Tlx2 (T cell leukemia, homeobox 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tlx2 (T cell leukemia, homeobox 2) Mus musculus

Analyze

Symbol:

Tlx2

Name:

T cell leukemia, homeobox 2

RGD ID:

1320083

MGI Page

MGI

Description:

Is expressed in several structures, including adrenal gland; alimentary system; nervous system; primitive streak; and urethra. Used to study intestinal pseudo-obstruction. Orthologous to human TLX2 (T cell leukemia homeobox 2); INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; 4-hydroxyphenyl retinamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

En; enteric neuron homeobox; Enx; homeo box 11-like 1; homeobox protein Hox-11L1; homeobox TLX-2; Hox11; Hox11L; Hox11L.1; Hox11l1; NC; NCX; Ncx1; PMUR10F; T-cell leukemia homeobox protein 2; T-cell leukemia, homeobox 2; Tlx1; Tlx1l1; Tlx1l2

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TLX2 (T cell leukemia homeobox 2)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Tlx2 (T-cell leukemia homeobox 2)	HGNC	HomoloGene, Inparanoid, Panther, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Tlx2 (T cell leukemia homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TLX2 (T cell leukemia homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TLX2 (T cell leukemia homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tlx2 (T cell leukemia homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TLX2 (T cell leukemia homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	TLX2 (T cell leukemia homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tlx2 (T cell leukemia homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TLX3 (T cell leukemia homeobox 3)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	TLX2 (T cell leukemia homeobox 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Danio rerio (zebrafish):	tlx2 (T cell leukemia homeobox 2)	Alliance	DIOPT (Ensembl Compara\|PANTHER\|TreeFam\|ZFIN)
Drosophila melanogaster (fruit fly):	C15	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Caenorhabditis elegans (roundworm):	ceh-63	Alliance	DIOPT (Ensembl Compara\|InParanoid)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	83,045,306 - 83,047,206 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	6	83,045,305 - 83,047,274 (-)	Ensembl
GRCm38	6	83,068,325 - 83,070,225 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	83,068,324 - 83,070,293 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	83,018,319 - 83,020,219 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	6	83,033,983 - 83,035,883 (-)	NCBI			mm8
Celera	6	85,050,935 - 85,052,835 (-)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI
cM Map	6	35.94	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

intestinal pseudo-obstruction (IEA)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

4-hydroxyphenyl retinamide (EXP)

all-trans-retinoic acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

C60 fullerene (ISO)

carbamazepine (ISO)

choline (EXP)

clofibrate (EXP)

folic acid (EXP)

fonofos (ISO)

L-methionine (EXP)

paracetamol (EXP)

parathion (ISO)

pentanal (ISO)

propanal (ISO)

silicon dioxide (ISO)

terbufos (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ development (IBA)

enteric nervous system development (IMP)

mesoderm formation (IMP)

multicellular organism development (IEA)

negative regulation of dendrite morphogenesis (IDA)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of transcription by RNA polymerase II (IBA,ISA)

regulation of transcription, DNA-templated (IEA)

Cellular Component

cytoplasm (IDA)

nucleus (IBA,IDA,ISA)

Molecular Function

DNA binding (ISA)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (IPI,ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal amnion morphology (IAGP)

abnormal colon morphology (IAGP)

abnormal ectoderm development (IAGP)

abnormal embryonic tissue morphology (IAGP)

abnormal enteric ganglia morphology (IAGP)

abnormal enteric nervous system morphology (IAGP)

abnormal enteric neuron morphology (IAGP)

abnormal extraembryonic tissue morphology (IAGP)

abnormal innervation (IAGP)

abnormal large intestine morphology (IAGP)

abnormal primitive streak formation (IAGP)

abnormal small intestinal transit time (IAGP)

abnormal small intestine morphology (IAGP)

decreased survivor rate (IAGP)

distended abdomen (IAGP)

distended cecum (IAGP)

distended duodenum (IAGP)

distended ileum (IAGP)

embryonic lethality between implantation and somite formation, complete penetrance (IAGP)

intestinal hypoperistalsis (IAGP)

intestinal obstruction (IAGP)

megacolon (IAGP)

postnatal growth retardation (IAGP)

premature death (IAGP)

