Dusp23 (dual specificity phosphatase 23)

Advanced Search (OLGA)

Gene: Dusp23 (dual specificity phosphatase 23) Mus musculus

Analyze

Symbol:

Dusp23

Name:

dual specificity phosphatase 23

RGD ID:

1319413

MGI Page

MGI

Description:

Predicted to enable protein tyrosine phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. Predicted to be involved in cilium assembly and dephosphorylation. Predicted to be located in nucleoplasm. Predicted to be active in cytoplasm. Orthologous to human DUSP23 (dual specificity phosphatase 23).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1300005N15Rik; dual specificity protein phosphatase 23; Ldp; LDP-3; low molecular mass dual specificity phosphatase 3; low-molecular-mass dual-specificity phosphatase; MGC73633

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DUSP23 (dual specificity phosphatase 23)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Dusp23 (dual specificity phosphatase 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dusp23 (dual specificity phosphatase 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DUSP23 (dual specificity phosphatase 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DUSP23 (dual specificity phosphatase 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dusp23 (dual specificity phosphatase 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DUSP23 (dual specificity phosphatase 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DUSP23 (dual specificity phosphatase 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dusp23 (dual specificity phosphatase 23)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Dusp23 (dual specificity phosphatase 23)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DUSP23 (dual specificity phosphatase 23)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dusp23a (dual specificity phosphatase 23a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|ZFIN)
Danio rerio (zebrafish):	dusp23b (dual specificity phosphatase 23b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Xenopus tropicalis (tropical clawed frog):	dusp23	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	172,458,336 - 172,460,504 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	172,458,331 - 172,460,529 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	172,630,769 - 172,632,974 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	172,630,764 - 172,632,962 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	174,560,900 - 174,563,105 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	174,468,045 - 174,469,637 (-)	NCBI		MGSCv36	mm8
Celera	1	175,487,228 - 175,489,448 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	80.05	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autoimmune interstitial lung, joint, and kidney disease (ISO)

gastrointestinal stromal tumor (ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

1,3-dinitrobenzene (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

4-nitrophenyl phosphate (ISO)

actinomycin D (ISO)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

bisphenol F (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

Dibutyl phosphate (ISO)

dorsomorphin (ISO)

endosulfan (ISO)

entinostat (ISO)

ethylenediaminetetraacetic acid (ISO)

fenthion (EXP)

genistein (EXP)

lead diacetate (EXP,ISO)

medroxyprogesterone acetate (ISO)

methidathion (EXP)

methoxychlor (ISO)

methylparaben (ISO)

N-ethylmaleimide (ISO)

nickel sulfate (ISO)

Nutlin-3 (ISO)

ozone (EXP)

panobinostat (ISO)

SB 431542 (ISO)

silver atom (EXP)

silver(0) (EXP)

sodium arsenate (EXP)

sodium arsenite (ISO)

sodium fluoride (EXP)

sunitinib (ISO)

temozolomide (ISO)

testosterone (EXP)

tetrachloromethane (ISO)

thioacetamide (ISO)

thiram (ISO)

titanium dioxide (EXP)

trichloroethene (ISO)

triphenyl phosphate (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromatin remodeling (IEA)

cilium assembly (IBA)

dephosphorylation (ISO,ISS)

regulation of transcription by RNA polymerase II (IEA)

Cellular Component

cytoplasm (IBA)

cytosol (IEA)

nucleoplasm (IEA,ISO)

Molecular Function

calmodulin-dependent protein phosphatase activity (IEA)

histone H2AXS140 phosphatase activity (IEA)

histone H2AXY142 phosphatase activity (IEA)

MAP kinase serine/threonine phosphatase activity (IEA)

myosin phosphatase activity (IEA)

non-membrane spanning protein tyrosine phosphatase activity (IEA)

phosphatase activity (ISO,ISS)

protein binding (ISO)

protein tyrosine phosphatase activity (IBA)

protein tyrosine phosphatase activity, metal-dependent (IEA)

protein tyrosine/serine/threonine phosphatase activity (IEA,ISO)

RNA polymerase II CTD heptapeptide repeat S2 phosphatase activity (IEA)

RNA polymerase II CTD heptapeptide repeat S5 phosphatase activity (IEA)

