	PMID:24449571
CWF19L2	Human	aristolochic acid A	decreases expression	EXP		6480464	aristolochic acid I results in decreased expression of CWF19L2 mRNA	CTD	PMID:33212167
CWF19L2	Human	benzo[a]pyrene	increases methylation	EXP		6480464	Benzo(a)pyrene results in increased methylation of CWF19L2 promoter	CTD	PMID:27901495
CWF19L2	Human	bisphenol A	decreases expression	ISO	Cwf19l2 (Mus musculus)	6480464	bisphenol A results in decreased expression of CWF19L2 mRNA	CTD	PMID:33221593
CWF19L2	Human	bisphenol A	increases expression	ISO	Cwf19l2 (Mus musculus)	6480464	bisphenol A results in increased expression of CWF19L2 mRNA	CTD	PMID:35598803
CWF19L2	Human	bisphenol A	decreases expression	ISO	Cwf19l2 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of CWF19L2 mRNA	CTD	PMID:34947998
CWF19L2	Human	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of CWF19L2 mRNA	CTD	PMID:38568856
CWF19L2	Human	caffeine	decreases phosphorylation	EXP		6480464	Caffeine results in decreased phosphorylation of CWF19L2 protein	CTD	PMID:35688186
CWF19L2	Human	chloroprene	increases expression	ISO	Cwf19l2 (Rattus norvegicus)	6480464	Chloroprene results in increased expression of CWF19L2 mRNA	CTD	PMID:23125180
CWF19L2	Human	chlorpyrifos	decreases expression	ISO	Cwf19l2 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of CWF19L2 mRNA	CTD	PMID:37019170
CWF19L2	Human	cocaine	increases expression	ISO	Cwf19l2 (Rattus norvegicus)	6480464	Cocaine results in increased expression of CWF19L2 mRNA	CTD	PMID:17898221
CWF19L2	Human	cyclosporin A	increases expression	EXP		6480464	Cyclosporine results in increased expression of CWF19L2 mRNA	CTD	PMID:25562108
CWF19L2	Human	deoxynivalenol	increases expression	EXP		6480464	deoxynivalenol results in increased expression of CWF19L2 mRNA	CTD	PMID:31863870
CWF19L2	Human	diazinon	affects expression	ISO	Cwf19l2 (Rattus norvegicus)	6480464	Diazinon affects the expression of CWF19L2 mRNA	CTD	PMID:22546817
CWF19L2	Human	dicrotophos	decreases expression	EXP		6480464	dicrotophos results in decreased expression of CWF19L2 mRNA	CTD	PMID:28302478
CWF19L2	Human	dieldrin	affects expression	ISO	Cwf19l2 (Rattus norvegicus)	6480464	Dieldrin affects the expression of CWF19L2 mRNA	CTD	PMID:22546817
CWF19L2	Human	dioxygen	increases expression	ISO	Cwf19l2 (Mus musculus)	6480464	Oxygen deficiency results in increased expression of CWF19L2 mRNA	CTD	PMID:24205000
CWF19L2	Human	epoxiconazole	increases expression	ISO	Cwf19l2 (Mus musculus)	6480464	epoxiconazole results in increased expression of CWF19L2 mRNA	CTD	PMID:35436446
CWF19L2	Human	FR900359	decreases phosphorylation	EXP		6480464	FR900359 results in decreased phosphorylation of CWF19L2 protein	CTD	PMID:37730182
CWF19L2	Human	hydrogen peroxide	decreases expression	EXP		6480464	Hydrogen Peroxide results in decreased expression of CWF19L2 mRNA	CTD	PMID:18951874
CWF19L2	Human	methidathion	decreases expression	ISO	Cwf19l2 (Mus musculus)	6480464	methidathion results in decreased expression of CWF19L2 mRNA	CTD	PMID:34813904
CWF19L2	Human	methoxychlor	affects methylation	ISO	Cwf19l2 (Rattus norvegicus)	6480464	Methoxychlor affects the methylation of CWF19L2 gene	CTD	PMID:35440735
CWF19L2	Human	methyl methanesulfonate	increases expression	EXP		6480464	Methyl Methanesulfonate results in increased expression of CWF19L2 mRNA	CTD	PMID:23649840
CWF19L2	Human	miconazole	decreases expression	ISO	Cwf19l2 (Mus musculus)	6480464	Miconazole results in decreased expression of CWF19L2 mRNA	CTD	PMID:27462272
CWF19L2	Human	nickel dichloride	affects expression	ISO	Cwf19l2 (Rattus norvegicus)	6480464	nickel chloride affects the expression of CWF19L2 mRNA	CTD	PMID:22546817
CWF19L2	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Cwf19l2 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of CWF19L2 mRNA	CTD	PMID:36331819
CWF19L2	Human	phenobarbital	increases expression	ISO	Cwf19l2 (Mus musculus)	6480464	Phenobarbital results in increased expression of CWF19L2 mRNA	CTD	PMID:19270015
CWF19L2	Human	potassium dichromate	increases expression	ISO	Cwf19l2 (Mus musculus)	6480464	Potassium Dichromate results in increased expression of CWF19L2 mRNA	CTD	PMID:23608068
CWF19L2	Human	rac-lactic acid	decreases expression	EXP		6480464	Lactic Acid results in decreased expression of CWF19L2 mRNA	CTD	PMID:30851411
CWF19L2	Human	resveratrol	multiple interactions	EXP		6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of CWF19L2 mRNA	CTD	PMID:23557933
CWF19L2	Human	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of CWF19L2 mRNA	CTD	PMID:38568856
CWF19L2	Human	sodium arsenite	decreases expression	ISO	Cwf19l2 (Mus musculus)	6480464	sodium arsenite results in decreased expression of CWF19L2 mRNA	CTD	PMID:36209798
CWF19L2	Human	tacrine	increases expression	ISO	Cwf19l2 (Rattus norvegicus)	6480464	Tacrine results in increased expression of CWF19L2 mRNA	CTD	PMID:12832660
CWF19L2	Human	temozolomide	increases expression	EXP		6480464	Temozolomide results in increased expression of CWF19L2 mRNA	CTD	PMID:31758290
CWF19L2	Human	triphenyl phosphate	affects expression	EXP		6480464	triphenyl phosphate affects the expression of CWF19L2 mRNA	CTD	PMID:37042841
CWF19L2	Human	tungsten	decreases expression	ISO	Cwf19l2 (Mus musculus)	6480464	Tungsten results in decreased expression of CWF19L2 mRNA	CTD	PMID:30912803
CWF19L2	Human	urethane	decreases expression	EXP		6480464	Urethane results in decreased expression of CWF19L2 mRNA	CTD	PMID:28818685
CWF19L2	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of CWF19L2 mRNA	CTD	PMID:25979313
CWF19L2	Human	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of CWF19L2 mRNA	CTD	PMID:23179753 more ...

