Symbol:
Dusp23
Name:
dual specificity phosphatase 23
RGD ID:
1319413
MGI Page
MGI
Description:
Predicted to enable protein tyrosine phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. Predicted to be involved in cilium assembly and dephosphorylation. Predicted to be located in nucleoplasm. Predicted to be active in cytoplasm. Orthologous to human DUSP23 (dual specificity phosphatase 23).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1300005N15Rik; dual specificity protein phosphatase 23; Ldp; LDP-3; low molecular mass dual specificity phosphatase 3; low-molecular-mass dual-specificity phosphatase; MGC73633
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DUSP23 (dual specificity phosphatase 23) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Dusp23 (dual specificity phosphatase 23) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dusp23 (dual specificity phosphatase 23) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DUSP23 (dual specificity phosphatase 23) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DUSP23 (dual specificity phosphatase 23) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dusp23 (dual specificity phosphatase 23) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DUSP23 (dual specificity phosphatase 23) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DUSP23 (dual specificity phosphatase 23) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dusp23 (dual specificity phosphatase 23) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Dusp23 (dual specificity phosphatase 23)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
DUSP23 (dual specificity phosphatase 23)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dusp23a (dual specificity phosphatase 23a)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Danio rerio (zebrafish):
dusp23b (dual specificity phosphatase 23b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
dusp23
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 172,458,336 - 172,460,504 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 172,458,331 - 172,460,529 (-) Ensembl GRCm39 Ensembl GRCm38 1 172,630,769 - 172,632,974 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 172,630,764 - 172,632,962 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 174,560,900 - 174,563,105 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 174,468,045 - 174,469,637 (-) NCBI MGSCv36 mm8 Celera 1 175,487,228 - 175,489,448 (-) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 80.05 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dusp23 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of DUSP23 mRNA CTD PMID:22206623 Dusp23 Mouse 1,3-dinitrobenzene decreases expression ISO Dusp23 (Rattus norvegicus) 6480464 3-dinitrobenzene results in decreased expression of DUSP23 protein CTD PMID:24140754 Dusp23 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DUSP23 mRNA CTD PMID:21570461 Dusp23 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Dusp23 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DUSP23 mRNA CTD PMID:32109520 Dusp23 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Dusp23 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Dusp23 Mouse 4-nitrophenyl phosphate decreases phosphorylation ISO DUSP23 (Homo sapiens) 6480464 DUSP23 protein results in decreased phosphorylation of nitrophenylphosphate CTD PMID:15147733 Dusp23 Mouse 4-nitrophenyl phosphate multiple interactions ISO DUSP23 (Homo sapiens) 6480464 Edetic Acid inhibits the reaction [DUSP23 protein results in decreased phosphorylation of nitrophenylphosphate] more ... CTD PMID:15147733 Dusp23 Mouse actinomycin D multiple interactions ISO DUSP23 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of DUSP23 protein CTD PMID:38460933 Dusp23 Mouse benzo[a]pyrene decreases expression ISO DUSP23 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of DUSP23 mRNA CTD PMID:20106945 Dusp23 Mouse bisphenol A decreases expression ISO Dusp23 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of DUSP23 mRNA CTD PMID:25181051 Dusp23 Mouse bisphenol A increases expression ISO Dusp23 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of DUSP23 mRNA CTD PMID:30816183 and PMID:32528016 Dusp23 Mouse bisphenol A decreases expression ISO DUSP23 (Homo sapiens) 6480464 bisphenol A results in decreased expression of DUSP23 mRNA CTD PMID:38568856 Dusp23 Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of DUSP23 mRNA CTD PMID:38685157 Dusp23 Mouse carbon nanotube increases expression ISO DUSP23 (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of DUSP23 mRNA CTD PMID:28673683 Dusp23 Mouse CGP 52608 multiple interactions ISO DUSP23 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DUSP23 