References

References - curated


1.	Gray PA, etal., Science 2004 Dec 24;306(5705):2255-7.
2.	Heyer BS, etal., Mol Reprod Dev 1997 Jun;47(2):148-56.
3.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.	MGD data from the GO Consortium
5.	MGD IEA
6.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.	RGD automated import pipeline
8.	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1681546	PMID:7698766	PMID:7747804	PMID:7908826	PMID:8099440	PMID:9021157	PMID:9176491	PMID:9259577	PMID:9550720	PMID:9738002	PMID:10198162	PMID:10343123
PMID:10349636	PMID:10446220	PMID:11042159	PMID:11076861	PMID:11287196	PMID:11353393	PMID:11581159	PMID:11587205	PMID:12477932	PMID:12502601	PMID:14598259	PMID:14633973
PMID:14681479	PMID:15803212	PMID:16141072	PMID:16141073	PMID:16291166	PMID:16329126	PMID:16602821	PMID:17035299	PMID:17560225	PMID:18287559	PMID:20682252	PMID:21267068
PMID:21873635	PMID:24952961	PMID:29031500	PMID:30917309

Genomics

Comparative Map Data

Tlx2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	83,045,306 - 83,047,206 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	6	83,045,305 - 83,047,274 (-)	Ensembl
GRCm38	6	83,068,325 - 83,070,225 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	83,068,324 - 83,070,293 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	83,018,319 - 83,020,219 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	6	83,033,983 - 83,035,883 (-)	NCBI			mm8
Celera	6	85,050,935 - 85,052,835 (-)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI
cM Map	6	35.94	NCBI

TLX2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	2	74,513,463 - 74,517,148 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	2	74,514,450 - 74,517,148 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	2	74,741,577 - 74,744,275 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	74,595,119 - 74,597,398 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	2	74,653,265 - 74,655,545	NCBI
Celera	2	74,572,760 - 74,575,439 (+)	NCBI
Cytogenetic Map	2	p13.1	NCBI
HuRef	2	74,477,857 - 74,480,536 (+)	NCBI		HuRef
CHM1_1	2	74,670,993 - 74,673,672 (+)	NCBI		CHM1_1

Tlx2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	115,573,736 - 115,576,097 (-)	NCBI
Rnor_6.0 Ensembl	4	113,900,556 - 113,902,399 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	4	114,766,714 - 114,768,029 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	4	114,766,401 - 114,768,243 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	4	178,585,662 - 178,587,437 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	117,279,091 - 117,281,693 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
Celera	4	104,568,477 - 104,570,295 (-)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

Tlx2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955424	11,269,426 - 11,275,200 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955424	11,269,426 - 11,275,200 (-)	NCBI	ChiLan1.0	ChiLan1.0

TLX2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2A	76,087,700 - 76,089,082 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	76,087,113 - 76,089,324 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	2A	74,581,111 - 74,583,425 (+)	NCBI	Mhudiblu_PPA_v0		panPan3

TLX2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	17	48,625,632 - 48,627,052 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	17	48,625,008 - 48,627,085 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Tlx2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936556	727,637 - 729,391 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TLX2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	68,532,963 - 68,534,344 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	68,532,111 - 68,537,385 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	71,857,416 - 71,876,586 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TLX2
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	32,761,338 - 32,764,030 (-)	NCBI
ChlSab1.1 Ensembl	14	32,762,310 - 32,763,692 (-)	Ensembl

Tlx2
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624749	28,996,912 - 28,998,900 (-)	NCBI

Position Markers

UniSTS:492892

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	83,068,603 - 83,070,099	UniSTS	GRCm38
MGSCv37	6	83,018,597 - 83,020,093	UniSTS	GRCm37
Celera	6	85,051,213 - 85,052,709	UniSTS
Cytogenetic Map	6	C3-D1	UniSTS

Tlx2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	6	C3-D1	UniSTS
cM Map	6	35.94	UniSTS