RNA polymerase II CTD heptapeptide repeat S7 phosphatase activity (IEA)

RNA polymerase II CTD heptapeptide repeat T4 phosphatase activity (IEA)

RNA polymerase II CTD heptapeptide repeat Y1 phosphatase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
3.	MGDs mouse GO annotations	MGD data from the GO Consortium
4.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:10349636	PMID:11042159	PMID:11076861	PMID:12477932	PMID:15281913	PMID:15489334	PMID:16141072	PMID:16141073	PMID:21873635	PMID:27255161	PMID:32325033
PMID:37196079	PMID:38355793

Genomics

Comparative Map Data

Dusp23
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	172,458,336 - 172,460,504 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	172,458,331 - 172,460,529 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	172,630,769 - 172,632,974 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	172,630,764 - 172,632,962 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	174,560,900 - 174,563,105 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	174,468,045 - 174,469,637 (-)	NCBI		MGSCv36	mm8
Celera	1	175,487,228 - 175,489,448 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	80.05	NCBI

DUSP23
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	159,780,962 - 159,782,543 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	159,780,932 - 159,782,543 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	159,750,752 - 159,752,333 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	158,017,383 - 158,018,957 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	156,563,831 - 156,565,406	NCBI
Celera	1	132,819,186 - 132,820,760 (+)	NCBI		Celera
Cytogenetic Map	1	q23.2	NCBI
HuRef	1	131,107,191 - 131,108,765 (+)	NCBI		HuRef
CHM1_1	1	161,146,109 - 161,147,683 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	158,917,974 - 158,919,555 (+)	NCBI		T2T-CHM13v2.0

Dusp23
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	87,630,245 - 87,632,400 (-)	NCBI		GRCr8
mRatBN7.2	13	85,097,899 - 85,100,054 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	85,097,899 - 85,100,093 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	87,602,026 - 87,603,219 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	89,002,297 - 89,003,490 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	86,187,031 - 86,188,224 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	91,018,670 - 91,019,862 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	91,018,510 - 91,020,112 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	95,537,373 - 95,538,565 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	88,637,671 - 88,638,863 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	88,826,435 - 88,827,841 (-)	NCBI
Celera	13	84,707,861 - 84,708,048 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

Dusp23
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	11,579,817 - 11,581,174 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	11,579,624 - 11,581,975 (+)	NCBI	ChiLan1.0	ChiLan1.0

DUSP23
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	90,071,900 - 90,073,604 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	89,811,935 - 89,813,618 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	135,132,451 - 135,134,101 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	139,053,238 - 139,054,865 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	139,053,238 - 139,054,865 (+)	Ensembl	panpan1.1		panPan2

DUSP23
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	22,341,052 - 22,344,861 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	22,417,809 - 22,423,310 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	22,463,300 - 22,469,314 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	22,462,976 - 22,469,317 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	22,235,838 - 22,236,110 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	22,762,744 - 22,768,279 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	23,173,732 - 23,179,864 (-)	NCBI		UU_Cfam_GSD_1.0

