Symbol:
Chac2
Name:
ChaC, cation transport regulator 2
RGD ID:
1319283
MGI Page
MGI
Description:
Predicted to enable glutathione specific gamma-glutamylcyclotransferase activity. Predicted to be involved in glutathione catabolic process. Predicted to be located in cytosol. Predicted to be active in cytoplasm. Orthologous to human CHAC2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2510006C20Rik; cation transport regulator-like protein 2; ChaC, cation transport regulator homolog 2; gamma-GCG 2; putative glutathione-specific gamma-glutamylcyclotransferase 2; RP23-20N14.6
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CHAC2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Chac2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Chac2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CHAC2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CHAC2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Chac2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CHAC2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CHAC2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Chac2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Chac2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CHAC2 (ChaC glutathione specific gamma-glutamylcyclotransferase 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
chac2 (ChaC, cation transport regulator homolog 2 (E. coli))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
F22F7.7
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
GCG1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG2540
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
chac2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Related Pseudogenes:
Gm11404
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 30,926,707 - 30,936,365 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 30,926,707 - 30,936,350 (-) Ensembl GRCm39 Ensembl GRCm38 11 30,976,707 - 30,986,365 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 30,976,707 - 30,986,350 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 30,876,709 - 30,886,365 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 30,876,724 - 30,886,334 (-) NCBI MGSCv36 mm8 Celera 11 33,385,672 - 33,395,218 (-) NCBI Celera Cytogenetic Map 11 A4 NCBI cM Map 11 18.2 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Chac2 Mouse (+)-schisandrin B multiple interactions ISO RGD:1309120 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CHAC2 mRNA] CTD PMID:31150632 Chac2 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1606619 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CHAC2 mRNA CTD PMID:22079256 Chac2 Mouse (-)-epigallocatechin 3-gallate decreases expression ISO RGD:1606619 6480464 epigallocatechin gallate results in decreased expression of CHAC2 mRNA CTD PMID:22079256 Chac2 Mouse 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO RGD:1606619 6480464 o,p'-DDT results in increased expression of CHAC2 mRNA CTD PMID:19371625 Chac2 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of CHAC2 mRNA CTD PMID:22206623 Chac2 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CHAC2 mRNA CTD PMID:22206623 Chac2 Mouse 17beta-estradiol increases expression ISO RGD:1606619 6480464 Estradiol results in increased expression of CHAC2 mRNA CTD PMID:19167446|PMID:31614463 Chac2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to CHAC2 promoter] CTD PMID:19654925 Chac2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1309120 6480464 Tetrachlorodibenzodioxin results in decreased expression of CHAC2 mRNA CTD PMID:33387578 Chac2 Mouse 2-hydroxypropanoic acid decreases expression ISO RGD:1606619 6480464 Lactic Acid results in decreased expression of CHAC2 mRNA CTD PMID:30851411 Chac2 Mouse acetamide decreases expression ISO RGD:1309120 6480464 acetamide results in decreased expression of CHAC2 mRNA CTD PMID:31881176 Chac2 Mouse aflatoxin B1 