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
25440480	Moaq2_m	modifier of alien QTL 2 (mouse)					6	1	117500000	Mouse
26884414	Bzwq12_m	bi-zygomatic width QTL 12, 16 week (mouse)					6	3400000	139100000	Mouse
1300556	Cia6_m	collagen induced arthritis QTL 6 (mouse)			Not determined		6	4464884	87426034	Mouse
4142126	W3q3_m	weight 3 weeks QTL 3 (mouse)			Not determined			4503823	96656149	Mouse
4142361	W10q11_m	weight 10 weeks QTL 11 (mouse)			Not determined			4503823	96656149	Mouse
4142271	Egq8_m	early growth QTL 8 (mouse)			Not determined			4503823	96656149	Mouse
4142232	W6q4_m	weight 6 weeks QTL 4 (mouse)			Not determined			4503823	96656149	Mouse
1558984	Cplaq9_m	circadian period of locomotor activity 9 (mouse)			Not determined		6	38669625	92607450	Mouse
1300618	Pgia19_m	proteoglycan induced arthritis 19 (mouse)			Not determined		6	45314059	87426034	Mouse
10412157	Fl1n_m	fatty liver 1 in NSY (mouse)			Not determined		6	45314059	128835032	Mouse
4142259	Tabw2_m	tally ho associated body weight 2 (mouse)			Not determined			46935985	136423692	Mouse
25314319	Histh6_m	histamine hypersensitivity 6 (mouse)					6	48720000	125360000	Mouse
25314320	Histh5_m	histamine hypersensitivity 5 (mouse)					6	48720000	148450000	Mouse
1301962	Eila2_m	ethanol induced locomotor activity 2 (mouse)			Not determined		6	48726556	125356785	Mouse
1301254	Skts11_m	skin tumor susceptibility 11 (mouse)			Not determined		6	51179150	85179300	Mouse
1357683	Igf1sl1_m	IGF-1 serum levels 1 (mouse)			Not determined		6	52161713	116155267	Mouse
4141028	Mclr_m	methylcholanthrene lymphoma resistance (mouse)			Not determined			54373427	88379171	Mouse
15039373	Adip28_m	adiposity 28 (mouse)					6	56308211	90308211	Mouse
15039375	Bw41_m	body weight QTL 41 (mouse)					6	56308211	90308211	Mouse
1558977	Skmw10_m	skeletal muscle weight 10 (mouse)			Not determined		6	58447583	92447710	Mouse
10043972	Obq28_m	obesity QTL 28 (mouse)			Not determined		6	58540433	92540433	Mouse
1301740	Bwq2_m	body weight QTL 2 (mouse)			Not determined		6	60057680	94057799	Mouse
1301369	Im4_m	immunoregulatory 4 (mouse)			Not determined		6	63484738	97484905	Mouse
1300650	Bw18_m	body weight QTL 18 (mouse)			Not determined		6	66713869	100714031	Mouse
1301876	Bits2_m	bitterness sensitivity 2 (mouse)			Not determined		6	70425898	104426034	Mouse
1301813	Skl3_m	skeletal size (tail length) 3 (mouse)			Not determined		6	70425898	104426034	Mouse
1301034	Egrm2_m	early growth rate (mouse)			Not determined		6	70425898	104426034	Mouse
4141990	Etax6_m	ethanol induced ataxia 6 (mouse)			Not determined			71322621	86275719	Mouse
1302020	Bbaa20_m	B.burgdorferi-associated arthritis 20 (mouse)			Not determined		6	71322621	93464093	Mouse
1300869	Stheal5_m	soft tissue heal 5 (mouse)			Not determined		6	71575060	105575178	Mouse
1300954	Fcsa1_m	femoral cross-sectional area 1 (mouse)			Not determined		6	71981024	105981170	Mouse
1301521	Pas1c_m	pulmonary adenoma susceptibility 1c (mouse)			Not determined		6	71981024	105981170	Mouse
13506930	Recrq9_m	recombination rate in male meiosis QTL 9 (mouse)					6	73500000	134700000	Mouse
1301320	Ots1_m	ovarian teratoma susceptibility 1 (mouse)			Not determined		6	75447583	104503555	Mouse
1301571	Arrd1_m	age-related retinal degeneration 1 (mouse)			Not determined		6	75544356	92607450	Mouse
1300674	Nidd3n_m	non-insulin-dependent diabetes mellitus 3 in NSY (mouse)			Not determined		6	75544356	94225955	Mouse
10412195	Efw_m	epididymal fat weight (mouse)			Not determined		6	75544356	94225955	Mouse
10043901	Pfat5_m	predicted fat percentage 5 (mouse)			Not determined		6	75607306	109607450	Mouse
10412208	Cypr4_m	cytokine production 4 (mouse)			Not determined		6	75716503	109716697	Mouse
1357875	Pfat2_m	predicted fat percentage 2 (mouse)			Not determined		6	76463949	110464093	Mouse
14697704	Stsl4_m	Salmonella typhimurium susceptibility locus 4 (mouse)					6	77100000	90000000	Mouse
13824985	Alh1_m	amplitude of lateral head displacement 1 (mouse)					6	78000000	97000000	Mouse
4141376	Dbm1_m	diabetes modifier 1 (mouse)			Not determined		6	78629504	121115387	Mouse
14696731	Pairq1_m	P. aeruginosa infection resistance QTL 1 (mouse)					6	81500000	102200000	Mouse