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CWF19L2	Human	mRNA splicing, via spliceosome	involved_in	IBA	PANTHER:PTN000249204 more ...	150520179		GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CWF19L2	Human	nucleoplasm	located_in	TAS		150520179		Reactome	Reactome:R-HSA-9770847 and Reactome:R-HSA-9772351
CWF19L2	Human	post-mRNA release spliceosomal complex	part_of	IBA	PANTHER:PTN000249204 more ...	150520179		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CWF19L2	Human	protein binding	enables	IPI	UniProtKB:P14136 more ...	150520179	PMID:32814053	IntAct	PMID:32814053
CWF19L2	Human	protein binding	enables	IPI	UniProtKB:A0A0C3SFZ9 more ...	150520179	PMID:32296183	IntAct	PMID:32296183
CWF19L2	Human	protein binding	enables	IPI	UniProtKB:O75558 more ...	150520179	PMID:25416956	IntAct	PMID:25416956
CWF19L2	Human	protein binding	enables	IPI	UniProtKB:Q13573	150520179	PMID:33961781	IntAct	PMID:33961781

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CWF19L2	Human	Intellectual disability		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:14702039	PMID:16344560	PMID:18398821	PMID:20379614	PMID:20677014	PMID:21832049	PMID:21873635	PMID:24623722	PMID:25184681	PMID:25416956	PMID:25921289	PMID:26186194
PMID:26496610	PMID:27433848	PMID:28514442	PMID:28700943	PMID:29395067	PMID:29773831	PMID:30196744	PMID:31586073	PMID:32296183	PMID:32433965	PMID:32814053	PMID:33961781
PMID:34079125	PMID:34349018	PMID:34795231	PMID:35271311	PMID:35439318	PMID:35944360	PMID:36273042	PMID:36373674	PMID:37071664	PMID:37689310	PMID:38113892	PMID:38334954
PMID:38580884	PMID:38697112

CWF19L2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	107,326,360 - 107,457,825 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	107,326,360 - 107,457,825 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	107,197,086 - 107,328,551 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	106,702,293 - 106,830,406 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	106,702,292 - 106,830,406	NCBI
Celera	11	104,362,890 - 104,483,437 (-)	NCBI		Celera
Cytogenetic Map	11	q22.3	NCBI
HuRef	11	103,133,370 - 103,254,160 (-)	NCBI		HuRef
CHM1_1	11	107,080,175 - 107,211,650 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	107,333,512 - 107,464,989 (-)	NCBI		T2T-CHM13v2.0

Cwf19l2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	3,403,592 - 3,479,236 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	3,403,592 - 3,479,236 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	3,403,592 - 3,479,236 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	3,403,592 - 3,479,236 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	3,404,085 - 3,479,236 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	3,404,085 - 3,479,236 (+)	NCBI		MGSCv36	mm8
Celera	3	119,215,796 - 119,285,730 (-)	NCBI		Celera
Cytogenetic Map	9	A1	NCBI
cM Map	9	2.06	NCBI

Cwf19l2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	6,036,158 - 6,102,686 (-)	NCBI		GRCr8
mRatBN7.2	6	290,148 - 356,636 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	281,685 - 356,604 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	506,515 - 572,953 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	815,805 - 882,242 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	340,227 - 406,631 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	18,970,616 - 19,037,176 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	18,970,564 - 19,055,924 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	28,868,716 - 28,935,276 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	418,368 - 485,802 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	418,367 - 482,123 (+)	NCBI
Celera	6	115,555 - 181,554 (-)	NCBI		Celera
Cytogenetic Map	6	q11	NCBI

Cwf19l2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	9,766,910 - 9,861,027 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	9,758,751 - 9,861,019 (-)	NCBI	ChiLan1.0	ChiLan1.0

CWF19L2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	108,025,853 - 108,203,804 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	109,157,101 - 109,297,820 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	102,219,339 - 102,345,865 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	105,702,934 - 105,828,168 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	105,702,934 - 105,828,149 (-)	Ensembl	panpan1.1		panPan2

CWF19L2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	24,936,700 - 25,080,927 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	24,833,373 - 25,080,451 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	24,852,125 - 25,005,758 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	24,963,467 - 25,107,620 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	24,963,519 - 25,107,618 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	25,015,519 - 25,159,677 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	24,902,624 - 25,047,003 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	24,964,115 - 25,111,783 (+)	NCBI		UU_Cfam_GSD_1.0