increases methylation ISO RGD:1606619 6480464 Aflatoxin B1 results in increased methylation of CHAC2 gene CTD PMID:27153756 Chac2 Mouse all-trans-retinoic acid decreases expression ISO RGD:1606619 6480464 Tretinoin results in decreased expression of CHAC2 mRNA CTD PMID:33167477 Chac2 Mouse arsenite(3-) increases expression EXP 6480464 arsenite results in increased expression of CHAC2 protein CTD PMID:37955338 Chac2 Mouse avobenzone decreases expression ISO RGD:1606619 6480464 avobenzone results in decreased expression of CHAC2 mRNA CTD PMID:31016361 Chac2 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of CHAC2 mRNA CTD PMID:19770486 Chac2 Mouse benzo[a]pyrene increases expression ISO RGD:1606619 6480464 Benzo(a)pyrene results in increased expression of CHAC2 mRNA CTD PMID:22316170 Chac2 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of CHAC2 mRNA CTD PMID:34319233 Chac2 Mouse bisphenol A increases expression ISO RGD:1606619 6480464 bisphenol A results in increased expression of CHAC2 mRNA; bisphenol A results in increased expression more ... CTD PMID:19371625|PMID:33376534 Chac2 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CHAC2 mRNA CTD PMID:33221593 Chac2 Mouse bisphenol A decreases expression ISO RGD:1606619 6480464 bisphenol A results in decreased expression of CHAC2 mRNA CTD PMID:33670352 Chac2 Mouse bisphenol A decreases expression ISO RGD:1309120 6480464 bisphenol A results in decreased expression of CHAC2 mRNA CTD PMID:30816183|PMID:32528016 Chac2 Mouse bisphenol A affects expression ISO RGD:1309120 6480464 bisphenol A affects the expression of CHAC2 mRNA CTD PMID:25181051 Chac2 Mouse cadmium dichloride increases expression ISO RGD:1606619 6480464 Cadmium Chloride results in increased expression of CHAC2 mRNA; Cadmium Chloride results in increased expression more ... CTD PMID:38185225|PMID:38568856 Chac2 Mouse calcitriol decreases expression ISO RGD:1606619 6480464 Calcitriol results in decreased expression of CHAC2 mRNA CTD PMID:21592394 Chac2 Mouse calcitriol multiple interactions ISO RGD:1606619 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of CHAC2 mRNA CTD PMID:21592394 Chac2 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon analog results in decreased expression of CHAC2 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25620056 Chac2 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes, Carbon analog results in increased expression of CHAC2 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Chac2 Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of CHAC2 mRNA CTD PMID:28472532 Chac2 Mouse cisplatin multiple interactions ISO RGD:1606619 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of CHAC2 mRNA CTD PMID:27392435 Chac2 Mouse cisplatin decreases expression ISO RGD:1606619 6480464 Cisplatin results in decreased expression of CHAC2 mRNA CTD PMID:27392435 Chac2 Mouse cobalt dichloride decreases expression ISO RGD:1309120 6480464 cobaltous chloride results in decreased expression of CHAC2 mRNA CTD PMID:24386269 Chac2 Mouse copper(II) sulfate decreases expression ISO RGD:1606619 6480464 Copper Sulfate results in decreased expression of CHAC2 mRNA CTD PMID:19549813 Chac2 Mouse coumestrol multiple interactions ISO RGD:1606619 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of CHAC2 mRNA; [Coumestrol co-treated with resveratrol] more ... CTD PMID:19167446 Chac2 Mouse coumestrol increases expression ISO RGD:1606619 6480464 Coumestrol results in increased expression of CHAC2 mRNA CTD PMID:19167446 Chac2 Mouse cyclosporin A decreases expression ISO RGD:1606619 6480464 Cyclosporine results in decreased expression of CHAC2 mRNA CTD PMID:20106945|PMID:21632981 Chac2 Mouse cyclosporin A affects expression ISO RGD:1606619 6480464 Cyclosporine affects the expression of CHAC2 mRNA CTD PMID:25562108 Chac2 Mouse cylindrospermopsin increases expression ISO RGD:1606619 