gene] CTD PMID:28238834 Dusp23 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of DUSP23 mRNA CTD PMID:37019170 Dusp23 Mouse chromium(6+) multiple interactions ISO DUSP23 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of DUSP23 mRNA CTD PMID:38479592 Dusp23 Mouse cisplatin multiple interactions ISO DUSP23 (Homo sapiens) 6480464 [Cisplatin co-treated with panobinostat] affects the expression of DUSP23 mRNA CTD PMID:21791302 Dusp23 Mouse cisplatin decreases expression ISO DUSP23 (Homo sapiens) 6480464 Cisplatin results in decreased expression of DUSP23 mRNA CTD PMID:27392435 Dusp23 Mouse cobalt dichloride decreases expression ISO DUSP23 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of DUSP23 mRNA CTD PMID:19320972 Dusp23 Mouse Dibutyl phosphate affects expression ISO DUSP23 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of DUSP23 mRNA CTD PMID:37042841 Dusp23 Mouse dorsomorphin multiple interactions ISO DUSP23 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DUSP23 mRNA CTD PMID:27188386 Dusp23 Mouse endosulfan increases expression ISO Dusp23 (Rattus norvegicus) 6480464 Endosulfan results in increased expression of DUSP23 mRNA CTD PMID:29391264 Dusp23 Mouse entinostat increases expression ISO DUSP23 (Homo sapiens) 6480464 entinostat results in increased expression of DUSP23 mRNA CTD PMID:27188386 Dusp23 Mouse ethylenediaminetetraacetic acid multiple interactions ISO DUSP23 (Homo sapiens) 6480464 Edetic Acid inhibits the reaction [DUSP23 protein results in decreased phosphorylation of nitrophenylphosphate] CTD PMID:15147733 Dusp23 Mouse fenthion increases expression EXP 6480464 Fenthion results in increased expression of DUSP23 mRNA CTD PMID:34813904 Dusp23 Mouse genistein decreases expression EXP 6480464 Genistein results in decreased expression of DUSP23 mRNA CTD PMID:32186404 Dusp23 Mouse GSK-J4 decreases expression ISO DUSP23 (Homo sapiens) 6480464 GSK-J4 results in decreased expression of DUSP23 mRNA CTD PMID:29301935 Dusp23 Mouse lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of DUSP23 mRNA CTD PMID:21829687 Dusp23 Mouse lead diacetate decreases expression ISO DUSP23 (Homo sapiens) 6480464 lead acetate results in decreased expression of DUSP23 mRNA CTD PMID:38568856 Dusp23 Mouse medroxyprogesterone acetate increases expression ISO DUSP23 (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in increased expression of DUSP23 mRNA CTD PMID:20843944 Dusp23 Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of DUSP23 mRNA CTD PMID:34813904 Dusp23 Mouse methoxychlor affects methylation ISO Dusp23 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of DUSP23 gene CTD PMID:35440735 Dusp23 Mouse methylparaben decreases expression ISO DUSP23 (Homo sapiens) 6480464 methylparaben results in decreased expression of DUSP23 mRNA CTD PMID:38568856 Dusp23 Mouse N-ethylmaleimide multiple interactions ISO DUSP23 (Homo sapiens) 6480464 Ethylmaleimide inhibits the reaction [DUSP23 protein results in decreased phosphorylation of nitrophenylphosphate] CTD PMID:15147733 Dusp23 Mouse nickel sulfate decreases expression ISO DUSP23 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of DUSP23 mRNA CTD PMID:22714537 Dusp23 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of DUSP23 mRNA CTD PMID:35964746 Dusp23 Mouse Nutlin-3 multiple interactions ISO DUSP23 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of DUSP23 protein CTD PMID:38460933 Dusp23 Mouse okadaic acid decreases expression ISO DUSP23 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of DUSP23 mRNA CTD PMID:38832940 Dusp23 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of DUSP23 mRNA CTD PMID:34911549 Dusp23 Mouse panobinostat multiple interactions ISO DUSP23 (Homo sapiens) 6480464 [Cisplatin co-treated with panobinostat] affects the expression of DUSP23 mRNA CTD PMID:21791302 Dusp23 Mouse SB 431542 multiple interactions ISO DUSP23 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DUSP23 mRNA CTD PMID:27188386 Dusp23 Mouse silver atom affects expression EXP 6480464 Silver affects the expression of DUSP23 mRNA CTD PMID:27131904 Dusp23 Mouse silver(0) affects expression EXP 6480464 Silver affects the expression of DUSP23 mRNA CTD PMID:27131904 Dusp23 Mouse sodium arsenate decreases expression EXP 6480464 sodium arsenate results in decreased expression of DUSP23 mRNA CTD PMID:21795629 Dusp23 Mouse sodium arsenite decreases expression ISO DUSP23 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DUSP23 mRNA CTD PMID:38568856 Dusp23 Mouse sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of DUSP23 mRNA CTD PMID:21340527 Dusp23 Mouse sunitinib decreases expression ISO DUSP23 (Homo sapiens) 6480464 Sunitinib