miRNA Target Status

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
Mir1a-1	mmu-miR-1a-3p	Mirtarbase	external_info	Luciferase reporter assay	Functional MTI	23436819
Mir1a-2	mmu-miR-1a-3p	Mirtarbase	external_info	Luciferase reporter assay	Functional MTI	23436819

Predicted Target Of

	Summary Value
Count of predictions:	417
Count of miRNA genes:	229
Interacting mature miRNAs:	245
Transcripts:	ENSMUST00000089641, ENSMUST00000174674
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_009392	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB008500	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC104324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC134899	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK013072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC138240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC138241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M75953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000089641 ⟹ ENSMUSP00000087069

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	6	83,068,591 - 83,070,293 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000174674 ⟹ ENSMUSP00000133420

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	6	83,068,324 - 83,070,225 (-)	Ensembl

RefSeq Acc Id:

NM_009392 ⟹ NP_033418

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	6	83,045,306 - 83,047,206 (-)	NCBI
GRCm38	6	83,068,325 - 83,070,225 (-)	ENTREZGENE
MGSCv37	6	83,018,319 - 83,020,219 (-)	RGD
Celera	6	85,050,935 - 85,052,835 (-)	RGD
cM Map	6		ENTREZGENE

Sequence:

show sequence

GGATGTTGCTGTCCCGGGGGCCCCGGCGCATGGCCGTGGCCAGCCCCGCGGGCCCCTGAAGCCT
CTGCCCTGAGCGCGCCGCCGCCGGGCTCCCGCAGCCGTCAGAAACACCTTTTCCAGTCATCCAA
CCTCTCAGGCTTGGACCCATGGAGCCCGCGGTGTTGGCTGCGCACCACCTTCCGCACCACGAAC
CCATCAGCTTCGGCATCGATCAGATCCTGAGCGGTCCCGAACCCCCGGGGGGCGGTCTGGGTCC
CGGTCAGTCGGGCCAGAGCCACGGAGAAAGTGCGGCGTTTTCCAGTGGATTCCACGGAGCCTCG
GGCTATGCTCCAGCCGGCTCGCTGGCCTCCTTGCCTAGAGGCTCGGGAGTGGGCCCCGGCGGCG
TGATCCGCGTCCCCGCGCACCGCCCGCTGCCCGTGCCGCCACCCTCGGGTGCGGCCCCCGCCGT
GCCCGGACCCTCTGGTTTGGGTGGCGCCGGGGGCCTAGCGGGACTCACCTTCCCCTGGATGGAC
AGCGGCCGCCGCTTTGCAAAGGACAGGCTCACGGCTGCGCTCTCGCCCTTCTCTGGGACACGTC
GCATAGGCCATCCCTACCAAAACCGGACCCCCCCGAAGCGCAAGAAGCCGCGCACCTCCTTTTC
CCGCTCGCAGGTGCTGGAGCTGGAGCGCCGCTTCTTGCGCCAGAAGTACCTGGCCTCCGCAGAG
AGGGCGGCGCTGGCCAAGGCCCTGCGCATGACGGACGCGCAGGTCAAGACCTGGTTCCAGAACC
GACGCACCAAGTGGCGGCGCCAGACCGCGGAGGAGCGCGAGGCCGAGCGGCACCGCGCTGGTCG
CCTGCTGCTGCACCTGCAGCAAGACGCGCTGCCCCGGCCGCTGCGGCCACCGCTGCCACCGGAC
CCGCTTTGCCTGCACAACTCGTCGCTCTTCGCGCTGCAGAATCTGCAGCCCTGGGCGGAAGACA
ACAAGGTGGCTTCGGTGTCCGGGCTCGCCTCGGTGGTGTGACCGACACCTGCCCGACGAGCGCC
AACGTGGCCGGGTGCCGTACCGCCAGCGAAGAGTGAGGAGCAGAAGGCCCGCGGCCCGCGGCCG