Dusp23
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408299	257 - 1,735 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004943943	31 - 1,797 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DUSP23
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	90,720,696 - 90,721,946 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	90,720,655 - 90,722,675 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	98,692,567 - 98,695,616 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DUSP23
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	4,169,422 - 4,171,092 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	4,169,418 - 4,170,947 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	3,274,497 - 3,276,202 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dusp23
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	1,467,692 - 1,469,857 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	1,462,782 - 1,469,881 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	354
Count of miRNA genes:	248
Interacting mature miRNAs:	275
Transcripts:	ENSMUST00000027826
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301523	Ccrs1_m	corpus callosum hemisphere surface size 1 (mouse)			Not determined		1	139602037	173602216	Mouse
1558802	Skmw6_m	skeletal muscle weight 6 (mouse)			Not determined		1	167954584	195154279	Mouse
10412185	Hcs9_m	hepatocarcinogenesis susceptibility 9 (mouse)			Not determined		1	63854690	189303617	Mouse
12790987	Tgl5_m	triglyceride 5 (mouse)					1	160097157	194097157	Mouse
4141878	Qrr1_m	QTL rich region on chromosome 1 (mouse)			Not determined			170878743	175320066	Mouse
1357854	Sle16_m	systematic lupus erythematosus susceptibility 16 (mouse)			Not determined		1	169038741	177377587	Mouse
4142389	Scfr1_m	stem cell frequency regulator 1 (mouse)			Not determined			171632048	189303617	Mouse
13824984	Twq5_m	testis weight QTL 5 (mouse)					1	3069992	184732197	Mouse
1301016	Szs1_m	seizure susceptibility 1 (mouse)			Not determined		1	170878743	174456436	Mouse
12790984	Pcho7_m	plasma cholesterol 7 (mouse)					1	147219390	181219390	Mouse
12790988	Phdlc5_m	plasma HDL cholesterol 5 (mouse)					9	160097157	194097157	Mouse
1301251	Scc3_m	colon tumor susceptibility 3 (mouse)			Not determined		1	168213823	195154279	Mouse
1300740	Tne1_m	total number errors (mouse)			Not determined		1	139602037	173602216	Mouse
12790996	Aath2_m	aortic arch atherosclerosis 2 (mouse)					1	145077630	179077630	Mouse
1300745	Gvhd1_m	graft-versus-host disease 1 (mouse)			Not determined		1	157456299	191456436	Mouse
12791001	Aath6_m	aortic arch atherosclerosis 6 (mouse)					1	147219390	181219390	Mouse
10412162	Nobq3_m	New Zealand obese QTL 3 (mouse)			Not determined		1	103933405	191225397	Mouse
4141346	Skmw12_m	skeletal muscle weight 12 (mouse)			Not determined			150756737	184756922	Mouse
1357618	Splq5_m	spleen weight QTL 5 (mouse)			Not determined		1	150193673	188359312	Mouse
1301301	Sle1_m	systemic lupus erythmatosus susceptibility 1 (mouse)			Not determined		1	152038741	186038913	Mouse
12904936	Edlmmq1_m	extensor digitorum longus muscle mass QTL 1 (mouse)					1	155002940	189002940	Mouse
1301565	Mnotch_m	modifier of Notch (mouse)			Not determined		1	157456299	191456436	Mouse
1301309	Emo1_m	emotionality 1 (mouse)			Not determined		1	162977097	185994196	Mouse
1301025	Lbw7_m	lupus NZB x NZW 7 (mouse)			Not determined		1	152038741	186038913	Mouse
10412205	Bbaa30_m	B.burgdorferi-associated arthritis 30 (mouse)			Not determined		1	169038741	174456436	Mouse
12904944	Tammq1_m	tibialis anterior muscle mass QTL 1 (mouse)					1	155002940	189002940	Mouse
1357602	Vtbt2_m	vertebral trabecular bone trait 2 (mouse)			Not determined		1	139602037	173602216	Mouse
12904957	Gmmq1_m	gastrocnemius muscle mass QTL 1 (mouse)					1	155002940	189002940	Mouse
1300777	Chol10_m	cholesterol 10 (mouse)			Not determined		9	147875502	181875616	Mouse
1302098	Eila1_m	ethanol induced locomotor activity 1 (mouse)			Not determined		1	112008822	175468938	Mouse
1300823	Ath9_m	atherosclerosis 9 (mouse)			Not determined		1	160112768	194112883	Mouse