6480464 cylindrospermopsin results in increased expression of CHAC2 mRNA CTD PMID:24921660 Chac2 Mouse Dibutyl phosphate affects expression ISO RGD:1606619 6480464 di-n-butylphosphoric acid affects the expression of CHAC2 mRNA CTD PMID:37042841 Chac2 Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of CHAC2 mRNA CTD PMID:21266533 Chac2 Mouse diethylstilbestrol increases expression ISO RGD:1606619 6480464 Diethylstilbestrol results in increased expression of CHAC2 mRNA CTD PMID:19371625 Chac2 Mouse dioxygen decreases expression ISO RGD:1606619 6480464 Oxygen deficiency results in decreased expression of CHAC2 mRNA CTD PMID:26516004 Chac2 Mouse dorsomorphin multiple interactions ISO RGD:1606619 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Chac2 Mouse doxorubicin decreases expression ISO RGD:1606619 6480464 Doxorubicin results in decreased expression of CHAC2 mRNA CTD PMID:29803840 Chac2 Mouse Enterolactone multiple interactions ISO RGD:1606619 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of CHAC2 mRNA CTD PMID:19167446 Chac2 Mouse entinostat increases expression ISO RGD:1606619 6480464 entinostat results in increased expression of CHAC2 mRNA CTD PMID:26272509 Chac2 Mouse entinostat multiple interactions ISO RGD:1606619 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Chac2 Mouse enzyme inhibitor multiple interactions ISO RGD:1606619 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Chac2 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of CHAC2 mRNA CTD PMID:30319688 Chac2 Mouse ethyl methanesulfonate decreases expression ISO RGD:1606619 6480464 Ethyl Methanesulfonate results in decreased expression of CHAC2 mRNA CTD PMID:23649840 Chac2 Mouse folic acid multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CHAC2 mRNA CTD PMID:22206623 Chac2 Mouse genistein increases expression ISO RGD:1606619 6480464 Genistein results in increased expression of CHAC2 mRNA CTD PMID:19371625 Chac2 Mouse gentamycin decreases expression ISO RGD:1309120 6480464 Gentamicins results in decreased expression of CHAC2 mRNA CTD PMID:33387578 Chac2 Mouse glafenine decreases expression ISO RGD:1309120 6480464 Glafenine results in decreased expression of CHAC2 mRNA CTD PMID:24136188 Chac2 Mouse ivermectin decreases expression ISO RGD:1606619 6480464 Ivermectin results in decreased expression of CHAC2 protein CTD PMID:32959892 Chac2 Mouse methylparaben decreases expression ISO RGD:1606619 6480464 methylparaben results in decreased expression of CHAC2 mRNA CTD PMID:31745603 Chac2 Mouse Monobutylphthalate increases expression ISO RGD:1309120 6480464 monobutyl phthalate results in increased expression of CHAC2 mRNA CTD PMID:29162477 Chac2 Mouse naringin multiple interactions EXP 6480464 CHAC2 protein promotes the reaction [naringin inhibits the reaction [Acetaminophen results in decreased expression of more ... CTD PMID:35166444|PMID:35179299 Chac2 Mouse nefazodone decreases expression ISO RGD:1309120 6480464 nefazodone results in decreased expression of CHAC2 mRNA CTD PMID:24136188 Chac2 Mouse nickel atom increases expression ISO RGD:1606619 6480464 Nickel results in increased expression of CHAC2 mRNA CTD PMID:24768652|PMID:25583101 Chac2 Mouse niclosamide decreases expression ISO RGD:1606619 6480464 Niclosamide results in decreased expression of CHAC2 mRNA CTD PMID:36318118 Chac2 Mouse okadaic acid increases expression ISO RGD:1606619 6480464 Okadaic Acid results in increased expression of CHAC2 mRNA CTD PMID:38832940 Chac2 Mouse oxaliplatin multiple interactions ISO RGD:1309120 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CHAC2 mRNA CTD PMID:25729387 Chac2 Mouse oxaliplatin decreases expression ISO RGD:1309120 6480464 oxaliplatin results in decreased expression of CHAC2 mRNA CTD PMID:25729387 Chac2 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Chac2 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of