TCCTCTGAGGCTCTTTGGTCATCAGTGGCCCCTGGCCCACACTCTGACTCCGCCCTTCAAGGTT
TTGTTTTGTTTTGTTTAAAAAAAAAAACCCCGCTGAGATGTGGGTTGCAAGAGCAACCTGCAGG
ATTGTGGATGAAGCAGGGACCCTGCAAGGCTGCGACTTTGCCCTGAGTGGGCTCAGAGCTCAGG
TCCTGCTGGGAAGGGACCACAGAGCTGGTGTAAAGGCAGATATCAAAGGACAGCGGGGGAGGGG
TAATGGAAGAGGCGCTGGCAGTAGAGAATGTGGCCTACTGTGACAGGGACCTCGTCCCTCATCT
GTAAAACAATAACTAAGGATTCCTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_033418	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA37805	(Get FASTA)	NCBI Sequence Viewer
	AAI38241	(Get FASTA)	NCBI Sequence Viewer
	AAI38242	(Get FASTA)	NCBI Sequence Viewer
	EDK99054	(Get FASTA)	NCBI Sequence Viewer
	EDK99055	(Get FASTA)	NCBI Sequence Viewer
	Q61663	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_033418 ⟸ NM_009392

- UniProtKB:

Q61663 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MEPAVLAAHHLPHHEPISFGIDQILSGPEPPGGGLGPGQSGQSHGESAAFSSGFHGASGYAPAG
SLASLPRGSGVGPGGVIRVPAHRPLPVPPPSGAAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFA
KDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAK
ALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHN
SSLFALQNLQPWAEDNKVASVSGLASVV

hide sequence

RefSeq Acc Id:

ENSMUSP00000133420 ⟸ ENSMUST00000174674

RefSeq Acc Id:

ENSMUSP00000087069 ⟸ ENSMUST00000089641

Promoters

RGD ID:

6839789

Promoter ID:

MM_KWN:46567

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Brain, Kidney, Lung

Transcripts:

NM_009392, UC009CMF.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	6	83,020,471 - 83,020,971 (-)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1350935	AgrOrtholog
Ensembl Genes	ENSMUSG00000068327	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSMUSP00000087069	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSMUSP00000133420	UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000089641	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSMUST00000174674	UniProtKB/TrEMBL
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_metazoa	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TLX1/2/3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:21909	UniProtKB/Swiss-Prot
MGD	MGI:1350935	ENTREZGENE
NCBI Gene	21909	ENTREZGENE
PANTHER	PTHR45921	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Homeodomain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tlx2	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	HOX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	G3UWU0_MOUSE	UniProtKB/TrEMBL
	Q61663	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	B2RR62	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-02-07	Tlx2	T cell leukemia, homeobox 2	Tlx2	T-cell leukemia, homeobox 2	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - MGI