1301333	Mop3_m	morphine preference 3 (mouse)			Not determined		1	167756737	189303617	Mouse
1300571	Opfa_m	open field activity (mouse)			Not determined		1	144531347	178531592	Mouse
1301339	Hdlq15_m	HDL QTL 15 (mouse)			Not determined		1	165873675	195154279	Mouse
10043863	Swrl5_m	SWR lupus locus 5 (mouse)			Not determined		1	172303451	195154279	Mouse
1301596	Elnt_m	escape latencies during navigation task (mouse)			Not determined		1	162145207	194111528	Mouse
4141165	Bglu3_m	blood glucose level 3 (mouse)			Not determined			155831765	189831892	Mouse
12792983	Liq1_m	limb inflammation QTL 1 (mouse)					1	167586086	191225397	Mouse
1357889	Lprq3_m	lipoprotein QTL 3 (mouse)			Not determined		1	152038741	186038913	Mouse
4141160	Cq1_m	cholesterol QTL 1 (mouse)			Not determined		1	139452188	173452308	Mouse
4142182	Shali5_m	survival time to hyperoxic acute lung injury 5 (mouse)			Not determined			155582237	185994196	Mouse
10402498	Lmr20_m	leishmaniasis resistance 20 (mouse)			Not determined		1	158468817	192468938	Mouse
1301619	Cafq1_m	caffeine metabolism QTL 1 (mouse)			Not determined		1	155716221	189716369	Mouse
4141149	Hbnr4_m	Heligmosomoides bakeri nematode resistance 4 (mouse)			Not determined			147125258	188983224	Mouse
10043899	Hdlq99_m	HDL QTL 99 (mouse)			Not determined		1	147875502	181875616	Mouse
11537365	Cnes4_m	C. neoformans susceptibility locus 4 (mouse)					1	144449142	178449142	Mouse
11081167	Tir8_m	trypanosome infection response 8 (mouse)					1	155716221	189716369	Mouse
1302132	Pbw1_m	pentobarbital withdrawal QTL 1 (mouse)			Not determined		1	155831765	189831892	Mouse
4142417	Emrq1_m	emotional reactivity QTL 1 (mouse)			Not determined			171632048	172716369	Mouse
4142159	Nba2_m	New Zealand Black autoimmunity 2 (mouse)			Not determined			151835111	185835280	Mouse
1301602	Bslm4_m	basal locomotor activity 4 (mouse)			Not determined		1	157456299	191456436	Mouse
1301866	Cplaq3_m	circadian period of locomotor activity 3 (mouse)			Not determined		1	155721528	189722608	Mouse
1300842	Sle9_m	systematic lupus erythematosus susceptibility 9 (mouse)			Not determined		1	158468817	192468938	Mouse
4142149	Ctex_m	Ctla4 expression QTL (mouse)			Not determined		1	153557406	175468938	Mouse
1301614	Cgnz1_m	chronic glomerulonephritis in NZM 1 (mouse)			Not determined		1	152038741	186038913	Mouse
12910521	Scgq1_m	spontaneous crescentic glomerulonephritis QTL 1 (mouse)					1	156602037	176262693	Mouse
11039528	Ccc3_m	colitis susceptibility in the Collaborative Cross 3 (mouse)					1	3680142	195051546	Mouse
4142014	Wbcq5_m	white blood cell quantitative locus 5 (mouse)			Not determined		1	141095010	175095156	Mouse
4141245	Cq2_m	cholesterol QTL 2 (mouse)			Not determined		1	157456299	191456436	Mouse
4141244	Bmd5c_m	bone mineral density 5c (mouse)			Not determined			155526796	189526897	Mouse
1301652	Cpfd2_m	cerebellum pattern fissures (mouse)			Not determined		1	172303451	195154279	Mouse
13464138	Hdlq107_m	HDL QTL 107 (mouse)					1	152132744	186132744	Mouse
38456000	Lick2_m	lick rate 2, sucralose (mouse)					1	170397438	173397435	Mouse
1300888	Berr1_m	berghei resistance locus 1 (mouse)			Not determined		1	164143227	190534272	Mouse
38456001	Lick1_m	lick rate 1, water (mouse)					1	170397438	173397435	Mouse
1301151	Hdlq14_m	HDL QTL 14 (mouse)			Not determined		1	142489543	176489734	Mouse
4141233	Femwf12_m	femur work to failure 12 (mouse)			Not determined			141233173	175233272	Mouse
1301122	Cd8mts1_m	CD8 T memory cell subset 1 (mouse)			Not determined		1	155831765	189831892	Mouse
1301632	Bw8q1_m	body weight at 8 weeks QTL 1 (mouse)			Not determined		1	161201261	195154279	Mouse
4141483	Femwf7_m	femur work to failure 7 (mouse)			Not determined			167462514	195154279	Mouse
1301894	Skull2_m	skull morphology 2 (mouse)			Not determined		1	139602037	173602216	Mouse
1301385	Radpf2_m	radiation pulmonary fibrosis 2 (mouse)			Not determined		1	147125258	182873798	Mouse
1302158	Fembrs5_m	femur breaking strength 5 (mouse)			Not determined		1	167462514	195154279	Mouse
1301134	Bmd1_m	bone mineral density 1 (mouse)			Not determined		1	156602037	189303617	Mouse