CHAC2 mRNA CTD PMID:17562736 Chac2 Mouse paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CHAC2 protein CTD PMID:35166444|PMID:35179299 Chac2 Mouse paracetamol multiple interactions EXP 6480464 CHAC2 protein promotes the reaction [naringin inhibits the reaction [Acetaminophen results in decreased expression of more ... CTD PMID:35166444|PMID:35179299 Chac2 Mouse paracetamol decreases expression ISO RGD:1309120 6480464 Acetaminophen results in decreased expression of CHAC2 mRNA CTD PMID:33387578 Chac2 Mouse PCB138 decreases expression ISO RGD:1309120 6480464 2,2',3',4,4',5-hexachlorobiphenyl results in decreased expression of CHAC2 mRNA CTD PMID:23829299 Chac2 Mouse perfluorooctanoic acid decreases expression ISO RGD:1606619 6480464 perfluorooctanoic acid results in decreased expression of CHAC2 mRNA CTD PMID:36326898 Chac2 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of CHAC2 mRNA CTD PMID:23091169 Chac2 Mouse PhIP decreases expression ISO RGD:1309120 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in decreased expression of CHAC2 mRNA CTD PMID:33945839 Chac2 Mouse picoxystrobin increases expression ISO RGD:1606619 6480464 picoxystrobin results in increased expression of CHAC2 mRNA CTD PMID:33512557 Chac2 Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Chac2 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of CHAC2 mRNA CTD PMID:23811191 Chac2 Mouse potassium chromate multiple interactions ISO RGD:1606619 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CHAC2 mRNA CTD PMID:22079256 Chac2 Mouse potassium chromate decreases expression ISO RGD:1606619 6480464 potassium chromate(VI) results in decreased expression of CHAC2 mRNA CTD PMID:22079256 Chac2 Mouse pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of CHAC2 mRNA CTD PMID:28903501 Chac2 Mouse pyrimidifen increases expression ISO RGD:1606619 6480464 pyrimidifen results in increased expression of CHAC2 mRNA CTD PMID:33512557 Chac2 Mouse quercetin affects expression ISO RGD:1606619 6480464 Quercetin affects the expression of CHAC2 mRNA CTD PMID:21632981 Chac2 Mouse quinolin-8-ol decreases expression ISO RGD:1606619 6480464 Oxyquinoline results in decreased expression of CHAC2 mRNA CTD PMID:21632981 Chac2 Mouse rac-lactic acid decreases expression ISO RGD:1606619 6480464 Lactic Acid results in decreased expression of CHAC2 mRNA CTD PMID:30851411 Chac2 Mouse resveratrol multiple interactions ISO RGD:1606619 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of CHAC2 mRNA CTD PMID:19167446 Chac2 Mouse SB 431542 multiple interactions ISO RGD:1606619 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Chac2 Mouse silver atom decreases expression EXP 6480464 Silver results in decreased expression of CHAC2 mRNA CTD PMID:27131904 Chac2 Mouse silver(0) decreases expression EXP 6480464 Silver results in decreased expression of CHAC2 mRNA CTD PMID:27131904 Chac2 Mouse sodium arsenite decreases expression ISO RGD:1606619 6480464 sodium arsenite results in decreased expression of CHAC2 mRNA CTD PMID:38568856 Chac2 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of CHAC2 mRNA CTD PMID:37682722 Chac2 Mouse sodium arsenite affects expression ISO RGD:1606619 6480464 sodium arsenite affects the expression of CHAC2 mRNA CTD PMID:34032870 Chac2 Mouse sunitinib decreases expression ISO RGD:1606619 6480464 Sunitinib results in decreased expression of CHAC2 mRNA CTD PMID:31533062 Chac2 Mouse testosterone multiple interactions ISO RGD:1606619 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of CHAC2 mRNA CTD PMID:21592394 Chac2 Mouse testosterone decreases expression ISO RGD:1606619 6480464 Testosterone results in decreased expression of CHAC2 mRNA CTD PMID:21592394 Chac2 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CHAC2 mRNA CTD PMID:27339419|PMID:31919559 Chac2 Mouse tetrachloromethane multiple interactions ISO RGD:1309120 