results in decreased expression of DUSP23 mRNA CTD PMID:31533062 Dusp23 Mouse temozolomide decreases expression ISO DUSP23 (Homo sapiens) 6480464 Temozolomide results in decreased expression of DUSP23 mRNA CTD PMID:31758290 Dusp23 Mouse testosterone multiple interactions EXP 6480464 1 more ... CTD PMID:33848595 Dusp23 Mouse testosterone decreases expression EXP 6480464 Testosterone deficiency results in decreased expression of DUSP23 mRNA CTD PMID:33848595 Dusp23 Mouse tetrachloromethane decreases expression ISO Dusp23 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of DUSP23 mRNA CTD PMID:33387578 Dusp23 Mouse thioacetamide decreases expression ISO Dusp23 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of DUSP23 mRNA CTD PMID:34492290 Dusp23 Mouse thiram decreases expression ISO DUSP23 (Homo sapiens) 6480464 Thiram results in decreased expression of DUSP23 mRNA CTD PMID:38568856 Dusp23 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of DUSP23 promoter CTD PMID:35295148 Dusp23 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of DUSP23 gene CTD PMID:35295148 Dusp23 Mouse trichloroethene increases expression ISO Dusp23 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of DUSP23 mRNA CTD PMID:33387578 Dusp23 Mouse triphenyl phosphate affects expression ISO DUSP23 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DUSP23 mRNA CTD PMID:37042841 Dusp23 Mouse tunicamycin decreases expression ISO DUSP23 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of DUSP23 mRNA CTD PMID:22378314 Dusp23 Mouse valproic acid affects expression ISO DUSP23 (Homo sapiens) 6480464 Valproic Acid affects the expression of DUSP23 mRNA CTD PMID:25979313 Dusp23 Mouse valproic acid multiple interactions ISO DUSP23 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DUSP23 mRNA CTD PMID:27188386 Dusp23 Mouse valproic acid increases expression ISO DUSP23 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DUSP23 mRNA CTD PMID:23179753 more ...
1,2-dimethylhydrazine (EXP) 1,3-dinitrobenzene (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 4-nitrophenyl phosphate (ISO) actinomycin D (ISO) benzo[a]pyrene (ISO) bisphenol A (ISO) bisphenol F (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) Dibutyl phosphate (ISO) dorsomorphin (ISO) endosulfan (ISO) entinostat (ISO) ethylenediaminetetraacetic acid (ISO) fenthion (EXP) genistein (EXP) GSK-J4 (ISO) lead diacetate (EXP,ISO) medroxyprogesterone acetate (ISO) methidathion (EXP) methoxychlor (ISO) methylparaben (ISO) N-ethylmaleimide (ISO) nickel sulfate (ISO) nitrates (EXP) Nutlin-3 (ISO) okadaic acid (ISO) ozone (EXP) panobinostat (ISO) SB 431542 (ISO) silver atom (EXP) silver(0) (EXP) sodium arsenate (EXP) sodium arsenite (ISO) sodium fluoride (EXP) sunitinib (ISO) temozolomide (ISO) testosterone (EXP) tetrachloromethane (ISO) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) valproic acid (ISO)
Dusp23 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 172,458,336 - 172,460,504 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 172,458,331 - 172,460,529 (-) Ensembl GRCm39 Ensembl GRCm38 1 172,630,769 - 172,632,974 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 172,630,764 - 172,632,962 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 174,560,900 - 174,563,105 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 174,468,045 - 174,469,637 (-) NCBI MGSCv36 mm8 Celera 1 175,487,228 - 175,489,448 (-) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 80.05 NCBI
DUSP23 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 159,780,962 - 159,782,543 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 159,780,932 - 159,782,543 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 159,750,752 - 159,752,333 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 158,017,383 - 158,018,957 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 156,563,831 - 156,565,406 NCBI Celera 1 132,819,186 - 132,820,760 (+) NCBI Celera Cytogenetic Map 1 q23.2 NCBI HuRef 1 131,107,191 - 131,108,765 (+) NCBI HuRef CHM1_1 1 161,146,109 - 161,147,683 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 158,917,974 - 158,919,555 (+) NCBI T2T-CHM13v2.0
Dusp23 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 87,630,245 - 87,632,400 (-) NCBI GRCr8 mRatBN7.2 13 85,097,899 - 85,100,054 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 85,097,899 - 85,100,093 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 87,602,026 - 87,603,219 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 89,002,297 - 89,003,490 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 86,187,031 - 86,188,224 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 91,018,670 - 91,019,862 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 91,018,510 - 91,020,112 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 95,537,373 - 95,538,565 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 88,637,671 - 88,638,863 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 88,826,435 - 88,827,841 (-) NCBI Celera 13 84,707,861 - 84,708,048 (-) NCBI Celera Cytogenetic Map 13 q24 NCBI