1301132	Mors1_m	modifier of obesity related sterility 1 (mouse)			Not determined		1	170379500	195154279	Mouse
1357493	Lgaq3_m	late growth adjusted QTL 3 (mouse)			Not determined		1	150193673	188359312	Mouse
11251722	Ewc1_m	ethanol withdrawal and consumption 1 (mouse)					1	152132744	186132744	Mouse
1302193	Cpfd1_m	cerebellum pattern fissures (mouse)			Not determined		1	139602037	173602216	Mouse
10043963	Obq25_m	obesity QTL 25 (mouse)			Not determined		1	154410512	188410512	Mouse
1301431	Pcho1_m	plasma cholesterol 1 (mouse)			Not determined		1	159262573	193262693	Mouse
1357732	Tbbmd1_m	total body bone mineral density 1 (mouse)			Not determined		1	171983110	195154279	Mouse
10412074	Nhdlt1_m	non-HDL cholesterol and triglyceride levels 1 (mouse)			Not determined		1	153675990	187676105	Mouse
1357485	Lgq4_m	late growth QTL 4 (mouse)			Not determined		1	150193673	188359312	Mouse
1301932	Ssta2_m	susceptibility to Salmonella typhimurium antigens 2 (mouse)			Not determined		1	155716221	189716369	Mouse
11049576	Lmr8a_m	leishmaniasis resistance 8a (mouse)					1	139602037	173602216	Mouse
1301202	Yaa4_m	Y-linked autoimmune acceleration 4 (mouse)			Not determined		1	158468817	192468938	Mouse
10054490	Opefa_m	open field activity (mouse)			Not determined		1	153712853	187712853	Mouse
1300948	Fglu2_m	fasting glucose 2 (mouse)			Not determined		1	157456299	191456436	Mouse
1301467	Pcir1_m	periosteal circumference 1 (mouse)			Not determined		1	141233173	175233272	Mouse
1301722	Cia9_m	collagen induced arthritis QTL 9 (mouse)			Not determined		1	45783900	189303617	Mouse
1300696	Bpq2_m	blood pressure QTL 2 (mouse)			Not determined		1	139602037	173602216	Mouse
11059556	Lmr20b_m	leishmaniasis resistance 20b (mouse)					1	158468817	192468938	Mouse
4141554	Cfmq1_m	cystic fibrosis modifier QTL 1 (mouse)			Not determined		1	152038741	186038913	Mouse
11059557	Lmr20a_m	leishmaniasis resistance 20a (mouse)					1	158468817	192468938	Mouse
11059558	Lmr20c_m	leishmaniasis resistance 20c (mouse)					1	158468817	192468938	Mouse
11049575	Lmr8b_m	leishmaniasis resistance 8b (mouse)					1	172303451	195154279	Mouse
1301191	Stia1_m	serum transfer induced arthritis 1 (mouse)			Not determined		1	141233173	175233272	Mouse
1300934	Cfbw1_m	cystic fibrosis body weight 1 (mouse)			Not determined		1	145145207	179145325	Mouse
1301189	Lmr8_m	leishmaniasis resistance 8 (mouse)			Not determined		1	156602037	189303617	Mouse
1558720	Bpq8_m	blood pressure QTL 8 (mouse)			Not determined		1	143284665	177284803	Mouse
13207571	Tcq11_m	total cholesterol QTL 11 (mouse)					1	169137569	179647565	Mouse
10766456	Sle21_m	systematic lupus erythematosus susceptibility 21 (mouse)					1	155831765	189831892	Mouse
1301710	Bmd5_m	bone mineral density 5 (mouse)			Not determined		1	139602037	173602216	Mouse
27095935	Ulnl5_m	ulna length 5, 10 week (mouse)					1	128727737	181327565	Mouse
1300727	Mptp1_m	MPTP sensitivity 1 (mouse)			Not determined		1	171632048	192681050	Mouse
10054271	Nba9_m	New Zealand Black autoimmunity 9 (mouse)			Not determined		1	155525623	189527533	Mouse
1559024	Zit1_m	zinc induced tolerance 1 (mouse)			Not determined		1	167462514	195154279	Mouse
10054270	Nba10_m	New Zealand Black autoimmunity 10 (mouse)			Not determined		1	152794822	186438620	Mouse
13207587	Mwmlpt1_m	Morris water maze latency to platform, training, 1 (mouse)					1	169597438	173397435	Mouse
4142291	Aec2_m	autoimmune exocrinopathy 2 (mouse)			Not determined			52457737	182250592	Mouse
13207591	Mwmlpa1_m	Morris water maze latency to platform, all, 1 (mouse)					1	169797438	173297435	Mouse
1300732	Melm2_m	melanoma modifier 2 (mouse)			Not determined		1	157456299	191456436	Mouse
1301216	Cbm1_m	cerebellum weight 1 (mouse)			Not determined		1	157456299	191456436	Mouse
11533913	Rd6m1_m	retinal degeneration 6 modifier 1 (mouse)					1	141233173	175233272	Mouse
27095915	Scvln13_m	sacral vertebrae length 2, 16 week (mouse)					1	117527730	179827565	Mouse
1300969	Sluc5_m	susceptibility to lung cancer 5 (mouse)			Not determined		1	151186243	185186402	Mouse
26884448	Sklq1_m	skull length QTL 1, 5 week (mouse)					1	75976637	181327565	Mouse