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CHAC2 mRNA] CTD PMID:31150632 Chac2 Mouse tetrachloromethane decreases expression ISO RGD:1309120 6480464 Carbon Tetrachloride results in decreased expression of CHAC2 mRNA CTD PMID:31150632|PMID:33387578 Chac2 Mouse thioacetamide decreases expression ISO RGD:1309120 6480464 Thioacetamide results in decreased expression of CHAC2 mRNA CTD PMID:34492290 Chac2 Mouse topotecan multiple interactions ISO RGD:1309120 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CHAC2 mRNA CTD PMID:25729387 Chac2 Mouse topotecan decreases expression ISO RGD:1309120 6480464 Topotecan results in decreased expression of CHAC2 mRNA CTD PMID:25729387 Chac2 Mouse trichloroethene decreases expression ISO RGD:1309120 6480464 Trichloroethylene results in decreased expression of CHAC2 mRNA CTD PMID:33387578 Chac2 Mouse tungsten increases expression EXP 6480464 Tungsten results in increased expression of CHAC2 mRNA CTD PMID:30912803 Chac2 Mouse urethane decreases expression ISO RGD:1606619 6480464 Urethane results in decreased expression of CHAC2 mRNA CTD PMID:28818685 Chac2 Mouse valproic acid increases methylation ISO RGD:1606619 6480464 Valproic Acid results in increased methylation of CHAC2 gene CTD PMID:29154799 Chac2 Mouse valproic acid multiple interactions ISO RGD:1606619 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Chac2 Mouse valproic acid increases expression ISO RGD:1606619 6480464 Valproic Acid results in increased expression of CHAC2 mRNA CTD PMID:23179753|PMID:24383497|PMID:24935251|PMID:25192806|PMID:26272509|PMID:28001369|PMID:29154799 Chac2 Mouse valproic acid affects expression ISO RGD:1606619 6480464 Valproic Acid affects the expression of CHAC2 mRNA CTD PMID:25979313 Chac2 Mouse vorinostat increases expression ISO RGD:1606619 6480464 vorinostat results in increased expression of CHAC2 mRNA CTD PMID:27188386 Chac2 Mouse zearalenone increases expression ISO RGD:1606619 6480464 Zearalenone results in increased expression of CHAC2 mRNA CTD PMID:19371625
(+)-schisandrin B (ISO) (-)-epigallocatechin 3-gallate (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) acetamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) arsenite(3-) (EXP) avobenzone (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (EXP) chromium(6+) (EXP) cisplatin (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diethylstilbestrol (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) Enterolactone (ISO) entinostat (ISO) enzyme inhibitor (ISO) ethanol (EXP) ethyl methanesulfonate (ISO) folic acid (EXP) genistein (ISO) gentamycin (ISO) glafenine (ISO) ivermectin (ISO) methylparaben (ISO) Monobutylphthalate (ISO) naringin (EXP) nefazodone (ISO) nickel atom (ISO) niclosamide (ISO) okadaic acid (ISO) oxaliplatin (ISO) ozone (EXP) paracetamol (EXP,ISO) PCB138 (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) PhIP (ISO) picoxystrobin (ISO) pirinixic acid (EXP) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) pyrimidifen (ISO) quercetin (ISO) quinolin-8-ol (ISO) rac-lactic acid (ISO) resveratrol (ISO) SB 431542 (ISO) silver atom (EXP) silver(0) (EXP) sodium arsenite (EXP,ISO) sunitinib (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thioacetamide (ISO) topotecan (ISO) trichloroethene (ISO) tungsten (EXP) urethane (ISO) valproic acid (ISO) vorinostat (ISO) zearalenone (ISO)
Chac2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 30,926,707 - 30,936,365 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 30,926,707 - 30,936,350 (-) Ensembl GRCm39 Ensembl GRCm38 11 30,976,707 - 30,986,365 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 30,976,707 - 30,986,350 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 30,876,709 - 30,886,365 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 30,876,724 - 30,886,334 (-) NCBI MGSCv36 mm8 Celera 11 33,385,672 - 33,395,218 (-) NCBI Celera Cytogenetic Map 11 A4 NCBI cM Map 11 18.2 NCBI
CHAC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 53,767,783 - 53,775,196 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 53,767,804 - 53,775,196 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 53,994,920 - 54,002,333 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 53,848,433 - 53,855,791 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 53,835,783 - 53,843,141 (+) NCBI Celera Cytogenetic Map 2 p16.2 NCBI HuRef 2 53,729,267 - 53,736,626 (+) NCBI HuRef CHM1_1 2 53,925,914 - 53,933,272 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 53,763,988 - 53,771,398 (+) NCBI T2T-CHM13v2.0
Chac2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 108,921,669 - 108,929,215 (-) NCBI GRCr8 mRatBN7.2 14 104,720,754 - 104,728,305 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 104,720,758 - 104,728,301 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 109,032,788 - 109,040,227 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 110,259,770 - 110,267,198 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 106,732,201 - 106,739,629 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 115,383,906 - 115,391,757 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 115,383,910 - 115,391,652 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 115,005,083 - 115,047,440 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 112,082,173 - 112,122,592 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 112,141,673 - 112,148,939 (-) NCBI Celera 14 103,558,180 - 103,565,612 (-) NCBI Celera Cytogenetic Map 14 q22 NCBI
Chac2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955441 19,502,383 - 19,509,736 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955441 19,502,389 - 19,509,736 (+) NCBI ChiLan1.0 ChiLan1.0
CHAC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 72,583,066 - 72,591,548 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 72,587,032 - 72,594,557 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 53,911,057 - 53,918,620 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 54,823,066 - 54,830,474 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 54,823,067 - 54,830,474 (+) Ensembl panpan1.1 panPan2
CHAC2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 54,790,670 - 54,799,823 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 54,790,942 - 54,798,955 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 54,742,510 - 54,751,696 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 55,789,281 - 55,798,477 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 55,789,595 - 55,797,618 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 55,482,583 - 55,491,741 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 55,768,555 - 55,777,742 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 56,055,614 - 56,064,806 (+) NCBI UU_Cfam_GSD_1.0
Chac2
CHAC2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 87,405,978 - 87,416,260 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 87,405,937 - 87,417,268 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 92,565,352 - 92,575,558 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CHAC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 53,205,940 - 53,214,439 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 53,203,361 - 53,213,885 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 58,493,585 - 58,501,099 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Chac2
.
Predicted Target Of
Count of predictions: 215 Count of miRNA genes: 100 Interacting mature miRNAs: 112 Transcripts: ENSMUST00000020553, ENSMUST00000101394 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1357844 Si5lq5_m serum IGFBP-5 level QTL 5 (mouse) Not determined 11 28165873 62165976 Mouse 1302171 Pgia28_m proteoglycan induced arthritis 28 (mouse) Not determined 11 8906097 42906218 Mouse 1357720 Kidpq1_m kidney weight percentage QTL 1 (mouse) Not determined 11 12268637 68500330 Mouse 1357851 Scfq3_m subcutaneous fat pad weight QTL 3 (mouse) Not determined 11 12268637 68500330 Mouse 12910804 Pwbwq16_m post-weaning body weight QTL 16 (mouse) 11 27198057 50636094 Mouse 12910806 Pwbwq15_m post-weaning body weight QTL 15 (mouse) 11 27198057 50636094 Mouse 12910801 Pwbwq14_m post-weaning body weight QTL 14 (mouse) 11 27198057 50636094 Mouse 27226762 Feml21_m femur length 21, 16 week (mouse) 11 11750000 65990826 Mouse 4141470 Egq4_m early growth QTL 4 (mouse) Not determined 12268637 68500330 Mouse 1301426 Desp2_m despair 2 (mouse) Not determined 11 28708581 62708700 Mouse 13524844 Ppiq9_m prepulse inhibition QTL 9 (mouse) 11 9049997 35077325 Mouse 4142109 W10q2_m weight 10 weeks QTL 2 (mouse) Not determined 12268637 68500330 Mouse 12910817 Pwgrq20_m post-weaning growth rate QTL 20 (mouse) 11 27198057 50636094 Mouse 1301814 Bbaa7_m B.burgdorferi-associated arthritis 7 (mouse) Not determined 11 26011780 44264695 Mouse 13208559 Wght10_m weight 10 (mouse) 11 3950000 88890826 Mouse 10412216 Eae44_m experimental allergic encephalomyelitis susceptibility 44 (mouse) Not determined 11 12268637 39950840 Mouse 13208558 Lgth12_m body length 12 (mouse) 11 3950000 94890826 Mouse 12910818 Ogrq5_m overall growth rate QTL 5 (mouse) 11 27198057 50636094 Mouse 26884401 Huml4_m humerus length 4, 10 week (mouse) 11 11550000 68490826 Mouse 10053687 Eae6_m susceptibility to experimental allergic encephalomyelitis 6 (mouse) Not determined 11 17781966 68500330 Mouse 27226798 Scvln18_m sacral vertebrae length 2, 16 week (mouse) 11 3250000 60690826 Mouse 4141582 Lgaq1_m late growth adjusted QTL 1 (mouse) Not determined 12268637 68500330 Mouse 4141966 Tailq1_m tail length QTL 1 (mouse) Not determined 12268637 68500330 Mouse 1558945 Orgwq8_m organ weight QTL 8 (mouse) Not determined 11 17056175 67078411 Mouse 4142216 Lgq1_m late growth QTL 1 (mouse) Not determined 12268637 68500330 Mouse 1300905 Scc6_m colon tumor susceptibility 6 (mouse) Not determined 11 6880277 89019734 Mouse 14746971 Manh70_m mandible shape 70 (mouse) 11 19905890 53905890 Mouse 13524848 Ppiq7_m prepulse inhibition QTL 7 (mouse) 11 28569147 62569147 Mouse 39128214 Lwq20_m liver weight QTL 20 (mouse) 11 12268637 118022724 Mouse 26884446 Sklq10_m skull length QTL 10, 10 week (mouse) 11 3250000 62890826 Mouse 4141047 Nilac1_m nicotine induced locomotor activity 1 (mouse) Not determined 11 9011780 43011942 Mouse 10412246 Dfs2_m dental fluorosis suseptibility 2 (mouse) Not determined 11 21807364 95881231 Mouse 1559002 Lmrq4_m Leishmania major resistance QTL 4 (mouse) Not determined 11 12268637 69684947 Mouse 1300938 Bulb3_m bulb size 3 (mouse) Not determined 11 18578616 52578716 Mouse 1357518 Tgyl1_m triglyceride level 1 (mouse) Not determined 11 6880277 33916219 Mouse 4142308 W6q3_m weight 6 weeks QTL 3 (mouse) Not determined 11 12268637 68500330 Mouse 1357640 Orq2_m ovulation rate QTL 2 (mouse) Not determined 11 12268637 68500330 Mouse 1300599 Cocrb11_m cocaine related behavior 11 (mouse) Not determined 11 2670355 36671472 Mouse 1357437 Epfq4_m epididymal fat pad weight QTL 4 (mouse) Not determined 11 12268637 68500330 Mouse 4141398 Tgq22_m triglyceride QTL 22 (mouse) Not determined 21163406 55163406 Mouse 27226741 Metcl5_m metatarsal-calcaneal length 5, 5 week (mouse) 11 4650000 46290827 Mouse 1300607 Tnbs2_m tri-nitrobenzene sulfonic acid susceptible 2 (mouse) Not determined 11 24898052 35126680 Mouse 1300990 Bits3_m bitterness sensitivity 3 (mouse) Not determined 11 8372121 42372260 Mouse 27226738 Metcl11_m metatarsal-calcaneal length 11, 10 week (mouse) 11 8850000 61390826 Mouse 27226735 Metcl16_m metatarsal-calcaneal length 16, 16 week (mouse) 11 5250000 35090827 Mouse 12801459 Leuf1_m leukocyte filtration 1 (mouse) 11 18578616 52578716 Mouse 1300579 Thypr1_m