Symbol:
Dhx29
Name:
DExH-box helicase 29
RGD ID:
1318665
MGI Page
MGI
Description:
Predicted to enable several functions, including ribonucleoside triphosphate phosphatase activity; ribosomal small subunit binding activity; and translation activator activity. Predicted to be involved in formation of translation preinitiation complex and ribosome assembly. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; connective tissue; genitourinary system; and hemolymphoid system gland. Orthologous to human DHX29 (DExH-box helicase 29).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
3732415M03; ATP-dependent RNA helicase Dhx29; Ddxx; DEAH (Asp-Glu-Ala-His) box polypeptide 29; DEAH box protein 29; E130202M19Rik; nucleic acid helicase DDXx
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DHX29 (DExH-box helicase 29) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Dhx29 (DExH-box helicase 29) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dhx29 (DExH-box helicase 29) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DHX29 (DExH-box helicase 29) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DHX29 (DExH-box helicase 29) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dhx29 (DExH-box helicase 29) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DHX29 (DExH-box helicase 29) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DHX29 (DExH-box helicase 29) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dhx29 (DExH-box helicase 29) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
DHX29 (DExH-box helicase 29)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Dhx29 (DExH-box helicase 29)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dhx29 (DEAH (Asp-Glu-Ala-His) box polypeptide 29)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
YLR419W
Alliance
DIOPT (InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
dhx29
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 113,063,976 - 113,105,968 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 113,063,988 - 113,105,966 (+) Ensembl GRCm39 Ensembl GRCm38 13 112,927,680 - 112,969,432 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 112,927,454 - 112,969,432 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 113,718,001 - 113,759,395 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 114,048,671 - 114,090,065 (+) NCBI MGSCv36 mm8 Celera 13 117,244,274 - 117,286,508 (+) NCBI Celera Cytogenetic Map 13 D2.2 NCBI cM Map 13 63.93 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dhx29 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of DHX29 mRNA CTD PMID:22206623 Dhx29 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of DHX29 mRNA CTD PMID:17942748 Dhx29 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DHX29 mRNA CTD PMID:17942748 Dhx29 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of DHX29 mRNA CTD PMID:39298647 Dhx29 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1318664 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of DHX29 protein CTD PMID:31675489 Dhx29 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DHX29 mRNA CTD PMID:17942748 Dhx29 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DHX29 mRNA CTD PMID:21570461 Dhx29 Mouse 2-hydroxypropanoic acid decreases expression ISO RGD:1318664 6480464 Lactic Acid results in decreased expression of DHX29 mRNA CTD PMID:30851411 Dhx29 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of DHX29 mRNA CTD PMID:39298647 Dhx29 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of DHX29 mRNA CTD PMID:19770486 Dhx29 Mouse aflatoxin B1 decreases methylation ISO RGD:1318664 6480464 Aflatoxin B1 results in decreased methylation of DHX29 gene CTD PMID:27153756 Dhx29 Mouse ammonium hexachloroplatinate affects expression ISO RGD:1318664 6480464 ammonium hexachloroplatinate affects the expression of DHX29 mRNA CTD PMID:19527780 Dhx29 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of DHX29 mRNA CTD PMID:22228805 Dhx29 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1318664 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of DHX29 mRNA CTD PMID:26238291 Dhx29 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DHX29 mRNA CTD PMID:21932408 Dhx29 Mouse bisphenol A decreases methylation ISO RGD:1318664 6480464 bisphenol A results in decreased methylation of DHX29 gene CTD PMID:31601247 Dhx29 Mouse bisphenol A multiple interactions ISO RGD:1318664 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of DHX29 gene CTD PMID:31601247 Dhx29 Mouse bisphenol A decreases expression ISO RGD:2318361 6480464 bisphenol A results in decreased expression of DHX29 mRNA CTD PMID:30816183 Dhx29 Mouse bisphenol A decreases expression ISO RGD:1318664 6480464 bisphenol A results in decreased expression of DHX29 mRNA CTD PMID:25047013 Dhx29 Mouse caffeine affects phosphorylation ISO RGD:1318664 6480464 Caffeine affects the phosphorylation of DHX29 protein CTD PMID:35688186 Dhx29 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes, Carbon analog results in increased expression of DHX29 mRNA CTD PMID:25554681 Dhx29 Mouse CGP 52608 multiple interactions ISO RGD:1318664 6480464 CGP 52608 promotes the reaction [RORA protein binds to DHX29 gene] CTD PMID:28238834 Dhx29 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of DHX29 mRNA CTD PMID:37019170 Dhx29 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Dhx29 Mouse chromium(6+) multiple interactions ISO RGD:1318664 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression more ... CTD PMID:38479592 Dhx29 Mouse DDT decreases methylation ISO RGD:2318361 6480464 DDT results in decreased methylation of DHX29 gene CTD PMID:31682807 Dhx29 Mouse dicrotophos decreases expression ISO RGD:1318664 6480464 dicrotophos results in decreased expression of DHX29 mRNA CTD PMID:28302478 Dhx29 Mouse doxorubicin decreases expression ISO RGD:1318664 6480464 Doxorubicin results in decreased expression of DHX29 mRNA CTD PMID:29803840 Dhx29 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of DHX29 mRNA CTD PMID:30319688 Dhx29 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Dhx29 Mouse folpet decreases expression EXP 6480464 folpet results in decreased expression of DHX29 mRNA CTD PMID:31558096 Dhx29 Mouse FR900359 affects phosphorylation ISO RGD:1318664 6480464 FR900359 affects the phosphorylation of DHX29 protein CTD PMID:37730182 Dhx29 Mouse fulvestrant multiple interactions ISO RGD:1318664 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of DHX29 gene CTD PMID:31601247 Dhx29 Mouse gentamycin increases expression ISO RGD:2318361 6480464 Gentamicins results in increased expression of DHX29 mRNA CTD PMID:22061828 Dhx29 Mouse hexadecanoic acid decreases phosphorylation ISO RGD:1318664 6480464 Palmitic Acid results in decreased phosphorylation of DHX29 protein CTD PMID:28073184 Dhx29 Mouse hexamethylene diisocyanate affects expression ISO RGD:1318664 6480464 1,6-hexamethylene diisocyanate affects the expression of DHX29 mRNA CTD PMID:19527780 Dhx29 Mouse ivermectin decreases expression ISO RGD:1318664 6480464 Ivermectin results in decreased expression of DHX29 protein CTD PMID:32959892 Dhx29 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Dhx29 Mouse lead diacetate multiple interactions ISO RGD:1318664 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of DHX29 mRNA CTD PMID:22839698 Dhx29 Mouse methoxychlor affects methylation ISO RGD:2318361 6480464 Methoxychlor affects the methylation of DHX29 gene CTD PMID:35440735 Dhx29 Mouse perfluorooctane-1-sulfonic acid decreases expression ISO RGD:1318664 6480464 perfluorooctane sulfonic acid results in decreased expression of DHX29 mRNA CTD PMID:27153767 Dhx29 Mouse quercetin decreases expression ISO RGD:1318664 6480464 Quercetin results in decreased expression of DHX29 mRNA CTD PMID:21632981 Dhx29 Mouse rac-lactic acid decreases expression ISO RGD:1318664 6480464 Lactic Acid results in decreased expression of DHX29 mRNA CTD PMID:30851411 Dhx29 Mouse rotenone increases expression EXP 6480464 Rotenone results in increased expression of DHX29 mRNA CTD PMID:32937126 Dhx29 Mouse sodium arsenite decreases expression ISO RGD:1318664 6480464 sodium arsenite results in decreased expression of DHX29 mRNA CTD PMID:22714537 Dhx29 Mouse sodium arsenite multiple interactions ISO RGD:1318664 6480464 sodium arsenite results in decreased expression of and results in increased activity of DHX29 protein CTD PMID:30528433 Dhx29 Mouse sodium arsenite increases expression ISO RGD:1318664 6480464 sodium arsenite results in increased expression of DHX29 mRNA CTD PMID:38568856 Dhx29 Mouse sunitinib decreases expression ISO RGD:1318664 6480464 Sunitinib results in decreased expression of DHX29 mRNA CTD PMID:31533062 Dhx29 Mouse testosterone enanthate affects expression ISO RGD:1318664 6480464 testosterone enanthate affects the expression of DHX29 mRNA CTD PMID:17440010 Dhx29 Mouse tetracycline increases expression EXP 6480464 Tetracycline results in increased expression of DHX29 mRNA CTD PMID:16917069 Dhx29 Mouse thiram increases expression ISO RGD:1318664 6480464 Thiram results in increased expression of DHX29 mRNA CTD PMID:38568856 Dhx29 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of DHX29 mRNA CTD PMID:27760801 Dhx29 Mouse trichloroethene decreases expression ISO RGD:2318361 6480464 Trichloroethylene results in decreased expression of DHX29 mRNA CTD PMID:33387578 Dhx29 Mouse trimellitic anhydride affects expression ISO RGD:1318664 6480464 trimellitic anhydride affects the expression of DHX29 mRNA CTD PMID:19527780 Dhx29 Mouse triphenyl phosphate affects expression ISO RGD:1318664 6480464 triphenyl phosphate affects the expression of DHX29 mRNA CTD PMID:37042841 Dhx29 Mouse Triptolide increases expression EXP 6480464 triptolide results in increased expression of DHX29 mRNA CTD PMID:32835833 Dhx29 Mouse tungsten decreases expression EXP 6480464 Tungsten results in decreased expression of DHX29 mRNA CTD PMID:30912803 Dhx29 Mouse zinc protoporphyrin multiple interactions ISO RGD:1318664 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of DHX29 mRNA CTD PMID:22839698
1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (EXP) aflatoxin B1 (EXP,ISO) ammonium hexachloroplatinate (ISO) benzo[a]pyrene (EXP) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) caffeine (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chlorpyrifos (EXP) choline (EXP) chromium(6+) (ISO) DDT (ISO) dicrotophos (ISO) doxorubicin (ISO) ethanol (EXP) folic acid (EXP) folpet (EXP) FR900359 (ISO) fulvestrant (ISO) gentamycin (ISO) hexadecanoic acid (ISO) hexamethylene diisocyanate (ISO) ivermectin (ISO) L-methionine (EXP) lead diacetate (ISO) methoxychlor (ISO) perfluorooctane-1-sulfonic acid (ISO) quercetin (ISO) rac-lactic acid (ISO) rotenone (EXP) sodium arsenite (ISO) sunitinib (ISO) testosterone enanthate (ISO) tetracycline (EXP) thiram (ISO) titanium dioxide (EXP) trichloroethene (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) Triptolide (EXP) tungsten (EXP) zinc protoporphyrin (ISO)
1.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.
Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development.
Ko MS, etal., Development 2000 Apr;127(8):1737-49.
3.
MGDs mouse GO annotations
MGD data from the GO Consortium
4.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.
mRNA helicases: the tacticians of translational control.
Parsyan A, etal., Nat Rev Mol Cell Biol. 2011 Apr;12(4):235-45. doi: 10.1038/nrm3083.
6.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Dhx29 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 113,063,976 - 113,105,968 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 113,063,988 - 113,105,966 (+) Ensembl GRCm39 Ensembl GRCm38 13 112,927,680 - 112,969,432 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 112,927,454 - 112,969,432 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 113,718,001 - 113,759,395 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 114,048,671 - 114,090,065 (+) NCBI MGSCv36 mm8 Celera 13 117,244,274 - 117,286,508 (+) NCBI Celera Cytogenetic Map 13 D2.2 NCBI cM Map 13 63.93 NCBI
DHX29 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 55,256,055 - 55,307,694 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 55,256,055 - 55,307,694 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 54,551,883 - 54,603,522 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 54,587,830 - 54,639,278 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 54,587,830 - 54,639,259 NCBI Celera 5 51,504,864 - 51,556,336 (-) NCBI Celera Cytogenetic Map 5 q11.2 NCBI HuRef 5 51,525,083 - 51,576,484 (-) NCBI HuRef CHM1_1 5 54,555,919 - 54,607,389 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 56,083,337 - 56,135,001 (-) NCBI T2T-CHM13v2.0
Dhx29 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 46,293,901 - 46,344,652 (+) NCBI GRCr8 mRatBN7.2 2 44,560,653 - 44,611,450 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 44,560,714 - 44,611,445 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 2 44,787,066 - 44,837,834 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 44,787,002 - 44,837,831 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 63,827,247 - 63,877,717 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 44,306,480 - 44,357,742 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 40,339,409 - 40,384,844 (+) NCBI Celera Cytogenetic Map 2 q14 NCBI
Dhx29 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955446 12,362,325 - 12,412,963 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955446 12,362,324 - 12,412,814 (+) NCBI ChiLan1.0 ChiLan1.0
DHX29 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 58,633,445 - 58,684,515 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 56,787,449 - 56,838,145 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 58,722,594 - 58,773,708 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 60,345,331 - 60,396,244 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 60,345,282 - 60,396,244 (+) Ensembl panpan1.1 panPan2
DHX29 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 42,611,630 - 42,660,328 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 42,611,632 - 42,660,207 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 39,657,379 - 39,706,087 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 43,075,358 - 43,124,087 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 43,075,358 - 43,124,020 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 40,153,936 - 40,202,629 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 40,955,696 - 41,004,412 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 41,778,709 - 41,824,714 (-) NCBI UU_Cfam_GSD_1.0
Dhx29 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 203,522,300 - 203,567,559 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936480 12,458,843 - 12,504,202 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936480 12,458,834 - 12,504,207 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DHX29 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 34,425,708 - 34,478,177 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 34,426,647 - 34,478,233 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 36,535,518 - 36,586,889 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DHX29 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 51,491,356 - 51,543,889 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 51,491,598 - 51,543,774 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 360,238 - 412,844 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dhx29
.
Predicted Target Of
Count of predictions: 74 Count of miRNA genes: 70 Interacting mature miRNAs: 72 Transcripts: ENSMUST00000038574 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142334 Svtms_m survival time modifier of Sod2 (mouse) Not determined 13 107613580 119476372 Mouse 1558741 Ses10_m salmonella enteritidis susceptibility 10 (mouse) Not determined 13 82739968 116740106 Mouse 10043997 Bw40_m body weight QTL 40 (mouse) Not determined 14 79239045 113239162 Mouse 1301142 Heal2_m wound healing/regeneration 2 (mouse) Not determined 13 93875267 120883175 Mouse 1357468 Rplag_m reduced platelet aggregation (mouse) Not determined 13 95502130 120883175 Mouse 12879496 Fexq2_m fear expression QTL 2 (mouse) 13 100741519 120883175 Mouse 10045623 Heal18_m wound healing regeneration 18 (mouse) Not determined 13 79239045 113239162 Mouse 14700691 Cisaq1_m coxsackieviral infection serum ALT QTL 1 (mouse) 13 86148119 120461536 Mouse 4141704 Hipq1_m hyperinsulin production QTL 1 (mouse) Not determined 110409487 119476372 Mouse 1300939 Hrtfm6_m heart failure modifier 6 (mouse) Not determined 13 91383692 120883175 Mouse 4140995 Fbtq6_m femoral bone trait QTL 6 (mouse) Not determined 13 86341617 120341758 Mouse 1558763 Gct9_m granulosa cell tumorigenesis 9 (mouse) Not determined 13 95036824 120883175 Mouse 4142338 Skmw18_m skeletal muscle weight 18 (mouse) Not determined 13 94528399 120883175 Mouse 4141826 Tbqt5_m tibia bone quality traits 5 (mouse) Not determined 13 103341617 117043216 Mouse 4142465 Pbwg17_m postnatal body weight growth 17 (mouse) Not determined 13 83876060 117876256 Mouse 1300876 Tanidd2_m tally ho associated non-insulin dependednt diabetes mellitus 2 (mouse) Not determined 13 91965303 120883175 Mouse 14746974 Manh75_m mandible shape 75 (mouse) 13 99386647 120883175 Mouse 4142400 Tgq24_m triglyceride QTL 24 (mouse) Not determined 102602630 120883175 Mouse
AU043276
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 13 112,969,189 - 112,969,303 UniSTS GRCm38 MGSCv37 13 113,759,397 - 113,759,511 UniSTS GRCm37 Celera 13 117,286,510 - 117,286,624 UniSTS Cytogenetic Map 13 D2.2 UniSTS Whitehead/MRC_RH 13 972.43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000038574 ⟹ ENSMUSP00000035244
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 113,063,988 - 113,105,966 (+) Ensembl GRCm38.p6 Ensembl 13 112,927,454 - 112,969,432 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000223866
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 113,064,182 - 113,068,711 (+) Ensembl GRCm38.p6 Ensembl 13 112,927,648 - 112,932,177 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000224176 ⟹ ENSMUSP00000153182
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 113,063,988 - 113,078,263 (+) Ensembl GRCm38.p6 Ensembl 13 112,927,454 - 112,941,729 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000226022
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 113,069,056 - 113,072,238 (+) Ensembl GRCm38.p6 Ensembl 13 112,932,522 - 112,935,704 (+) Ensembl
RefSeq Acc Id:
NM_172594 ⟹ NP_766182
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 113,064,214 - 113,105,966 (+) NCBI GRCm38 13 112,927,680 - 112,969,432 (+) NCBI MGSCv37 13 113,718,001 - 113,759,395 (+) RGD Celera 13 117,244,274 - 117,286,508 (+) RGD cM Map 13 ENTREZGENE
Sequence:
ATGGAGGAGGCTGGGTGGAGGCGTGGGAGCCGGCAAACGTGAAGAGCTCTCGGGCTTCTGCTGTGCCGCAGCGGGGATCTGGATCTGGAAGACTACTCTCCTGCAGCTGAAACATGGGCGGCAAAAAT
hide sequence
RefSeq Acc Id:
XR_004938025
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 113,063,976 - 113,105,968 (+) NCBI
Sequence:
GACGGTGGCCCGGAGGAGTCAAAAGTGAGCGAGCCTTGAGCCCCGCGTGACTTTTCTCCTTTCTAGTCTGGGTCCTGCCCCTTTTCTCTTCCAACCACTGCGAGTCCGGCAGTTCAATGACTAAAAAC
hide sequence
RefSeq Acc Id:
NP_766182 ⟸ NM_172594
- UniProtKB:
Q8C9H9 (UniProtKB/Swiss-Prot), Q8C9B7 (UniProtKB/Swiss-Prot), Q8BT01 (UniProtKB/Swiss-Prot), Q8BQJ4 (UniProtKB/Swiss-Prot), Q6PGC1 (UniProtKB/Swiss-Prot)
- Sequence:
MGGKNKKHKAPGAAAMRAAVSASRARSAEAGAVGEAQSKKPVARPAPAVPTGAREPRVKQGPKIYSFNSANDSGGSANLDKSILKVVINNKLEQRIIGVINEHKKQNSDRGAISGRLSAKKLQDLYMA
hide sequence
Ensembl Acc Id:
ENSMUSP00000153182 ⟸ ENSMUST00000224176
Ensembl Acc Id:
ENSMUSP00000035244 ⟸ ENSMUST00000038574
RGD ID: 8681324 Promoter ID: EPDNEW_M18692 Type: initiation region Name: Dhx29_1 Description: Mus musculus DEAH (Asp-Glu-Ala-His) box polypeptide 29 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 13 112,927,714 - 112,927,774 EPDNEW
RGD ID: 6824382 Promoter ID: MM_KWN:15286 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000038574, NM_028151, UC007RWU.1, UC007RWV.1, UC007RWW.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 13 113,717,466 - 113,717,992 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-26
Dhx29
DExH-box helicase 29
AU043276
expressed sequence AU043276
Symbol and/or name updated
27372883 PROVISIONAL
2024-08-21
AU043276
expressed sequence AU043276
Dhx29
DExH-box helicase 29
Symbol and/or name change
5135510 APPROVED
2023-06-27
Dhx29
DExH-box helicase 29
Dhx29
DEAH (Asp-Glu-Ala-His) box polypeptide 29
Symbol and/or name change
5135510 APPROVED