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_026725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA048085	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB183013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC131177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK004912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466520	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000027826 ⟹ ENSMUSP00000027826

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	1	172,458,331 - 172,460,529 (-)	Ensembl
GRCm38.p6 Ensembl	1	172,630,764 - 172,632,962 (-)	Ensembl

RefSeq Acc Id:

NM_026725 ⟹ NP_081001

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	1	172,458,336 - 172,460,504 (-)	NCBI
GRCm38	1	172,630,769 - 172,632,974 (-)	ENTREZGENE
MGSCv37	1	174,560,900 - 174,563,105 (-)	RGD
Celera	1	175,487,228 - 175,489,448 (-)	RGD
cM Map	1		ENTREZGENE

Sequence:

show sequence

GCGGGGACGGAATCCAGCCCCAGAGGGGGGGTGACCCAATCTCCCGGCAGAGTAGGAAAGGCCA
GCCTCGCCCTGAGTAAACTCCCCCCACGATGGGCGTGCAACCCCCCAACTTCTCCTGGGTGCTT
CCGGGACGGCTGGCCGGACTGGCGTTGCCCCGGCTGCCCGCGCACTACCAGTTCCTGCTGGACC
AGGGTGTGCGGCACCTGGTGTCCCTGACGGAGCGCGGACCCCCTCACAGTGACAGCTGTCCCGG
CCTCACGCTGCACCGAATGCGCATCCCTGACTTTTGCCCGCCGTCCCCGGAACAGATCGACCAA
TTTGTGAAGATCGTGGACGAGGCCAATGCCCGGGGAGAGGCTGTTGGAGTGCACTGTGCCCTAG
GCTTTGGCCGCACTGGCACCATGCTAGCCTGCTACTTGGTGAAGGAGCGGGCTTTGGCCGCAGG
AGATGCCATTGCTGAGATCCGGCGCCTGCGACCAGGATCCATTGAGACGTATGAACAGGAGAAG
GCCGTCTTCCAGTTCTACCAGCGAACAAAATGAGGACTTCAACAGCCCGCCTTTCCCCCTCCCC
AACTCCTGCGGCCAGGGAGGAAGGGGAGTGAACTAAAGTACTGCATCCTTCAGGTCCCTCTGAC
TCCTATTGGACAAAAGTAGTCCTTCCCCAAAGCCATAACGTGGCCGGCAGGATGGCCGAGACCC
CACAAAAATGAGGTAATAACTGATAAGAACTCATCACCGCTGCATAGCATGTACACAGCACTCC
CAATACATCTGGGTGGTTGAAAAGACAAAAAAAAAAAAAACAAAAAAAAAAAAAAAAAAACCAC
TTCTGTTCTTTGGATGAGGTGTCTAGAGTTCAGAAAGGCCTCCGGTCACAGTTCTGGGAAACAG
AAGGATAGGCCAGGACTCCAGCACACACCTTTGTCATCCTGAGGATGATGGGATTCTAAGTGCT
GTTCCCTGACATGTGATAGAGGAGAACTGGTCAGTGAAGGAGACCCATGTCCCTGGCCACATGG
CCTCCAAGCAGCCTCAGGCCGCTGCACTCCTACACCAGCAGTGCCCCCTTGACATCACCCCTTA
TGTAGGGTCATCCGTCCTACCTGAGCCACCTTTGTTCTCTCAGGGTACAGAAGACCTGCATATC
GTGCTACAGATGAGGTCTCTCTCTGTCTTATCTGTTTCTCTCTTGGTCTCCCCCTCCCACTCTC
CCTCTTAATCTCCCTCTCTCCCTCCCCCTTCCTCCCCCCACCAGGGCTGGCCACCTCTTACCAG
CCTCAGGTGACTCAGCTCATCTGTCACCTCCAACCCCTATGTCGTCCCCAGCCTCAGACCAACG
AATGCTGAAACTGTGTCTTGGTGGTTTTAGAGTGGATATTAAGTGATCAAATAAATAACTCTGG
GACTATGAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_081001	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH69187	(Get FASTA)	NCBI Sequence Viewer
	BAB23663	(Get FASTA)	NCBI Sequence Viewer
	BAD26711	(Get FASTA)	NCBI Sequence Viewer
	EDL39004	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000027826
	ENSMUSP00000027826.6
GenBank Protein	Q6NT99	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_081001 ⟸ NM_026725
- UniProtKB:	Q9CW48 (UniProtKB/Swiss-Prot), Q6NT99 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDQGVRHLVSLTERGPPHSDSCPGLTLHRMRIP DFCPPSPEQIDQFVKIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERALAAGDAIAEIRRL RPGSIETYEQEKAVFQFYQRTK hide sequence