thymocyte proliferative response 1 (mouse) Not determined 11 19282577 53282715 Mouse 10044008 Hbnr15_m Heligmosomoides bakeri nematode resistance 15 (mouse) Not determined 11 227052 34227232 Mouse 12801457 Intmrm2_m intima/media ratio modifier 2 (mouse) 11 18578616 52578716 Mouse 12801460 Intim2_m intima modifier 2 (mouse) 11 18578616 52578716 Mouse 27095909 Scvln6_m sacral vertebrae length 2, 5 week (mouse) 11 3250000 44090827 Mouse 4141127 W3q4_m weight 3 weeks QTL 4 (mouse) Not determined 12268637 68500330 Mouse 4141894 Nidd6k_m Nidd6 on KK-A (mouse) Not determined 19124204 96897826 Mouse 13463479 Mchq19_m mean corpuscular hemoglobin QTL 19 (mouse) 11 10951232 44951464 Mouse 25394552 Skmw69_m skeletal muscle weight 69, TA (mouse) 11 29699029 32329535 Mouse 27095904 Scvln12_m sacral vertebrae length 2, 10 week (mouse) 11 3250000 34495048 Mouse 13463472 Mcvq15_m mean corpuscular volume QTL 15 (mouse) 11 10951232 44951464 Mouse 26884453 Sklq16_m skull length QTL 16, 16 week (mouse) 11 3250000 72690826 Mouse 10044006 Hbnr13_m Heligmosomoides bakeri nematode resistance 13 (mouse) Not determined 11 25772626 59772741 Mouse
UniSTS:236546
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 30,976,746 - 30,977,009 UniSTS GRCm38 MGSCv37 11 30,876,746 - 30,877,009 UniSTS GRCm37 Celera 11 33,385,709 - 33,385,972 UniSTS Cytogenetic Map 11 A4 UniSTS cM Map 11 16.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000020553 ⟹ ENSMUSP00000020553
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 30,926,952 - 30,936,334 (-) Ensembl GRCm38.p6 Ensembl 11 30,976,952 - 30,986,334 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000101394 ⟹ ENSMUSP00000098942
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 30,926,707 - 30,936,350 (-) Ensembl GRCm38.p6 Ensembl 11 30,976,707 - 30,986,350 (-) Ensembl
RefSeq Acc Id:
NM_001290667 ⟹ NP_001277596
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 30,926,707 - 30,936,365 (-) NCBI GRCm38 11 30,976,707 - 30,986,365 (-) NCBI Celera 11 33,385,670 - 33,395,218 (-) NCBI
Sequence:
GTGTGCTTTGCGCCGCACATCAGGCGAAGCCAGAGCGCCTGGCACTGCCCCAGCAGCCGGTTACTCCCCTCGGTAGCAGTCTCGTTCTGAAGTCCGAGTGCCGGTCAGGGTCCAGAAAGATGTGGGTG
hide sequence
RefSeq Acc Id:
NM_026527 ⟹ NP_080803
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 30,926,707 - 30,936,365 (-) NCBI GRCm38 11 30,976,707 - 30,986,365 (-) NCBI MGSCv37 11 30,876,709 - 30,886,365 (-) RGD Celera 11 33,385,670 - 33,395,218 (-) NCBI cM Map 11 ENTREZGENE
Sequence:
GTGTGCTTTGCGCCGCACATCAGGCGAAGCCAGAGCGCCTGGCACTGCCCCAGCAGCCGGTTAC
hide sequence
RefSeq Acc Id:
NP_080803 ⟸ NM_026527
- Peptide Label:
isoform 1
- UniProtKB:
Q8R3K5 (UniProtKB/Swiss-Prot), Q9D1T7 (UniProtKB/Swiss-Prot), Q9CQG1 (UniProtKB/Swiss-Prot)
- Sequence:
MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPGGSVWGVAYKLPVGKEEEVKTYLDFREKGGYRTTTVIFYPKDSTTKPFSVLLYIGTCDNPNYLGPAPLEDIA
hide sequence
RefSeq Acc Id:
NP_001277596 ⟸ NM_001290667
- Peptide Label:
isoform 2
- UniProtKB:
Q9CQG1 (UniProtKB/Swiss-Prot)
- Sequence:
MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKGSVWGVAYKLPVGKEEEVK
hide sequence
Ensembl Acc Id:
ENSMUSP00000020553 ⟸ ENSMUST00000020553
Ensembl Acc Id:
ENSMUSP00000098942 ⟸ ENSMUST00000101394
RGD ID: 6820164 Promoter ID: MM_KWN:6844 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, MEF_B4, MEF_B6 Transcripts: OTTMUST00000011937, UC007III.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 30,886,011 - 30,886,511 (-) MPROMDB
RGD ID: 8674206 Promoter ID: EPDNEW_M15134 Type: initiation region Name: Chac2_1 Description: Mus musculus ChaC, cation transport regulator 2 , transcriptvariant 2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 30,986,334 - 30,986,394 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-07-10
Chac2
ChaC, cation transport regulator 2
Chac2
ChaC, cation transport regulator homolog 2 (E. coli)
Symbol and/or name change
5135510 APPROVED
