Symbol:
Ddost
Name:
dolichyl-di-phosphooligosaccharide-protein glycotransferase
RGD ID:
1319053
MGI Page
MGI
Description:
Predicted to enable enzyme activator activity. Predicted to be involved in several processes, including T cell activation; protein N-linked glycosylation via asparagine; and regulation of protein stability. Predicted to be located in endoplasmic reticulum. Predicted to be part of oligosaccharyltransferase complex. Is expressed in several structures, including alimentary system; brain; genitourinary system; respiratory system; and sensory organ. Human ortholog(s) of this gene implicated in congenital disorder of glycosylation Ir. Orthologous to human DDOST (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
DDOST 48 kDa subunit; dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit; oligosaccharyl transferase 48 kDa subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DDOST (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DDOST (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DDOST (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DDOST (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DDOST (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
DDOST (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Ost48
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
WBP1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ostb-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ddost
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 138,032,049 - 138,039,930 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 138,032,041 - 138,039,939 (+) Ensembl GRCm39 Ensembl GRCm38 4 138,304,738 - 138,312,619 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 138,304,730 - 138,312,628 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 137,860,653 - 137,868,526 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 137,576,814 - 137,584,687 (+) NCBI MGSCv36 mm8 Celera 4 140,084,875 - 140,092,756 (+) NCBI Celera Cytogenetic Map 4 D3 NCBI cM Map 4 70.13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ddost Mouse (+)-catechin multiple interactions ISO DDOST (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of DDOST mRNA CTD PMID:24763279 Ddost Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DDOST mRNA CTD PMID:22206623 Ddost Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of DDOST mRNA CTD PMID:17555576 Ddost Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DDOST mRNA CTD PMID:17942748 Ddost Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of DDOST mRNA CTD PMID:17942748 Ddost Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of DDOST mRNA CTD PMID:14664709 Ddost Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of DDOST mRNA CTD PMID:39298647 Ddost Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2 more ... CTD PMID:30294300 Ddost Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DDOST mRNA CTD PMID:17942748 Ddost Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ddost (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of DDOST mRNA CTD PMID:33387578 Ddost Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ddost (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of DDOST mRNA CTD PMID:34747641 Ddost Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DDOST mRNA CTD PMID:21570461 Ddost Mouse 2-bromohexadecanoic acid multiple interactions ISO DDOST (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DDOST protein] CTD PMID:38195004 Ddost Mouse 3-chloropropane-1,2-diol increases expression ISO Ddost (Rattus norvegicus) 6480464 alpha-Chlorohydrin analog results in increased expression of DDOST protein and alpha-Chlorohydrin results in increased expression of DDOST protein CTD PMID:26597043 Ddost Mouse 4,4'-sulfonyldiphenol increases expression ISO DDOST (Homo sapiens) 6480464 bisphenol S results in increased expression of DDOST protein CTD PMID:34186270 Ddost Mouse 5-aza-2'-deoxycytidine affects methylation ISO DDOST (Homo sapiens) 6480464 Decitabine affects the methylation of DDOST gene CTD PMID:17630775 Ddost Mouse acrolein multiple interactions ISO DDOST (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of DDOST mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of DDOST mRNA CTD PMID:32699268 Ddost Mouse acrylamide increases expression ISO Ddost (Rattus norvegicus) 6480464 Acrylamide results in increased expression of DDOST mRNA CTD PMID:28959563 Ddost Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of DDOST mRNA CTD PMID:19770486 Ddost Mouse alpha-pinene multiple interactions ISO DDOST (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of DDOST mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of DDOST mRNA CTD PMID:32699268 Ddost Mouse antirheumatic drug decreases expression ISO DDOST (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of DDOST mRNA CTD PMID:24449571 Ddost Mouse Benoxacor decreases expression EXP 6480464 benoxacor results in decreased expression of DDOST mRNA CTD PMID:34850242 Ddost Mouse benzo[a]pyrene increases methylation ISO DDOST (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of DDOST promoter CTD PMID:27901495 Ddost Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of DDOST mRNA CTD PMID:33754040 Ddost Mouse bisphenol A increases expression ISO Ddost (Rattus norvegicus) 6480464 bisphenol A results in increased expression of DDOST mRNA CTD PMID:25181051 Ddost Mouse bisphenol A decreases expression ISO DDOST (Homo sapiens) 6480464 bisphenol A results in decreased expression of DDOST protein CTD PMID:34186270 Ddost Mouse bisphenol A multiple interactions ISO DDOST (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of DDOST gene CTD PMID:31601247 Ddost Mouse bisphenol A increases methylation ISO DDOST (Homo sapiens) 6480464 bisphenol A results in increased methylation of DDOST gene CTD PMID:31601247 Ddost Mouse bisphenol A decreases expression ISO Ddost (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of DDOST mRNA CTD PMID:30816183 and PMID:32528016 Ddost Mouse bisphenol AF increases expression ISO DDOST (Homo sapiens) 6480464 bisphenol AF results in increased expression of DDOST protein CTD PMID:34186270 Ddost Mouse Bisphenol B increases expression ISO DDOST (Homo sapiens) 6480464 bisphenol B results in increased expression of DDOST protein CTD PMID:34186270 Ddost Mouse bisphenol F multiple interactions ISO DDOST (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in decreased methylation of DDOST gene CTD PMID:31601247 Ddost Mouse cadmium atom multiple interactions ISO DDOST (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DDOST protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DDOST protein CTD PMID:38195004 Ddost Mouse cadmium dichloride decreases expression ISO Ddost (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of DDOST mRNA CTD PMID:33453195 Ddost Mouse cadmium dichloride multiple interactions ISO DDOST (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DDOST protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DDOST protein CTD PMID:38195004 Ddost Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon analog results in increased expression of DDOST mRNA CTD PMID:25554681 Ddost Mouse CGP 52608 multiple interactions ISO DDOST (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DDOST gene] CTD PMID:28238834 Ddost Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of DDOST mRNA CTD PMID:37019170 Ddost Mouse clofibric acid affects expression ISO Ddost (Rattus norvegicus) 6480464 Clofibric Acid affects the expression of DDOST mRNA CTD PMID:17602206 Ddost Mouse cobalt dichloride decreases expression ISO DDOST (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of DDOST mRNA CTD PMID:19376846 Ddost Mouse copper(II) sulfate decreases expression ISO DDOST (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of DDOST mRNA CTD PMID:19549813 Ddost Mouse coumarin increases expression ISO Ddost (Rattus norvegicus) 6480464 coumarin results in increased expression of DDOST mRNA CTD PMID:18480146 Ddost Mouse cyclosporin A increases expression ISO DDOST (Homo sapiens) 6480464 Cyclosporine results in increased expression of DDOST mRNA CTD PMID:20106945 and PMID:27989131 Ddost Mouse cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of DDOST mRNA CTD PMID:19770486 and PMID:25270620 Ddost Mouse cyproconazole increases expression EXP 6480464 cyproconazole results in increased expression of DDOST mRNA CTD PMID:22334560 Ddost Mouse doxorubicin increases expression ISO DDOST (Homo sapiens) 6480464 Doxorubicin results in increased expression of DDOST mRNA CTD PMID:29803840 Ddost Mouse elemental selenium increases expression ISO DDOST (Homo sapiens) 6480464 Selenium results in increased expression of DDOST mRNA CTD PMID:19244175 Ddost Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of DDOST mRNA CTD PMID:22334560 Ddost Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of DDOST mRNA CTD PMID:30319688 Ddost Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DDOST mRNA CTD PMID:22206623 Ddost Mouse fulvestrant multiple interactions ISO DDOST (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of DDOST gene and [bisphenol F co-treated with Fulvestrant] results in decreased methylation of DDOST gene CTD PMID:31601247 Ddost Mouse gentamycin increases expression ISO Ddost (Rattus norvegicus) 6480464 Gentamicins results in increased expression of DDOST mRNA CTD PMID:22061828 Ddost Mouse glafenine increases expression ISO Ddost (Rattus norvegicus) 6480464 Glafenine results in increased expression of DDOST mRNA CTD PMID:24136188 Ddost Mouse isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of DDOST mRNA CTD PMID:21823215 Ddost Mouse ivermectin decreases expression ISO DDOST (Homo sapiens) 6480464 Ivermectin results in decreased expression of DDOST protein CTD PMID:32959892 Ddost Mouse nimesulide increases expression ISO Ddost (Rattus norvegicus) 6480464 nimesulide results in increased expression of DDOST mRNA CTD PMID:24136188 Ddost Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of DDOST mRNA CTD PMID:35964746 Ddost Mouse ouabain decreases expression ISO DDOST (Homo sapiens) 6480464 Ouabain results in decreased expression of DDOST mRNA CTD PMID:16412265 Ddost Mouse ozone multiple interactions ISO DDOST (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of DDOST mRNA more ... CTD PMID:32699268 Ddost Mouse paracetamol multiple interactions EXP 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of DDOST mRNA] CTD PMID:29246445 Ddost Mouse paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of DDOST mRNA CTD PMID:29246445 Ddost Mouse phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of DDOST mRNA CTD PMID:19270015 Ddost Mouse propiconazole increases expression EXP 6480464 propiconazole results in increased expression of DDOST mRNA CTD PMID:22334560 Ddost Mouse resveratrol increases expression EXP 6480464 resveratrol results in increased expression of DDOST protein CTD PMID:25505154 Ddost Mouse SB 431542 multiple interactions ISO DDOST (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of DDOST protein CTD PMID:37664457 Ddost Mouse selenium atom increases expression ISO DDOST (Homo sapiens) 6480464 Selenium results in increased expression of DDOST mRNA CTD PMID:19244175 Ddost Mouse sodium arsenite decreases expression ISO DDOST (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DDOST mRNA CTD PMID:38568856 Ddost Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of DDOST mRNA CTD PMID:37682722 Ddost Mouse sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of DDOST protein CTD PMID:28918527 Ddost Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of DDOST mRNA CTD PMID:17555576 Ddost Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of DDOST mRNA CTD PMID:31919559 Ddost Mouse thapsigargin increases expression ISO DDOST (Homo sapiens) 6480464 Thapsigargin results in increased expression of DDOST mRNA CTD PMID:22378314 Ddost Mouse thapsigargin increases expression ISO Ddost (Rattus norvegicus) 6480464 Thapsigargin results in increased expression of DDOST protein CTD PMID:35544339 Ddost Mouse thiram decreases expression ISO DDOST (Homo sapiens) 6480464 Thiram results in decreased expression of DDOST mRNA CTD PMID:38568856 Ddost Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of DDOST mRNA CTD PMID:23557971 Ddost Mouse tolcapone affects binding ISO Ddost (Rattus norvegicus) 6480464 tolcapone binds to DDOST protein CTD PMID:19783845 Ddost Mouse tunicamycin increases expression ISO DDOST (Homo sapiens) 6480464 Tunicamycin results in increased expression of DDOST mRNA CTD PMID:22378314 and PMID:29453283 Ddost Mouse vinclozolin decreases expression ISO Ddost (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of DDOST mRNA CTD PMID:23034163 Ddost Mouse vitamin E increases expression ISO DDOST (Homo sapiens) 6480464 Vitamin E results in increased expression of DDOST mRNA CTD PMID:19244175
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-bromohexadecanoic acid (ISO) 3-chloropropane-1,2-diol (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (EXP) alpha-pinene (ISO) antirheumatic drug (ISO) Benoxacor (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chlorpyrifos (EXP) clofibric acid (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (EXP,ISO) cyproconazole (EXP) doxorubicin (ISO) elemental selenium (ISO) epoxiconazole (EXP) ethanol (EXP) folic acid (EXP) fulvestrant (ISO) gentamycin (ISO) glafenine (ISO) isoprenaline (EXP) ivermectin (ISO) nimesulide (ISO) nitrates (EXP) ouabain (ISO) ozone (ISO) paracetamol (EXP) phenobarbital (EXP) propiconazole (EXP) resveratrol (EXP) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (EXP,ISO) sodium fluoride (EXP) tamoxifen (EXP) tetrachloromethane (EXP) thapsigargin (ISO) thiram (ISO) titanium dioxide (EXP) tolcapone (ISO) tunicamycin (ISO) vinclozolin (ISO) vitamin E (ISO)
Ddost Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 138,032,049 - 138,039,930 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 138,032,041 - 138,039,939 (+) Ensembl GRCm39 Ensembl GRCm38 4 138,304,738 - 138,312,619 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 138,304,730 - 138,312,628 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 137,860,653 - 137,868,526 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 137,576,814 - 137,584,687 (+) NCBI MGSCv36 mm8 Celera 4 140,084,875 - 140,092,756 (+) NCBI Celera Cytogenetic Map 4 D3 NCBI cM Map 4 70.13 NCBI
DDOST Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 20,651,777 - 20,661,369 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 20,651,767 - 20,661,544 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 20,978,270 - 20,987,862 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 20,850,847 - 20,860,624 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 20,723,576 - 20,733,250 NCBI Celera 1 19,304,032 - 19,313,806 (-) NCBI Celera Cytogenetic Map 1 p36.12 NCBI HuRef 1 19,224,399 - 19,234,152 (-) NCBI HuRef CHM1_1 1 21,089,079 - 21,098,837 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 20,477,979 - 20,487,556 (-) NCBI T2T-CHM13v2.0
Ddost Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 155,805,612 - 155,812,728 (+) NCBI GRCr8 mRatBN7.2 5 150,522,297 - 150,529,413 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 150,522,242 - 150,529,413 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 153,218,031 - 153,225,154 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 154,992,317 - 154,999,440 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 154,974,338 - 154,981,461 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 156,668,924 - 156,676,036 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 156,668,712 - 156,676,035 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 160,417,854 - 160,424,605 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 157,083,337 - 157,090,071 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 157,093,375 - 157,100,109 (+) NCBI Celera 5 148,916,053 - 148,922,908 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
Ddost Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 1,186,733 - 1,240,087 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 1,186,733 - 1,195,691 (-) NCBI ChiLan1.0 ChiLan1.0
DDOST Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 206,461,933 - 206,472,335 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 205,575,039 - 205,584,653 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 19,602,086 - 19,611,431 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 20,646,653 - 20,656,392 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 20,647,043 - 20,657,012 (-) Ensembl panpan1.1 panPan2
DDOST Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 78,268,540 - 78,275,789 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 78,267,912 - 78,294,463 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 74,782,846 - 74,790,095 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 78,835,418 - 78,842,667 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 78,834,790 - 78,843,082 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 75,654,130 - 75,661,378 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 76,665,950 - 76,673,196 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 77,669,554 - 77,676,814 (+) NCBI UU_Cfam_GSD_1.0
Ddost Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 40,765,020 - 40,773,177 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 6,589,798 - 6,598,379 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 6,589,939 - 6,597,951 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DDOST Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 78,885,268 - 78,895,853 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 78,885,268 - 78,895,720 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 73,128,945 - 73,139,406 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DDOST Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 111,892,317 - 111,901,690 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 111,891,793 - 111,901,429 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 4,334,088 - 4,343,482 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ddost
.
Predicted Target Of
Count of predictions: 281 Count of miRNA genes: 236 Interacting mature miRNAs: 260 Transcripts: ENSMUST00000030538 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301267 Bcmd2_m B cell maturation defect 2 (mouse) Not determined 4 133154678 150789451 Mouse 4142139 Adip12_m adiposity 12 (mouse) Not determined 4 124621281 156860686 Mouse 10047132 Albq19_m albuminuria QTL 19 (mouse) Not determined 4 112824389 146824389 Mouse 1301525 Lmb1_m lupus in MRL and B6 F2 cross (mouse) Not determined 4 124264957 150676858 Mouse 14746982 Manh56_m mandible shape 56 (mouse) 4 117815917 151815917 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 12910797 Pwgrq4_m pre-weaning growth rate QTL 4 (mouse) 4 105835310 141433838 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 12910794 Pwbwq8_m post-weaning body weight QTL 8 (mouse) 4 105835310 141433838 Mouse 1300743 Skull6_m skull morphology 6 (mouse) Not determined 4 111009051 145009280 Mouse 1301382 Arvm2_m autoimmune renal vasculitis 2 (mouse) Not determined 4 107791564 141791756 Mouse 1302149 Tlsr2_m thymic lymphoma suppressor region 2 (mouse) Not determined 4 124264957 142230960 Mouse 12910813 Pwbwq4_m pre-weaning body weight QTL 4 (mouse) 4 105835310 141433838 Mouse 1300874 Gasa2_m gastritis type A susceptibility locus 2 (mouse) Not determined 4 133010494 156860686 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 27226757 Femd1_m femur midshaft diameter 1, 5 week (mouse) 4 123993793 144326570 Mouse 12050091 Shm2_m sperm head morphology 2 (mouse) 4 136876000 138342753 Mouse 12910808 Pwbwq9_m post-weaning body weight QTL 9 (mouse) 4 105835310 141433838 Mouse 1300621 Tpnr1_m thermal pain response 1 (mouse) Not determined 4 125230872 156860686 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 4142493 Femwf13_m femur work to failure 13 (mouse) Not determined 116154678 150154782 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300663 Start2_m startle response 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300917 Gasa1_m gastritis type A susceptibility locus 1 (mouse) Not determined 4 124055093 142438020 Mouse 1300537 Ap3q_m alcohol preference 3 QTL (mouse) Not determined 4 134654451 156860686 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 10412210 Cypr6_m cytokine production 6 (mouse) Not determined 4 120617848 154617995 Mouse 1302078 Sluc21_m susceptibility to lung cancer 21 (mouse) Not determined 4 117401141 151401275 Mouse 10045620 Heal22_m wound healing/regeneration 22 (mouse) Not determined 4 125230872 156860686 Mouse 4142481 Gct1_m granulosa cell tumorigenesis 1 (mouse) Not determined 4 127784226 156860686 Mouse 4141065 Shali2_m survival time to hyperoxic acute lung injury 2 (mouse) Not determined 124055093 141572792 Mouse 13503348 Bntq18_m bone traits QTL 18 (mouse) 4 120617848 154617995 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 1300781 Lith8_m lithogenic gene 8 (mouse) Not determined 4 107264957 141265153 Mouse 4141184 Tb2r1_m TGF-beta2 responsiveness 1 (mouse) Not determined 137674005 150676858 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 4142077 Ignpq2_m IgA nephropathy QTL 2 (mouse) Not determined 4 133676733 156860686 Mouse 4141180 Ssic1_m susceptibility to small intestinal cancer 1 (mouse) Not determined 120674005 154674151 Mouse 1301584 Lrdg2_m light induced retinal degeneration 2 (mouse) Not determined 4 129465811 151654550 Mouse 1302102 Bis1_m beta-carboline-induced seizures 1 (mouse) Not determined 4 119864433 153864536 Mouse 10043996 Gct5_m granulosa cell tumorigenesis 5 (mouse) Not determined 4 127784226 156860686 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 10043985 Stheal12_m soft tissue heal 12 (mouse) Not determined 4 121342649 155342753 Mouse 1357534 Cinda3_m cytokine induced activation 3 (mouse) Not determined 4 137617848 142289472 Mouse 1301982 Pltiq1_m phospholipid transfer protein inducibility QTL 1 (mouse) Not determined 4 124621281 156860686 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 1300803 Sluc6_m susceptibility to lung cancer 6 (mouse) Not determined 4 120674005 154674151 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 4142061 Chlq16_m circulating hormone level QTL 16 (mouse) Not determined 4 121342649 155342753 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 1300933 Cdcs9_m cytokine deficiency colitis susceptibility 9 (mouse) Not determined 4 125230872 156860686 Mouse 1300809 Ccrs2_m corpus callosum hemisphere surface size 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300553 Athsq1_m atherosclerosis susceptibility QTL 1 (mouse) Not determined 4 137617848 151654550 Mouse 4141154 Nba1_m New Zealand Black autoimmunity 1 (mouse) Not determined 131650724 140879275 Mouse 1301964 Bw8q2_m body weight at 8 weeks QTL 2 (mouse) Not determined 4 119864433 153864536 Mouse 1301452 Elsgp1_m elevated serum gp70 1 (mouse) Not determined 4 121342649 155342753 Mouse 10755520 Rbc1_m red blood cell count 1 (mouse) 4 108477692 142477692 Mouse 10755521 Hct1_m hematocrit 1 (mouse) 4 108477692 142477692 Mouse 10755522 Hgb1_m hemoglobin 1 (mouse) 4 108477692 142477692 Mouse 1301108 Scon2_m sucrose consumption 2 (mouse) Not determined 4 134654451 156860686 Mouse 1300858 Tafat_m tally ho associated mesenteric fat pad weight (mouse) Not determined 4 124621281 156860686 Mouse 10755531 Lymph3_m lymphocyte differential 3 (mouse) 4 124553483 156860686 Mouse 15039382 Ltgq7_m liver triglyceride QTL 7 (mouse) 4 105705794 139705794 Mouse 11533916 Mts1_m mammary tumor susceptibility 1 (mouse) 4 125289325 156860686 Mouse 15039377 Bw45_m body weight QTL 45 (mouse) 4 105705794 139705794 Mouse 1300839 Dyscalc2_m dystrophic cardiac calcinosis 2 (mouse) Not determined 4 111009051 145009280 Mouse 4141001 Tgq17_m triglyceride QTL 17 (mouse) Not determined 112523489 146523489 Mouse 15039378 Adip30_m adiposity 30 (mouse) 4 105705794 139705794 Mouse 1357800 Tgq3_m triglyceride QTL 3 (mouse) Not determined 4 107055093 141055180 Mouse 15039385 Mvlq3_m macrovesicular liver lesion QTL 3 (mouse) 4 112182386 146182386 Mouse
RH130187
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 138,311,962 - 138,312,169 UniSTS GRCm38 MGSCv37 4 137,867,877 - 137,868,084 UniSTS GRCm37 Celera 4 140,092,107 - 140,092,314 UniSTS Cytogenetic Map 4 D3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000030538 ⟹ ENSMUSP00000030538
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 138,032,041 - 138,039,939 (+) Ensembl GRCm38.p6 Ensembl 4 138,304,730 - 138,312,628 (+) Ensembl
RefSeq Acc Id:
NM_007838 ⟹ NP_031864
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 138,032,049 - 138,039,930 (+) NCBI GRCm38 4 138,304,738 - 138,312,619 (+) NCBI MGSCv37 4 137,860,653 - 137,868,526 (+) RGD Celera 4 140,084,875 - 140,092,756 (+) RGD cM Map 4 ENTREZGENE
Sequence:
GTCCGTCCCCGCAGCGGCGTGGGCCGCGGGGCCACGGAGTACCCGGACCGCTTCCAAGTGGTACTCCGCCGCTGCGAGCGGCCATTGGGCGGCCGCGAGGGACGCTTCCGGTGCCCAGGTGCTGGCCT
hide sequence
RefSeq Acc Id:
NP_031864 ⟸ NM_007838
- Peptide Label:
precursor
- UniProtKB:
Q8C4P7 (UniProtKB/Swiss-Prot), O54734 (UniProtKB/Swiss-Prot), Q3UC51 (UniProtKB/TrEMBL)
- Sequence:
MKMDPRLAVRAWPLCGLLLAVLGCVCASGPRTLVLLDNLNVRDTHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGS
hide sequence
Ensembl Acc Id:
ENSMUSP00000030538 ⟸ ENSMUST00000030538
RGD ID: 6835124 Promoter ID: MM_KWN:40308 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000023187 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 137,860,516 - 137,861,016 (+) MPROMDB
RGD ID: 6847799 Promoter ID: MM_ACW:36204 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, Brain, Kidney, Liver, Lung Transcripts: DDOST.BSEP07-UNSPLICED, DDOST.CSEP07 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 137,866,681 - 137,867,282 (+) MPROMDB
RGD ID: 6885182 Promoter ID: EPDNEW_M6042 Type: initiation region Name: Ddost_1 Description: Mus musculus dolichyl-di-phosphooligosaccharide-protein glycotransferase, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 138,304,854 - 138,304,914 EPDNEW