Ensembl Acc Id:

ENSMUSP00000027826 ⟸ ENSMUST00000027826

Protein Domains

Tyrosine-protein phosphatase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6NT99-F1-model_v2	AlphaFold	Q6NT99	1-150	view protein structure

Promoters

RGD ID:

6875780

Promoter ID:

EPDNEW_M1341

Type:

initiation region

Name:

Dusp23_1

Description:

Mus musculus dual specificity phosphatase 23 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	1	172,632,937 - 172,632,997	EPDNEW

RGD ID:

6817627

Promoter ID:

MM_KWN:2934

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

NM_026725

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	1	174,562,736 - 174,563,236 (-)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1915690	AgrOrtholog
Ensembl Genes	ENSMUSG00000026544	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000027826	ENTREZGENE
	ENSMUST00000027826.7	UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.190.10	UniProtKB/Swiss-Prot
InterPro	Prot-tyrosine_phosphatase-like	UniProtKB/Swiss-Prot
	PTP	UniProtKB/Swiss-Prot
	Tyr_Pase_AS	UniProtKB/Swiss-Prot
	Tyr_Pase_cat	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_dom	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_DUAL_dom	UniProtKB/Swiss-Prot
KEGG Report	mmu:68440	UniProtKB/Swiss-Prot
MGD	MGI:1915690	ENTREZGENE
NCBI Gene	68440	ENTREZGENE
PANTHER	CYCLIN-DEPENDENT KINASE INHIBITOR 3-RELATED	UniProtKB/Swiss-Prot
	TYROSINE SPECIFIC PROTEIN PHOSPHATASE AND DUAL SPECIFICITY PROTEIN PHOSPHATASE	UniProtKB/Swiss-Prot
Pfam	PTP-SAK	UniProtKB/Swiss-Prot
PhenoGen	Dusp23	PhenoGen
PROSITE	TYR_PHOSPHATASE_1	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_2	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_DUAL	UniProtKB/Swiss-Prot
SMART	DSPc	UniProtKB/Swiss-Prot
	PTPc_motif	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52799	UniProtKB/Swiss-Prot
UniProt	DUS23_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9CW48	ENTREZGENE
UniProt Secondary	Q9CW48	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar