Advanced Search (OLGA)

Gene: ZNF22 (zinc finger protein 22) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

ZNF22

Name:

zinc finger protein 22

RGD ID:

1318379

HGNC Page

HGNC:13012

Description:

Predicted to enable DNA binding activity. Predicted to be involved in regulation of gene expression. Located in nucleoplasm.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

HKR-T1; KOX15; krox-26 protein; Zfp422; zinc finger protein 22 (KOX 15); zinc finger protein KOX15; zinc finger protein Krox-26; ZNF422

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	45,000,923 - 45,005,326 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	45,000,923 - 45,005,326 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	45,496,371 - 45,500,774 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	44,815,928 - 44,820,780 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	44,815,927 - 44,820,779	NCBI
Celera	10	41,499,447 - 41,503,956 (+)	NCBI		Celera
Cytogenetic Map	10	q11.21	NCBI
HuRef	10	42,021,639 - 42,026,148 (+)	NCBI		HuRef
CHM1_1	10	45,535,250 - 45,539,759 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	45,881,879 - 45,886,287 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ZNF22	Human	(1->4)-beta-D-glucan	multiple interactions	ISO	Zfp422 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ZFP422 mRNA	CTD	PMID:36331819
ZNF22	Human	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	ISO	Zfp422 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
ZNF22	Human	1,2-dichloroethane	decreases expression	ISO	Zfp422 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of ZFP422 mRNA	CTD	PMID:28960355
ZNF22	Human	1,2-dimethylhydrazine	multiple interactions	ISO	Zfp422 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZFP422 mRNA	CTD	PMID:22206623
ZNF22	Human	1,2-dimethylhydrazine	decreases expression	ISO	Zfp422 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of ZFP422 mRNA	CTD	PMID:22206623
ZNF22	Human	17alpha-ethynylestradiol	decreases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Ethinyl Estradiol results in decreased expression of ZNF22 mRNA	CTD	PMID:17557909
ZNF22	Human	17beta-estradiol	decreases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Estradiol results in decreased expression of ZFP422 mRNA	CTD	PMID:20068009
ZNF22	Human	17beta-estradiol	multiple interactions	EXP		6480464	[Estradiol co-treated with TGFB1 protein] results in increased expression of ZNF22 mRNA	CTD	PMID:30165855
ZNF22	Human	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	Zfp422 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
ZNF22	Human	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	Zfp422 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
ZNF22	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Zfp422 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of ZFP422 mRNA	CTD	PMID:21570461
ZNF22	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of ZFP422 mRNA	CTD	PMID:33387578
ZNF22	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of ZFP422 mRNA	CTD	PMID:34747641
ZNF22	Human	2,4,4'-trichlorobiphenyl	multiple interactions	ISO	Zfp422 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
ZNF22	Human	2,6-dinitrotoluene	affects expression	ISO	Zfp422 (Rattus norvegicus)	6480464	2 and 6-dinitrotoluene affects the expression of ZFP422 mRNA	CTD	PMID:21346803
ZNF22	Human	2-butoxyethanol	decreases expression	ISO	Zfp422 (Mus musculus)	6480464	n-butoxyethanol results in decreased expression of ZFP422 mRNA	CTD	PMID:19812364
ZNF22	Human	2-methylcholine	affects expression	EXP		6480464	beta-methylcholine affects the expression of ZNF22 mRNA	CTD	PMID:21179406
ZNF22	Human	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of ZNF22 mRNA	CTD	PMID:34979203
ZNF22	Human	5-aza-2'-deoxycytidine	multiple interactions	EXP		6480464	Decitabine inhibits the reaction [tobacco tar results in decreased expression of ZNF22 mRNA]	CTD	PMID:19559774
ZNF22	Human	6-propyl-2-thiouracil	decreases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Propylthiouracil results in decreased expression of ZFP422 mRNA	CTD	PMID:30047161
ZNF22	Human	all-trans-retinoic acid	decreases expression	EXP		6480464	Tretinoin results in decreased expression of ZNF22 mRNA	CTD	PMID:21934132 and PMID:33167477
ZNF22	Human	amitrole	decreases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Amitrole results in decreased expression of ZFP422 mRNA	CTD	PMID:30047161 and PMID:38685447
ZNF22	Human	ammonium chloride	affects expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Ammonium Chloride affects the expression of ZFP422 mRNA	CTD	PMID:16483693
ZNF22	Human	antirheumatic drug	increases expression	EXP		6480464	Antirheumatic Agents results in increased expression of ZNF22 mRNA	CTD	PMID:24449571
ZNF22	Human	aristolochic acid A	decreases expression	EXP		6480464	aristolochic acid I results in decreased expression of ZNF22 mRNA	CTD	PMID:33212167
ZNF22	Human	azoxystrobin	multiple interactions	ISO	Zfp422 (Rattus norvegicus)	6480464	[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of ZFP422 mRNA	CTD	PMID:33854195
ZNF22	Human	benzo[a]pyrene	increases methylation	EXP		6480464	Benzo(a)pyrene results in increased methylation of ZNF22 3' UTR	CTD	PMID:27901495
ZNF22	Human	bisphenol A	increases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of ZFP422 mRNA and bisphenol A results in increased expression of ZNF22 mRNA	CTD	PMID:25181051 and PMID:34947998
ZNF22	Human	butan-1-ol	multiple interactions	EXP		6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of ZNF22 mRNA	CTD	PMID:29432896
ZNF22	Human	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ZNF22 mRNA	CTD	PMID:35301059
ZNF22	Human	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ZNF22 mRNA	CTD	PMID:35301059
ZNF22	Human	chlorpyrifos	multiple interactions	ISO	Zfp422 (Rattus norvegicus)	6480464	[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of ZFP422 mRNA	CTD	PMID:33854195
ZNF22	Human	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of ZNF22 mRNA	CTD	PMID:27392435
ZNF22	Human	copper atom	increases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Copper results in increased expression of ZFP422 mRNA	CTD	PMID:30556269
ZNF22	Human	copper(0)	increases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Copper results in increased expression of ZFP422 mRNA	CTD	PMID:30556269
ZNF22	Human	copper(II) sulfate	decreases expression	EXP		6480464	Copper Sulfate results in decreased expression of ZNF22 mRNA	CTD	PMID:19549813
ZNF22	Human	cyclosporin A	decreases expression	EXP		6480464	Cyclosporine results in decreased expression of ZNF22 mRNA	CTD	PMID:25562108
ZNF22	Human	dextran sulfate	multiple interactions	ISO	Zfp422 (Mus musculus)	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of ZFP422 protein]	CTD	PMID:35362542
ZNF22	Human	dextran sulfate	decreases expression	ISO	Zfp422 (Mus musculus)	6480464	Dextran Sulfate results in decreased expression of ZFP422 protein	CTD	PMID:35362542
ZNF22	Human	Dibutyl phosphate	affects expression	EXP		6480464	di-n-butylphosphoric acid affects the expression of ZNF22 mRNA	CTD	PMID:37042841
ZNF22	Human	dorsomorphin	multiple interactions	EXP		6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ZNF22 mRNA	CTD	PMID:27188386
ZNF22	Human	doxorubicin	decreases expression	EXP		6480464	Doxorubicin results in decreased expression of ZNF22 mRNA	CTD	PMID:16404146
ZNF22	Human	endosulfan	decreases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Endosulfan results in decreased expression of ZFP422 mRNA	CTD	PMID:29391264
ZNF22	Human	ethanol	multiple interactions	EXP		6480464	[[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of ZNF22 mRNA	CTD	PMID:29432896
ZNF22	Human	Evodiamine	multiple interactions	ISO	Zfp422 (Mus musculus)	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of ZFP422 protein]	CTD	PMID:35362542
ZNF22	Human	folic acid	multiple interactions	ISO	Zfp422 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZFP422 mRNA	CTD	PMID:22206623
ZNF22	Human	FR900359	decreases phosphorylation	EXP		6480464	FR900359 results in decreased phosphorylation of ZNF22 protein	CTD	PMID:37730182
ZNF22	Human	gentamycin	decreases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Gentamicins results in decreased expression of ZFP422 mRNA	CTD	PMID:33387578
ZNF22	Human	glyphosate	multiple interactions	ISO	Zfp422 (Rattus norvegicus)	6480464	[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of ZFP422 mRNA	CTD	PMID:33854195
ZNF22	Human	glyphosate	increases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Glyphosate results in increased expression of ZFP422 mRNA	CTD	PMID:34850229
ZNF22	Human	gold atom	decreases expression	EXP		6480464	Gold results in decreased expression of ZNF22 mRNA	CTD	PMID:25523186
ZNF22	Human	gold(0)	decreases expression	EXP		6480464	Gold results in decreased expression of ZNF22 mRNA	CTD	PMID:25523186
ZNF22	Human	imidacloprid	multiple interactions	ISO	Zfp422 (Rattus norvegicus)	6480464	[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of ZFP422 mRNA	CTD	PMID:33854195
ZNF22	Human	indometacin	increases expression	EXP		6480464	Indomethacin results in increased expression of ZNF22 mRNA	CTD	PMID:24737281
ZNF22	Human	manganese atom	multiple interactions	EXP		6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of ZNF22 mRNA	CTD	PMID:39836092
ZNF22	Human	manganese(0)	multiple interactions	EXP		6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of ZNF22 mRNA	CTD	PMID:39836092