Cwf19l2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	90,229,976 - 90,343,408 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936551	1,193,109 - 1,306,533 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CWF19L2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	35,967,204 - 36,059,749 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	35,967,198 - 36,059,780 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	40,006,188 - 40,106,971 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CWF19L2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	98,749,892 - 98,885,698 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	98,766,109 - 98,885,671 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	27,061,434 - 27,186,945 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cwf19l2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624784	2,113,153 - 2,253,466 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in CWF19L2
84 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 11q22.1-25(chr11:100348599-135040246)x3	copy number gain	See cases [RCV000053638]	Chr11:100348599..135040246 [GRCh38] Chr11:100219331..134910140 [GRCh37] Chr11:99724541..134415350 [NCBI36] Chr11:11q22.1-25	pathogenic
NM_152434.2(CWF19L2):c.1434-600A>C	single nucleotide variant	Lung cancer [RCV000109577]	Chr11:107418887 [GRCh38] Chr11:107289613 [GRCh37] Chr11:11q22.3	uncertain significance
GRCh38/hg38 11q14.3-22.3(chr11:91086659-109595582)x1	copy number loss	See cases [RCV000138038]	Chr11:91086659..109595582 [GRCh38] Chr11:90819827..109466308 [GRCh37] Chr11:90459475..108971518 [NCBI36] Chr11:11q14.3-22.3	pathogenic
GRCh37/hg19 11q22.3(chr11:106959465-107537265)x1	copy number loss	See cases [RCV000239992]	Chr11:106959465..107537265 [GRCh37] Chr11:11q22.3	uncertain significance
GRCh37/hg19 11q14.2-22.3(chr11:88152458-109414650)x1	copy number loss	See cases [RCV000510457]	Chr11:88152458..109414650 [GRCh37] Chr11:11q14.2-22.3	pathogenic
GRCh37/hg19 11q22.3(chr11:106767102-107561488)x3	copy number gain	See cases [RCV000511621]	Chr11:106767102..107561488 [GRCh37] Chr11:11q22.3	uncertain significance
GRCh37/hg19 11p15.5-q25(chr11:230616-134938470)	copy number gain	See cases [RCV000511729]	Chr11:230616..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11p15.5-q25(chr11:230616-134938470)x3	copy number gain	See cases [RCV000510881]	Chr11:230616..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11q22.3(chr11:107072930-107283027)x1	copy number loss	See cases [RCV000511100]	Chr11:107072930..107283027 [GRCh37] Chr11:11q22.3	uncertain significance
GRCh37/hg19 11q22.2-22.3(chr11:102578709-107230611)x1	copy number loss	not provided [RCV000683366]	Chr11:102578709..107230611 [GRCh37] Chr11:11q22.2-22.3	likely pathogenic
GRCh37/hg19 11q13.4-23.3(chr11:71588805-116680918)x3	copy number gain	not provided [RCV000683374]	Chr11:71588805..116680918 [GRCh37] Chr11:11q13.4-23.3	pathogenic
GRCh37/hg19 11p15.5-q25(chr11:198510-134934063)x3	copy number gain	not provided [RCV000737348]	Chr11:198510..134934063 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11q14.1-23.2(chr11:80053454-113316236)x1	copy number loss	not provided [RCV000737595]	Chr11:80053454..113316236 [GRCh37] Chr11:11q14.1-23.2	pathogenic
GRCh37/hg19 11p15.5-q25(chr11:70864-134938470)x3	copy number gain	not provided [RCV000749874]	Chr11:70864..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11q22.3-23.3(chr11:104101411-116680918)x1	copy number loss	not provided [RCV000848741]	Chr11:104101411..116680918 [GRCh37] Chr11:11q22.3-23.3	pathogenic
NM_152434.3(CWF19L2):c.2498A>G (p.His833Arg)	single nucleotide variant	not specified [RCV004302175]	Chr11:107329961 [GRCh38] Chr11:107200687 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1037C>T (p.Thr346Met)	single nucleotide variant	not specified [RCV004309461]	Chr11:107429195 [GRCh38] Chr11:107299921 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.421T>G (p.Ser141Ala)	single nucleotide variant	not specified [RCV004286209]	Chr11:107442968 [GRCh38] Chr11:107313694 [GRCh37] Chr11:11q22.3	uncertain significance
GRCh37/hg19 11q22.3-23.3(chr11:105699599-114524876)x1	copy number loss	not provided [RCV001006445]	Chr11:105699599..114524876 [GRCh37] Chr11:11q22.3-23.3	pathogenic
GRCh37/hg19 11q22.3-23.2(chr11:103320065-114349787)x1	copy number loss	not provided [RCV001006439]	Chr11:103320065..114349787 [GRCh37] Chr11:11q22.3-23.2	pathogenic
Single allele	deletion	Intellectual disability [RCV001293382]	Chr11:118359328..118372573 [GRCh37] Chr11:11p15.3-q23.3	pathogenic
NC_000011.9:g.(?_94153285)_(111965700_?)del	deletion	Ataxia-telangiectasia syndrome [RCV001389105]	Chr11:94153285..111965700 [GRCh37] Chr11:11q21-23.1	pathogenic
NC_000011.9:g.104288964_134937416dup	duplication	Distal trisomy 11q [RCV001250234]	Chr11:104288964..134937416 [GRCh37] Chr11:11q22.3-25	pathogenic
GRCh37/hg19 11q14.1-23.3(chr11:85422071-118022671)x1	copy number loss	not provided [RCV001832892]	Chr11:85422071..118022671 [GRCh37] Chr11:11q14.1-23.3	uncertain significance
GRCh37/hg19 11p13-q25(chr11:32799481-134938470)x3	copy number gain	MISSED ABORTION [RCV002282973]	Chr11:32799481..134938470 [GRCh37] Chr11:11p13-q25	pathogenic
GRCh37/hg19 11q22.1-22.3(chr11:101371503-109306519)x1	copy number loss	not provided [RCV002472494]	Chr11:101371503..109306519 [GRCh37] Chr11:11q22.1-22.3	pathogenic
NM_152434.3(CWF19L2):c.1709A>C (p.Gln570Pro)	single nucleotide variant	not specified [RCV004202518]	Chr11:107392804 [GRCh38] Chr11:107263530 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1690G>A (p.Gly564Arg)	single nucleotide variant	not specified [RCV004092521]	Chr11:107392823 [GRCh38] Chr11:107263549 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1276G>C (p.Gly426Arg)	single nucleotide variant	not specified [RCV004094655]	Chr11:107428956 [GRCh38] Chr11:107299682 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1928A>G (p.Lys643Arg)	single nucleotide variant	not specified [RCV004118012]	Chr11:107353681 [GRCh38] Chr11:107224407 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1082T>C (p.Phe361Ser)	single nucleotide variant	not specified [RCV004166879]	Chr11:107429150 [GRCh38] Chr11:107299876 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2367A>G (p.Ile789Met)	single nucleotide variant	not specified [RCV004217202]	Chr11:107334953 [GRCh38] Chr11:107205679 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1084G>C (p.Gly362Arg)	single nucleotide variant	not specified [RCV004166529]	Chr11:107429148 [GRCh38] Chr11:107299874 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.661A>G (p.Lys221Glu)	single nucleotide variant	not specified [RCV004076242]	Chr11:107439093 [GRCh38] Chr11:107309819 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2555G>C (p.Gly852Ala)	single nucleotide variant	not specified [RCV004100235]	Chr11:107327040 [GRCh38] Chr11:107197766 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1913A>G (p.Asp638Gly)	single nucleotide variant	not specified [RCV004150573]	Chr11:107353696 [GRCh38] Chr11:107224422 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.276A>T (p.Glu92Asp)	single nucleotide variant	not specified [RCV004224562]	Chr11:107454513 [GRCh38] Chr11:107325239 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.70C>A (p.Gln24Lys)	single nucleotide variant	not specified [RCV004122330]	Chr11:107457747 [GRCh38] Chr11:107328473 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1984A>G (p.Ile662Val)	single nucleotide variant	not specified [RCV004081998]	Chr11:107353625 [GRCh38] Chr11:107224351 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1261C>T (p.Arg421Cys)	single nucleotide variant	not specified [RCV004135456]	Chr11:107428971 [GRCh38] Chr11:107299697 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.599C>T (p.Pro200Leu)	single nucleotide variant	not specified [RCV004145609]	Chr11:107439155 [GRCh38] Chr11:107309881 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2252G>A (p.Cys751Tyr)	single nucleotide variant	not specified [RCV004106415]	Chr11:107336664 [GRCh38] Chr11:107207390 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1634A>G (p.Glu545Gly)	single nucleotide variant	not specified [RCV004159429]	Chr11:107392879 [GRCh38] Chr11:107263605 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1469T>C (p.Val490Ala)	single nucleotide variant	not specified [RCV004175662]	Chr11:107418252 [GRCh38] Chr11:107288978 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2203A>G (p.Met735Val)	single nucleotide variant	not specified [RCV004107044]	Chr11:107336713 [GRCh38] Chr11:107207439 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.52A>G (p.Ile18Val)	single nucleotide variant	not specified [RCV004114097]	Chr11:107457765 [GRCh38] Chr11:107328491 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.44C>T (p.Ala15Val)	single nucleotide variant	not specified [RCV004225930]	Chr11:107457773 [GRCh38] Chr11:107328499 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2456C>T (p.Pro819Leu)	single nucleotide variant	not specified [RCV004124298]	Chr11:107330003 [GRCh38] Chr11:107200729 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.157C>T (p.Arg53Trp)	single nucleotide variant	not specified [RCV004137039]	Chr11:107455725 [GRCh38] Chr11:107326451 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.489A>T (p.Lys163Asn)	single nucleotide variant	not specified [RCV004222016]	Chr11:107441584 [GRCh38] Chr11:107312310 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2503A>G (p.Ile835Val)	single nucleotide variant	not specified [RCV004147266]	Chr11:107329956 [GRCh38] Chr11:107200682 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2288A>G (p.Gln763Arg)	single nucleotide variant	not specified [RCV004075356]	Chr11:107336628 [GRCh38] Chr11:107207354 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.947A>T (p.Asp316Val)	single nucleotide variant	not specified [RCV004279548]	Chr11:107429285 [GRCh38] Chr11:107300011 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2564A>C (p.Asp855Ala)	single nucleotide variant	not specified [RCV004278927]	Chr11:107327031 [GRCh38] Chr11:107197757 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.658A>G (p.Thr220Ala)	single nucleotide variant	not specified [RCV004270209]	Chr11:107439096 [GRCh38] Chr11:107309822 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1115C>T (p.Ser372Phe)	single nucleotide variant	not specified [RCV004248739]	Chr11:107429117 [GRCh38] Chr11:107299843 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2621A>G (p.Lys874Arg)	single nucleotide variant	not specified [RCV004253683]	Chr11:107326974 [GRCh38] Chr11:107197700 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1721G>T (p.Arg574Ile)	single nucleotide variant	not specified [RCV004251975]	Chr11:107392792 [GRCh38] Chr11:107263518 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.83C>T (p.Ala28Val)	single nucleotide variant	not specified [RCV004345229]	Chr11:107457734 [GRCh38] Chr11:107328460 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.136C>T (p.Arg46Cys)	single nucleotide variant	not specified [RCV004340742]	Chr11:107455746 [GRCh38] Chr11:107326472 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1518G>A (p.Met506Ile)	single nucleotide variant	not specified [RCV004341873]	Chr11:107418203 [GRCh38] Chr11:107288929 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1607C>T (p.Ser536Phe)	single nucleotide variant	not specified [RCV004339471]	Chr11:107416219 [GRCh38] Chr11:107286945 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2303A>G (p.Tyr768Cys)	single nucleotide variant	not specified [RCV004361219]	Chr11:107336613 [GRCh38] Chr11:107207339 [GRCh37] Chr11:11q22.3	uncertain significance
Single allele	duplication	not provided [RCV003448710]	Chr11:102134973..134945611 [GRCh37] Chr11:11q22.2-25	pathogenic
NM_152434.3(CWF19L2):c.429A>G (p.Lys143=)	single nucleotide variant	not provided [RCV003396059]	Chr11:107442960 [GRCh38] Chr11:107313686 [GRCh37] Chr11:11q22.3	likely benign
NM_152434.3(CWF19L2):c.201T>C (p.Ile67=)	single nucleotide variant	not provided [RCV003396060]	Chr11:107455681 [GRCh38] Chr11:107326407 [GRCh37] Chr11:11q22.3	likely benign
NM_152434.3(CWF19L2):c.1439C>T (p.Pro480Leu)	single nucleotide variant	not specified [RCV004367510]	Chr11:107418282 [GRCh38] Chr11:107289008 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1975A>G (p.Lys659Glu)	single nucleotide variant	not specified [RCV004367512]	Chr11:107353634 [GRCh38] Chr11:107224360 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2279T>G (p.Met760Arg)	single nucleotide variant	not specified [RCV004367517]	Chr11:107336637 [GRCh38] Chr11:107207363 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.950G>T (p.Arg317Ile)	single nucleotide variant	not specified [RCV004367523]	Chr11:107429282 [GRCh38] Chr11:107300008 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2110C>T (p.Arg704Trp)	single nucleotide variant	not specified [RCV004367514]	Chr11:107349029 [GRCh38] Chr11:107219755 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2153A>G (p.His718Arg)	single nucleotide variant	not specified [RCV004367515]	Chr11:107348986 [GRCh38] Chr11:107219712 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2289G>C (p.Gln763His)	single nucleotide variant	not specified [RCV004367518]	Chr11:107336627 [GRCh38] Chr11:107207353 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2623A>G (p.Lys875Glu)	single nucleotide variant	not specified [RCV004367519]	Chr11:107326972 [GRCh38] Chr11:107197698 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.611A>G (p.Asp204Gly)	single nucleotide variant	not specified [RCV004367520]	Chr11:107439143 [GRCh38] Chr11:107309869 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1461C>G (p.Ile487Met)	single nucleotide variant	not specified [RCV004367511]	Chr11:107418260 [GRCh38] Chr11:107288986 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1232A>G (p.Asn411Ser)	single nucleotide variant	not specified [RCV004367509]	Chr11:107429000 [GRCh38] Chr11:107299726 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1999A>T (p.Ser667Cys)	single nucleotide variant	not specified [RCV004367513]	Chr11:107353610 [GRCh38] Chr11:107224336 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2221G>T (p.Val741Leu)	single nucleotide variant	not specified [RCV004367516]	Chr11:107336695 [GRCh38] Chr11:107207421 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.673G>A (p.Val225Ile)	single nucleotide variant	not specified [RCV004367521]	Chr11:107433741 [GRCh38] Chr11:107304467 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.710A>T (p.Tyr237Phe)	single nucleotide variant	not specified [RCV004367522]	Chr11:107433704 [GRCh38] Chr11:107304430 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1694A>C (p.Lys565Thr)	single nucleotide variant	not specified [RCV004616168]	Chr11:107392819 [GRCh38] Chr11:107263545 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1819A>G (p.Lys607Glu)	single nucleotide variant	not specified [RCV004616166]	Chr11:107390127 [GRCh38] Chr11:107260853 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2465C>T (p.Ser822Phe)	single nucleotide variant	not specified [RCV004616167]	Chr11:107329994 [GRCh38] Chr11:107200720 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2341G>A (p.Ala781Thr)	single nucleotide variant	not specified [RCV004616170]	Chr11:107336575 [GRCh38] Chr11:107207301 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1411G>T (p.Asp471Tyr)	single nucleotide variant	not specified [RCV004616172]	Chr11:107428821 [GRCh38] Chr11:107299547 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2517C>G (p.His839Gln)	single nucleotide variant	not specified [RCV004616165]	Chr11:107329942 [GRCh38] Chr11:107200668 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2078G>T (p.Gly693Val)	single nucleotide variant	not specified [RCV004616169]	Chr11:107353531 [GRCh38] Chr11:107224257 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.680A>T (p.Asp227Val)	single nucleotide variant	not specified [RCV004910971]	Chr11:107433734 [GRCh38] Chr11:107304460 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2296A>G (p.Met766Val)	single nucleotide variant	not specified [RCV004910972]	Chr11:107336620 [GRCh38] Chr11:107207346 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2096G>A (p.Cys699Tyr)	single nucleotide variant	not specified [RCV004910975]	Chr11:107349043 [GRCh38] Chr11:107219769 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.901G>C (p.Glu301Gln)	single nucleotide variant	not specified [RCV004910979]	Chr11:107429331 [GRCh38] Chr11:107300057 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1663G>A (p.Gly555Arg)	single nucleotide variant	not specified [RCV004910974]	Chr11:107392850 [GRCh38] Chr11:107263576 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2114C>G (p.Ser705Cys)	single nucleotide variant	not specified [RCV004910984]	Chr11:107349025 [GRCh38] Chr11:107219751 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.797A>G (p.Gln266Arg)	single nucleotide variant	not specified [RCV004910985]	Chr11:107429435 [GRCh38] Chr11:107300161 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.2425G>A (p.Asp809Asn)	single nucleotide variant	not specified [RCV004910977]	Chr11:107334895 [GRCh38] Chr11:107205621 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1712G>A (p.Gly571Glu)	single nucleotide variant	not specified [RCV004910981]	Chr11:107392801 [GRCh38] Chr11:107263527 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.692G>A (p.Ser231Asn)	single nucleotide variant	not specified [RCV004910978]	Chr11:107433722 [GRCh38] Chr11:107304448 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.631C>T (p.Pro211Ser)	single nucleotide variant	not specified [RCV004910982]	Chr11:107439123 [GRCh38] Chr11:107309849 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.1898A>G (p.Tyr633Cys)	single nucleotide variant	not specified [RCV004910976]	Chr11:107353711 [GRCh38] Chr11:107224437 [GRCh37] Chr11:11q22.3	uncertain significance
NM_152434.3(CWF19L2):c.164A>G (p.Glu55Gly)	single nucleotide variant	not specified [RCV004910980]	Chr11:107455718 [GRCh38] Chr11:107326444 [GRCh37] Chr11:11q22.3	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	932
Count of miRNA genes:	413
Interacting mature miRNAs:	439
Transcripts:	ENST00000282251, ENST00000431778, ENST00000433523, ENST00000462890, ENST00000532251
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
407115937	GWAS764913_H	cognitive decline measurement QTL GWAS764913 (human)		0.000008	cognitive behavior trait (VT:0010450)		11	107326880	107326881	Human
597242830	GWAS1338904_H	C-reactive protein measurement QTL GWAS1338904 (human)		1e-08	C-reactive protein measurement	blood C-reactive protein level (CMO:0003160)	11	107373196	107373197	Human
597274126	GWAS1370200_H	physical activity measurement QTL GWAS1370200 (human)		9e-10	wellness/fitness trait (VT:1000152)	voluntary body movement measurement (CMO:0000954)	11	107450430	107450431	Human
597306880	GWAS1402954_H	pulse pressure measurement QTL GWAS1402954 (human)		4e-14	pulse pressure measurement	pulse pressure (CMO:0000292)	11	107370011	107370012	Human
1559115	SCL20_H	Serum cholesterol level QTL 20 (human)	3.22	0.001213	Lipid level	LDL cholesterol	11	100442501	126442501	Human
597139466	GWAS1235540_H	smoking initiation QTL GWAS1235540 (human)		6e-10	smoking initiation		11	107434056	107434057	Human
597074088	GWAS1170162_H	coronary artery disease QTL GWAS1170162 (human)		9e-08	coronary artery disease		11	107326914	107326915	Human
597139465	GWAS1235539_H	smoking initiation QTL GWAS1235539 (human)		2e-11	smoking initiation		11	107430784	107430785	Human

RH92467

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	107,197,116 - 107,197,285	UniSTS	GRCh37
Build 36	11	106,702,326 - 106,702,495	RGD	NCBI36
Celera	11	104,362,935 - 104,363,104	RGD
Cytogenetic Map	11	q22.3	UniSTS
HuRef	11	103,133,415 - 103,133,584	UniSTS
GeneMap99-GB4 RH Map	11	362.08	UniSTS

D11S2228E

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	107,198,621 - 107,198,734	UniSTS	GRCh37
Build 36	11	106,703,831 - 106,703,944	RGD	NCBI36
Celera	11	104,364,440 - 104,364,553	RGD
Cytogenetic Map	11	q22.3	UniSTS
HuRef	11	103,134,920 - 103,135,033	UniSTS
GeneMap99-GB4 RH Map	11	361.98	UniSTS
NCBI RH Map	11	934.8	UniSTS

SHGC-145207

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	107,202,834 - 107,203,167	UniSTS	GRCh37
Build 36	11	106,708,044 - 106,708,377	RGD	NCBI36
Celera	11	104,368,640 - 104,368,973	RGD
Cytogenetic Map	11	q22.3	UniSTS
HuRef	11	103,139,124 - 103,139,457	UniSTS
TNG Radiation Hybrid Map	11	49016.0	UniSTS

RH36538

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	107,197,117 - 107,197,255	UniSTS	GRCh37
Build 36	11	106,702,327 - 106,702,465	RGD	NCBI36
Celera	11	104,362,936 - 104,363,074	RGD
Cytogenetic Map	11	q22.3	UniSTS
HuRef	11	103,133,416 - 103,133,554	UniSTS
GeneMap99-GB4 RH Map	11	362.08	UniSTS

D11S4021

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	107,299,030 - 107,299,256	UniSTS	GRCh37
Build 36	11	106,804,240 - 106,804,466	RGD	NCBI36
Celera	11	104,453,902 - 104,454,128	RGD
Cytogenetic Map	11	q22.3	UniSTS
HuRef	11	103,224,320 - 103,224,546	UniSTS
Whitehead-RH Map	11	486.4	UniSTS
Whitehead-YAC Contig Map	11		UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2438	2788	2253	4974	1726	2351	6	624	1951	465	2270	7305	6472	53	3734	1	852	1744	1617	175	1


RefSeq Transcripts	NM_152434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_011542620	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017017239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_047426419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054367763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054367764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_007062452	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_008488344	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_947795	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AI148333	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK056905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK126881	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK293001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AP000766	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AP001823	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC016611	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC028043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC056241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC070142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC107418	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC110439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC110440	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC110441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC110442	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC118669	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX647832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX648704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX649022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DA291472	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000282251 ⟹ ENSP00000282251

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	11	107,326,360 - 107,457,825 (-)	Ensembl

Ensembl Acc Id:

ENST00000431778 ⟹ ENSP00000411736

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	11	107,326,360 - 107,443,031 (-)	Ensembl

Ensembl Acc Id:

ENST00000462890

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	11	107,348,711 - 107,353,730 (-)	Ensembl

Ensembl Acc Id:

ENST00000532251 ⟹ ENSP00000434704

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	11	107,326,797 - 107,443,031 (-)	Ensembl

RefSeq Acc Id:

NM_152434 ⟹ NP_689647

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	11	107,326,360 - 107,457,825 (-)	NCBI
GRCh37	11	107,197,071 - 107,328,572 (-)	RGD
Build 36	11	106,702,293 - 106,830,406 (-)	NCBI Archive
Celera	11	104,362,890 - 104,483,437 (-)	RGD
HuRef	11	103,133,370 - 103,254,160 (-)	ENTREZGENE
CHM1_1	11	107,080,175 - 107,211,650 (-)	NCBI
T2T-CHM13v2.0	11	107,333,512 - 107,464,989 (-)	NCBI

Sequence:

show sequence

AGCTTTACGATGGCAACAAGTATGGCGGCTGCTAGTGGTAGATTTGAAAGTGCGAAGAGTATCGAAGAGCGGAAAGAACAGACCCGGAATGCCAGGGCCGAGGTGTTGCGCCAGGCTAAAGCCAATTT
TGAAAAAGAAGAAAGGCGTAAAGAACTTAAGCGACTTCGGGGTGAGGATACATGGATGCTACCTGATGTGAATGAGAGAATTGAACAGTTCTCACAGGAACACTCTGTGAAGAAAAAGAAGAAAAAAG
ACAAGCATTCAAAAAAAGCAAAGAAAGAAAAGAAAAAAAAGAGCAAGAAACAGAAATATGAAAAAAACAATGAGTCATCTGATAGCTCATCAAGCTCTGAAGATGAGTGGGTTGAGGCTGTTCCATCC
CAGACTCCTGACAAGGAAAAAGCCTGGAAAGTGAAAGATGAAAAGTCAGGAAAAGATGACACCCAAATTATCAAGAGGGATGAGTGGATGACTGTTGATTTTATGTCTGTTAAAACTGTGTCATCATC
ATCACTCAAAGCTGAAAAGGAAACTATGAGGAAAATAGAGCAAGAGAAAAACCAAGCGCTTGAACAGTCCAAACTGATGGAAAGAGAATTGAATCCGTACTGGAAGGATGGTGGGACAGGTCTTCCAC
CTGAAGACTGTAGTGTGTCATCGATTACTAAAGTTTCAGTGGTAGAAGATGGTGGATTAAGCTGGCTAAGGAAATCTTATCTAAGAATGAAGGAACAAGCTGAGAAACAAAGTAGAAACTTTGAGGAC
ATTGTAGCCGAAAGATATGGGTCAATGGAAATATTTCAGTCAAAATTAGAAGATGCTGAAAAAGCTGCATCCACGAAAGAAGATTATAGACGGGAACGGTGGAGGAAACCCACATATTCAGATAAAGC
ACAAAATTGTCAAGAAAGTAGAGAATCAGACTTAGTAAAATATGGTAACAGTTCAAGGGATAGATATGCTACAACAGATACTGCAAAAAATAGCAATAATGAAAAATTTATTGGTGATGAAAAAGATA
AGAGACCTGGGTCTTTAGAAACGTGTAGAAGAGAATCTAACCCAAGGCAAAATCAAGAGTTTTCTTTTGGCAATTTGAGAGCTAAATTCTTGAGACCCTCTGATGATGAAGAACTGTCATTTCACAGC
AAGGGCAGAAAATTTGAACCACTTAGTTCATCTTCAGCATTGGTAGCTCAGGGCTCTTTGTGTAGTGGTTTTAGAAAACCCACCAAGAACAGTGAAGAAAGATTAACATCATGGAGTCGCTCTGATGG
GAGAGGAGACAAGAAACATTCAAATCAAAAGCCATCGGAAACCAGTACTGATGAACACCAACATGTTCCAGAAGACCCAAGAGAAAAATCACAAGATGAAGTCTTGAGAGATGACCCTCCAAAAAAAG
AACATCTACGGGATACAAAGTCTACATTTGCTGGCAGTCCAGAGCGTGAGTCCATTCACATCCTGAGTGTTGATGAGAAGAACAAGTTGGGAGCCAAGATTATCAAAGCAGAGATGATGGGGAATATG
GAATTAGCTGAACAACTTAAAGTTCAACTTGAAAAGGCAAATAAATTCAAAGAAACTATAACACAGATACCAAAAAAATCTGGGGTAGAGAATGAAGACCAGCAAGAAGTAATCCTTGTCAGAACAGA
TCAGTCTGGAAGAGTATGGCCTGTGAACACACCCGGAAAATCTCTGGAATCACAAGGAGGAAGAAGAAAGAGACAGATGGTTTCAACCCATGAGGAAAGAGAAAGGGTCAGATACTTTCATGATGATG
ATAATCTAAGCCTAAATGATTTAGTCAAAAATGAAAAGATGGGAACAGCAGAAAATCAAAACAAGCTCTTTATGAGAATGGCATCTAAGTTTATGGGAAAAACAGATGGAGACTATTACACCCTGGAT
GACATGTTTGTCTCCAAAGCAGCTGAGAGAGAACGTCTTGGTGAAGAGGAAGAGAACCAAAGGAAAAAAGCTATTGCTGAGCATCGGAGTCTTGCTGCACAAATGGAAAAATGTCTGTATTGTTTTGA
CAGCTCTCAATTTCCCAAGCATCTTATTGTTGCAATAGGTGTTAAGGTTTATTTATGTTTACCCAACGTACGGTCTCTTACTGAGGGGCACTGCCTGATAGTCCCTTTGCAGCACCATAGAGCAGCTA
CTTTGTTGGATGAAGACATCTGGGAGGAGATCCAGATGTTCAGAAAATCATTGGTAAAGATGTTTGAAGATAAAGGATTAGACTGCATTTTTTTGGAAACTAATATGAGCATGAAGAAACAGTATCAC
ATGGTTTATGAATGTATTCCTCTTCCCAAGGAAGTGGGTGACATGGCTCCCATCTATTTTAAGAAAGCCATAATGGAATCTGATGAAGAGTGGTCCATGAACAAGAAGTTGATAGATCTCTCTTCAAA
AGATATCAGAAAGTCTGTACCCAGAGGGTTACCTTACTTCTCTGTGGATTTTGGCCTTCACGGAGGGTTTGCCCATGTCATTGAAGATCAGCACAAATTCCCTCATTACTTTGGAAAGGAAATCATAG
GTGGGATGCTGGATATAGAACCAAGACTTTGGAGGAAAGGCATCCGAGAAAGCTTTGAGGATCAGAGGAAAAAAGCACTGCAGTTTGCTCAGTGGTGGAAACCATATGACTTCACCAAAAGTAAAAAC
TATTGAGGTGTACCTTCCATTTTAAAATTTTTCTTCAGATCCCGTTCAGTTTTATTTCCATTGCATCTAATGAAGCAACTGACCCTCAGGTCACAGGCAGAGAGAGTCACAGCAGCAGACTGCTCTGG
GTCAGTGACAACTGTACATCAGGAGATTGTGTTGTTTTCTTCTTCACCTGCTCCTATCTATGGACTTCATTTTAGTCACCATGGAGTAAAAACATATATTCGATGATCTGCTCACATTCCTGCTCTCT
ACCTACTTCTTGGTATTCCGAATTGTTCAGTTAATTTAGAGAAGGCCTTTTCTGAAGGGATATCTAAAAAGCATAGGAAATCCTTGGTTCAGAGGGAAGTGGGTCTGCTTCATGGTTGTTAAGTCTAC
TGTCTGGCTTCTTTTGCATTTTTAAAAATAAGACGATTTAATTTTAATTTCATAGGATTTTATAGAAAAGCTCTTAATTTTCTACTAGCAGTATATAGTATCACTTCTATTCTTTTTGTTAAAGGAAA
AGGAAATGTCCCCAAAGTATTAAAGAATTAAATGATACTGAAAA

hide sequence

RefSeq Acc Id:

XM_011542620 ⟹ XP_011540922

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	11	107,424,773 - 107,457,825 (-)	NCBI

Sequence:

show sequence

TCTTGCGGCTTCTTAGCTTTACGATGGCAACAAGTATGGCGGCTGCTAGTGGTAGATTTGAAAG
TGCGAAGAGTATCGAAGAGCGGAAAGAACAGACCCGGAATGCCAGGGCCGAGGTGTTGCGCCAGGCTAAAGCCAATTTTGAAAAAGAAGAAAGGCGTAAAGAACTTAAGCGACTTCGGGGTGAGGATA
CATGGATGCTACCTGATGTGAATGAGAGAATTGAACAGTTCTCACAGGAACACTCTGTGAAGAAAAAGAAGAAAAAAGACAAGCATTCAAAAAAAGCAAAGAAAGAAAAGAAAAAAAAGAGCAAGAAA
CAGAAATATGAAAAAAACAATGAGTCATCTGATAGCTCATCAAGCTCTGAAGATGAGTGGGTTGAGGCTGTTCCATCCCAGACTCCTGACAAGGAAAAAGCCTGGAAAGTGAAAGATGAAAAGTCAGG
AAAAGATGACACCCAAATTATCAAGAGGGATGAGTGGATGACTGTTGATTTTATGTCTGTTAAAACTGTGTCATCATCATCACTCAAAGCTGAAAAGGAAACTATGAGGAAAATAGAGCAAGAGAAAA
ACCAAGCGCTTGAACAGTCCAAACTGATGGAAAGAGAATTGAATCCGTACTGGAAGGATGGTGGGACAGGTCTTCCACCTGAAGACTGTAGTGTGTCATCGATTACTAAAGTTTCAGTGGTAGAAGAT
GGTGGATTAAGCTGGCTAAGGAAATCTTATCTAAGAATGAAGGAACAAGCTGAGAAACAAAGTAGAAACTTTGAGGACATTGTAGCCGAAAGATATGGGTCAATGGAAATATTTCAGTCAAAATTAGA
AGATGCTGAAAAAGCTGCATCCACGAAAGAAGATTATAGACGGGAACGGTGGAGGAAACCCACATATTCAGATAAAGCACAAAATTGTCAAGAAAGTAGAGAATCAGACTTAGTAAAATATGGTAACA
GTTCAAGGGATAGATATGCTACAACAGATACTGCAAAAAATAGCAATAATGAAAAATTTATTGGTGATGAAAAAGATAAGAGACCTGGGTCTTTAGAAACGTGTAGAAGAGAATCTAACCCAAGGCAA
AATCAAGAGTTTTCTTTTGGCAATTTGAGAGCTAAATTCTTGAGACCCTCTGATGATGAAGAACTGTCATTTCACAGCAAGGGCAGAAAATTTGAACCACTTAGTTCATCTTCAGCATTGGTAGCTCA
GGGCTCTTTGTGTAGTGGTTTTAGAAAACCCACCAAGAACAGTGAAGAAAGATTAACATCATGGAGTCGCTCTGATGGGAGAGGAGACAAGAAACATTCAAATCAAAAGCCATCGGAAACCAGTACTG
ATGAACACCAACATGTTCCAGAAGACCCAAGAGAAAAATCACAAGATGAAGTCTTGAGAGATGACCCTCCAAAAAAAGAACATCTACGGGATACAAAGTCTACATTTGCTGGGATAATTGCAGGTGTC
ATGGTGATGTTTCTTTCAAAGCATTTGCTCATCATTATAAACACTTGGGGAAAGAAAGGAAGAGCCCATTCCCTGATGTTTGCTGTAGAACAGTGTCTTTGCTGTGGTGTTCACAAAATAAAATAGAA
TAATATTTTCTTCAGTTACTTTGTGCTCAACAACTTTCATTTAAATGTCTTTACTTGACACCTATTACTGTTACATTGTGTTCAAGTAACTTAATGTTGAAATTACTACTATAAAAGATGTTCAGAAT
TCTTGTATATTTTTGTCATTTATCCTCATCTACTAATAAACAATTTAATTCTTGTTAGAAAATACTAA

hide sequence

RefSeq Acc Id:

XM_047426419 ⟹ XP_047282375

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	11	107,326,360 - 107,433,741 (-)	NCBI

RefSeq Acc Id:

XM_054367763 ⟹ XP_054223738

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	11	107,431,867 - 107,464,989 (-)	NCBI

RefSeq Acc Id:

XM_054367764 ⟹ XP_054223739

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	11	107,333,512 - 107,440,900 (-)	NCBI

RefSeq Acc Id:

XR_007062452

Type:

NON-CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	11	107,336,627 - 107,457,825 (-)	NCBI

RefSeq Acc Id:

XR_008488344

Type:

NON-CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	11	107,343,780 - 107,464,989 (-)	NCBI


Protein RefSeqs	NP_689647	(Get FASTA)	NCBI Sequence Viewer
	XP_011540922	(Get FASTA)	NCBI Sequence Viewer
	XP_047282375	(Get FASTA)	NCBI Sequence Viewer
	XP_054223738	(Get FASTA)	NCBI Sequence Viewer
	XP_054223739	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH28043	(Get FASTA)	NCBI Sequence Viewer
	AAH56241	(Get FASTA)	NCBI Sequence Viewer
	AAI10440	(Get FASTA)	NCBI Sequence Viewer
	AAI10441	(Get FASTA)	NCBI Sequence Viewer
	AAI10442	(Get FASTA)	NCBI Sequence Viewer
	AAI10443	(Get FASTA)	NCBI Sequence Viewer
	AAI18670	(Get FASTA)	NCBI Sequence Viewer
	BAB71307	(Get FASTA)	NCBI Sequence Viewer
	BAF85690	(Get FASTA)	NCBI Sequence Viewer
	EAW67085	(Get FASTA)	NCBI Sequence Viewer
	EAW67086	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000282251
	ENSP00000282251.5
GenBank Protein	Q2TBE0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_689647 ⟸ NM_152434

- UniProtKB:

Q6PHW1 (UniProtKB/Swiss-Prot), A8KAD6 (UniProtKB/Swiss-Prot), A4FU68 (UniProtKB/Swiss-Prot), A4FU67 (UniProtKB/Swiss-Prot), A4FU66 (UniProtKB/Swiss-Prot), Q96MI1 (UniProtKB/Swiss-Prot), Q2TBE0 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MATSMAAASGRFESAKSIEERKEQTRNARAEVLRQAKANFEKEERRKELKRLRGEDTWMLPDVNERIEQFSQEHSVKKKKKKDKHSKKAKKEKKKKSKKQKYEKNNESSDSSSSSEDEWVEAVPSQTP
DKEKAWKVKDEKSGKDDTQIIKRDEWMTVDFMSVKTVSSSSLKAEKETMRKIEQEKNQALEQSKLMERELNPYWKDGGTGLPPEDCSVSSITKVSVVEDGGLSWLRKSYLRMKEQAEKQSRNFEDIVA
ERYGSMEIFQSKLEDAEKAASTKEDYRRERWRKPTYSDKAQNCQESRESDLVKYGNSSRDRYATTDTAKNSNNEKFIGDEKDKRPGSLETCRRESNPRQNQEFSFGNLRAKFLRPSDDEELSFHSKGR
KFEPLSSSSALVAQGSLCSGFRKPTKNSEERLTSWSRSDGRGDKKHSNQKPSETSTDEHQHVPEDPREKSQDEVLRDDPPKKEHLRDTKSTFAGSPERESIHILSVDEKNKLGAKIIKAEMMGNMELA
EQLKVQLEKANKFKETITQIPKKSGVENEDQQEVILVRTDQSGRVWPVNTPGKSLESQGGRRKRQMVSTHEERERVRYFHDDDNLSLNDLVKNEKMGTAENQNKLFMRMASKFMGKTDGDYYTLDDMF
VSKAAERERLGEEEENQRKKAIAEHRSLAAQMEKCLYCFDSSQFPKHLIVAIGVKVYLCLPNVRSLTEGHCLIVPLQHHRAATLLDEDIWEEIQMFRKSLVKMFEDKGLDCIFLETNMSMKKQYHMVY
ECIPLPKEVGDMAPIYFKKAIMESDEEWSMNKKLIDLSSKDIRKSVPRGLPYFSVDFGLHGGFAHVIEDQHKFPHYFGKEIIGGMLDIEPRLWRKGIRESFEDQRKKALQFAQWWKPYDFTKSKNY

hide sequence

RefSeq Acc Id:

XP_011540922 ⟸ XM_011542620

- Peptide Label:

isoform X1

- Sequence:

show sequence

MATSMAAASGRFESAKSIEERKEQTRNARAEVLRQAKANFEKEERRKELKRLRGEDTWMLPDVNERIEQFSQEHSVKKKKKKDKHSKKAKKEKKKKSKKQKYEKNNESSDSSSSSEDEWVEAVPSQTP
DKEKAWKVKDEKSGKDDTQIIKRDEWMTVDFMSVKTVSSSSLKAEKETMRKIEQEKNQALEQSKLMERELNPYWKDGGTGLPPEDCSVSSITKVSVVEDGGLSWLRKSYLRMKEQAEKQSRNFEDIVA
ERYGSMEIFQSKLEDAEKAASTKEDYRRERWRKPTYSDKAQNCQESRESDLVKYGNSSRDRYATTDTAKNSNNEKFIGDEKDKRPGSLETCRRESNPRQNQEFSFGNLRAKFLRPSDDEELSFHSKGR
KFEPLSSSSALVAQGSLCSGFRKPTKNSEERLTSWSRSDGRGDKKHSNQKPSETSTDEHQHVPEDPREKSQDEVLRDDPPKKEHLRDTKSTFAGIIAGVMVMFLSKHLLIIINTWGKKGRAHSLMFAV
EQCLCCGVHKIK

hide sequence

Ensembl Acc Id:

ENSP00000282251 ⟸ ENST00000282251

Ensembl Acc Id:

ENSP00000434704 ⟸ ENST00000532251

Ensembl Acc Id:

ENSP00000411736 ⟸ ENST00000431778

Protein Domains

Cwf19-like C-terminal Cwf19-like protein C-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q2TBE0-F1-model_v2	AlphaFold	Q2TBE0	1-894	view protein structure

RGD ID:

6788665

Promoter ID:

HG_KWN:14097

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

NM_152434

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	11	106,833,466 - 106,833,966 (-)	MPROMDB

RGD ID:

7221987

Promoter ID:

EPDNEW_H16739

Type:

initiation region

Name:

CWF19L2_2

Description:

CWF19 like 2, cell cycle control

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H16740

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	11	107,443,030 - 107,443,090	EPDNEW

RGD ID:

7221989

Promoter ID:

EPDNEW_H16740

Type:

initiation region

Name:

CWF19L2_1

Description:

CWF19 like 2, cell cycle control

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H16739

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	11	107,457,825 - 107,457,885	EPDNEW

Database	Acc Id	Source(s)
COSMIC	CWF19L2	COSMIC
Ensembl Genes	ENSG00000152404	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000282251	ENTREZGENE
	ENST00000282251.10	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.428.10	UniProtKB/Swiss-Prot
GTEx	ENSG00000152404	GTEx
HGNC ID	HGNC:26508	ENTREZGENE
Human Proteome Map	CWF19L2	Human Proteome Map
InterPro	Cwf19-like	UniProtKB/Swiss-Prot
	Cwf19-like_C_dom-1	UniProtKB/Swiss-Prot
	Cwf19-like_C_dom-2	UniProtKB/Swiss-Prot
	HIT-like_sf	UniProtKB/Swiss-Prot
KEGG Report	hsa:143884	UniProtKB/Swiss-Prot
NCBI Gene	143884	ENTREZGENE
PANTHER	CWF19-LIKE PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR12072	UniProtKB/Swiss-Prot
Pfam	CwfJ_C_1	UniProtKB/Swiss-Prot
	CwfJ_C_2	UniProtKB/Swiss-Prot
PharmGKB	PA134914164	PharmGKB
Superfamily-SCOP	SSF54197	UniProtKB/Swiss-Prot
UniProt	A4FU66	ENTREZGENE
	A4FU67	ENTREZGENE
	A4FU68	ENTREZGENE
	A8KAD6	ENTREZGENE
	C19L2_HUMAN	UniProtKB/Swiss-Prot
	H0YE03_HUMAN	UniProtKB/TrEMBL
	H7C3G7_HUMAN	UniProtKB/TrEMBL
	Q2TBE0	ENTREZGENE
	Q6PHW1	ENTREZGENE
	Q6PIV4_HUMAN	UniProtKB/TrEMBL
	Q96MI1	ENTREZGENE
UniProt Secondary	A4FU66	UniProtKB/Swiss-Prot
	A4FU67	UniProtKB/Swiss-Prot
	A4FU68	UniProtKB/Swiss-Prot
	A8KAD6	UniProtKB/Swiss-Prot
	Q6PHW1	UniProtKB/Swiss-Prot
	Q96MI1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-07-10	CWF19L2	CWF19 like cell cycle control factor 2		CWF19 like 2, cell cycle control (S. pombe)	Symbol and/or name change	5135510	APPROVED
2017-02-28	CWF19L2	CWF19 like 2, cell cycle control (S. pombe)		CWF19-like 2, cell cycle control (S. pombe)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Human Phenotype Annotations - ClinVar

Send us a Message

Imported Disease Annotations - ClinVar

Imported Human Phenotype Annotations - ClinVar