Dusp23 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 11,579,817 - 11,581,174 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 11,579,624 - 11,581,975 (+) NCBI ChiLan1.0 ChiLan1.0
DUSP23 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 90,071,900 - 90,073,604 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 89,811,935 - 89,813,618 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 135,132,451 - 135,134,101 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 139,053,238 - 139,054,865 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 139,053,238 - 139,054,865 (+) Ensembl panpan1.1 panPan2
DUSP23 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 22,341,052 - 22,344,861 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 22,417,809 - 22,423,310 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 22,463,300 - 22,469,314 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 22,462,976 - 22,469,317 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 22,235,838 - 22,236,110 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 22,762,744 - 22,768,279 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 23,173,732 - 23,179,864 (-) NCBI UU_Cfam_GSD_1.0
Dusp23
DUSP23 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 90,720,696 - 90,721,946 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 90,720,655 - 90,722,675 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 98,692,567 - 98,695,616 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DUSP23 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 4,169,422 - 4,171,092 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 4,169,418 - 4,170,947 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 3,274,497 - 3,276,202 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dusp23
.
Predicted Target Of
Count of predictions: 354 Count of miRNA genes: 248 Interacting mature miRNAs: 275 Transcripts: ENSMUST00000027826 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301523 Ccrs1_m corpus callosum hemisphere surface size 1 (mouse) Not determined 1 139602037 173602216 Mouse 1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 4141878 Qrr1_m QTL rich region on chromosome 1 (mouse) Not determined 170878743 175320066 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 1357854 Sle16_m systematic lupus erythematosus susceptibility 16 (mouse) Not determined 1 169038741 177377587 Mouse 4142389 Scfr1_m stem cell frequency regulator 1 (mouse) Not determined 171632048 189303617 Mouse 12790984 Pcho7_m plasma cholesterol 7 (mouse) 1 147219390 181219390 Mouse 1301016 Szs1_m seizure susceptibility 1 (mouse) Not determined 1 170878743 174456436 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 1300740 Tne1_m total number errors (mouse) Not determined 1 139602037 173602216 Mouse 12790996 Aath2_m aortic arch atherosclerosis 2 (mouse) 1 145077630 179077630 Mouse 12791001 Aath6_m aortic arch atherosclerosis 6 (mouse) 1 147219390 181219390 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 4141346 Skmw12_m skeletal muscle weight 12 (mouse) Not determined 150756737 184756922 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1301309 Emo1_m emotionality 1 (mouse) Not determined 1 162977097 185994196 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 10412205 Bbaa30_m B.burgdorferi-associated arthritis 30 (mouse) Not determined 1 169038741 174456436 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1357602 Vtbt2_m vertebral trabecular bone trait 2 (mouse) Not determined 1 139602037 173602216 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1300777 Chol10_m cholesterol 10 (mouse) Not determined 9 147875502 181875616 Mouse 1302098 Eila1_m ethanol induced locomotor activity 1 (mouse) Not determined 1 112008822 175468938 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1301333 Mop3_m morphine preference 3 (mouse) Not determined 1 167756737 189303617 Mouse 1300571 Opfa_m open field activity (mouse) Not determined 1 144531347 178531592 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 12792983 Liq1_m limb inflammation QTL 1 (mouse) 1 167586086 191225397 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 4141160 Cq1_m cholesterol QTL 1 (mouse) Not determined 1 139452188 173452308 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 10043899 Hdlq99_m HDL QTL 99 (mouse) Not determined 1 147875502 181875616 Mouse 11537365 Cnes4_m C. neoformans susceptibility locus 4 (mouse) 1 144449142 178449142 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 4142417 Emrq1_m emotional reactivity QTL 1 (mouse) Not determined 171632048 172716369 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 4142149 Ctex_m Ctla4 expression QTL (mouse) Not determined 1 153557406 175468938 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse 12910521 Scgq1_m spontaneous crescentic glomerulonephritis QTL 1 (mouse) 1 156602037 176262693 Mouse 11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4142014 Wbcq5_m white blood cell quantitative locus 5 (mouse) Not determined 1 141095010 175095156 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 38456000 Lick2_m lick rate 2, sucralose (mouse) 1 170397438 173397435 Mouse 1300888 Berr1_m berghei resistance locus 1 (mouse) Not determined 1 164143227 190534272 Mouse 38456001 Lick1_m lick rate 1, water (mouse) 1 170397438 173397435 Mouse 1301151 Hdlq14_m HDL QTL 14 (mouse) Not determined 1 142489543 176489734 Mouse 4141233 Femwf12_m femur work to failure 12 (mouse) Not determined 141233173 175233272 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1301894 Skull2_m skull morphology 2 (mouse) Not determined 1 139602037 173602216 Mouse 1301385 Radpf2_m radiation pulmonary fibrosis 2 (mouse) Not determined 1 147125258 182873798 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 1302193 Cpfd1_m cerebellum pattern fissures (mouse) Not determined 1 139602037 173602216 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 11049576 Lmr8a_m leishmaniasis resistance 8a (mouse) 1 139602037 173602216 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301467 Pcir1_m periosteal circumference 1 (mouse) Not determined 1 141233173 175233272 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 1300696 Bpq2_m blood pressure QTL 2 (mouse) Not determined 1 139602037 173602216 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 1301191 Stia1_m serum transfer induced arthritis 1 (mouse) Not determined 1 141233173 175233272 Mouse 1300934 Cfbw1_m cystic fibrosis body weight 1 (mouse) Not determined 1 145145207 179145325 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 1558720 Bpq8_m blood pressure QTL 8 (mouse) Not determined 1 143284665 177284803 Mouse 13207571 Tcq11_m total cholesterol QTL 11 (mouse) 1 169137569 179647565 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 1301710 Bmd5_m bone mineral density 5 (mouse) Not determined 1 139602037 173602216 Mouse 27095935 Ulnl5_m ulna length 5, 10 week (mouse) 1 128727737 181327565 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 13207587 Mwmlpt1_m Morris water maze latency to platform, training, 1 (mouse) 1 169597438 173397435 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 13207591 Mwmlpa1_m Morris water maze latency to platform, all, 1 (mouse) 1 169797438 173297435 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 27095915 Scvln13_m sacral vertebrae length 2, 16 week (mouse) 1 117527730 179827565 Mouse 11533913 Rd6m1_m retinal degeneration 6 modifier 1 (mouse) 1 141233173 175233272 Mouse 26884448 Sklq1_m skull length QTL 1, 5 week (mouse) 1 75976637 181327565 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000027826 ⟹ ENSMUSP00000027826
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 172,458,331 - 172,460,529 (-) Ensembl GRCm38.p6 Ensembl 1 172,630,764 - 172,632,962 (-) Ensembl
RefSeq Acc Id:
NM_026725 ⟹ NP_081001
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 172,458,336 - 172,460,504 (-) NCBI GRCm38 1 172,630,769 - 172,632,974 (-) ENTREZGENE MGSCv37 1 174,560,900 - 174,563,105 (-) RGD Celera 1 175,487,228 - 175,489,448 (-) RGD cM Map 1 ENTREZGENE
Sequence:
GCGGGGACGGAATCCAGCCCCAGAGGGGGGGTGACCCAATCTCCCGGCAGAGTAGGAAAGGCCAGCCTCGCCCTGAGTAAACTCCCCCCACGATGGGCGTGCAACCCCCCAACTTCTCCTGGGTGCTT
hide sequence
RefSeq Acc Id:
NP_081001 ⟸ NM_026725
- UniProtKB:
Q9CW48 (UniProtKB/Swiss-Prot), Q6NT99 (UniProtKB/Swiss-Prot)
- Sequence:
MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDQGVRHLVSLTERGPPHSDSCPGLTLHRMRIPDFCPPSPEQIDQFVKIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERALAAGDAIAEIRRL
hide sequence
Ensembl Acc Id:
ENSMUSP00000027826 ⟸ ENSMUST00000027826
RGD ID: 6875780 Promoter ID: EPDNEW_M1341 Type: initiation region Name: Dusp23_1 Description: Mus musculus dual specificity phosphatase 23 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 172,632,937 - 172,632,997 EPDNEW
RGD ID: 6817627 Promoter ID: MM_KWN:2934 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_026725 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 174,562,736 - 174,563,236 (-) MPROMDB