ZNF22	Human	manganese(II) chloride	multiple interactions	EXP		6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of ZNF22 mRNA	CTD	PMID:39836092
ZNF22	Human	methapyrilene	decreases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Methapyrilene results in decreased expression of ZFP422 mRNA	CTD	PMID:30467583
ZNF22	Human	methimazole	decreases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Methimazole results in decreased expression of ZFP422 mRNA	CTD	PMID:30047161
ZNF22	Human	methyl methanesulfonate	decreases expression	EXP		6480464	Methyl Methanesulfonate results in decreased expression of ZNF22 mRNA	CTD	PMID:23649840
ZNF22	Human	mifepristone	increases expression	EXP		6480464	Mifepristone results in increased expression of ZNF22 mRNA	CTD	PMID:17584828
ZNF22	Human	nickel sulfate	decreases expression	EXP		6480464	nickel sulfate results in decreased expression of ZNF22 mRNA	CTD	PMID:22714537
ZNF22	Human	nitric oxide	decreases expression	ISO	Zfp422 (Mus musculus)	6480464	Nitric Oxide deficiency results in decreased expression of ZFP422 mRNA	CTD	PMID:15878706
ZNF22	Human	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of ZNF22 mRNA	CTD	PMID:22230336
ZNF22	Human	paracetamol	decreases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of ZFP422 mRNA	CTD	PMID:33387578
ZNF22	Human	PCB138	multiple interactions	ISO	Zfp422 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
ZNF22	Human	perfluorononanoic acid	increases expression	EXP		6480464	perfluoro-n-nonanoic acid results in increased expression of ZNF22 mRNA	CTD	PMID:32588087
ZNF22	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Zfp422 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ZFP422 mRNA	CTD	PMID:36331819
ZNF22	Human	pirinixic acid	increases expression	ISO	Zfp422 (Mus musculus)	6480464	pirinixic acid results in increased expression of ZFP422 mRNA	CTD	PMID:18301758
ZNF22	Human	resveratrol	multiple interactions	EXP		6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of ZNF22 mRNA	CTD	PMID:23557933
ZNF22	Human	S-butyl-DL-homocysteine (S,R)-sulfoximine	decreases expression	ISO	Zfp422 (Mus musculus)	6480464	Buthionine Sulfoximine results in decreased expression of ZFP422 mRNA	CTD	PMID:15878706
ZNF22	Human	SB 431542	multiple interactions	EXP		6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ZNF22 mRNA	CTD	PMID:27188386
ZNF22	Human	sunitinib	decreases expression	EXP		6480464	Sunitinib results in decreased expression of ZNF22 mRNA	CTD	PMID:31533062
ZNF22	Human	T-2 toxin	increases expression	EXP		6480464	T-2 Toxin results in increased expression of ZNF22 mRNA	CTD	PMID:31863870
ZNF22	Human	thiabendazole	multiple interactions	ISO	Zfp422 (Rattus norvegicus)	6480464	[azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of ZFP422 mRNA	CTD	PMID:33854195
ZNF22	Human	titanium dioxide	decreases methylation	ISO	Zfp422 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of ZFP422 gene	CTD	PMID:35295148
ZNF22	Human	trichloroethene	decreases expression	ISO	Zfp422 (Rattus norvegicus)	6480464	Trichloroethylene results in decreased expression of ZFP422 mRNA	CTD	PMID:33387578
ZNF22	Human	trichostatin A	decreases expression	EXP		6480464	trichostatin A results in decreased expression of ZNF22 mRNA	CTD	PMID:26272509
ZNF22	Human	trichostatin A	multiple interactions	EXP		6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ZNF22 mRNA	CTD	PMID:27188386
ZNF22	Human	triphenyl phosphate	affects expression	EXP		6480464	triphenyl phosphate affects the expression of ZNF22 mRNA	CTD	PMID:37042841
ZNF22	Human	triptonide	increases expression	ISO	Zfp422 (Mus musculus)	6480464	triptonide results in increased expression of ZFP422 mRNA	CTD	PMID:33045310
ZNF22	Human	trovafloxacin	increases expression	ISO	Zfp422 (Mus musculus)	6480464	trovafloxacin results in increased expression of ZFP422 mRNA	CTD	PMID:35537566
ZNF22	Human	urethane	decreases expression	EXP		6480464	Urethane results in decreased expression of ZNF22 mRNA	CTD	PMID:28818685
ZNF22	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of ZNF22 mRNA	CTD	PMID:25979313
ZNF22	Human	valproic acid	decreases methylation	EXP		6480464	Valproic Acid results in decreased methylation of ZNF22 gene	CTD	PMID:29154799
ZNF22	Human	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of ZNF22 mRNA	CTD	PMID:23179753 and PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ZNF22	Human	odontogenesis	involved_in	NAS		150520179	PMID:14630903	UniProt	PMID:14630903
ZNF22	Human	regulation of DNA-templated transcription	involved_in	NAS		150520179	PMID:14630903	UniProt	PMID:14630903
ZNF22	Human	regulation of gene expression	involved_in	IBA	FB:FBgn0035625 more ...	150520179		GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ZNF22	Human	nucleoplasm	located_in	IDA		150520179		HPA	GO_REF:0000052
ZNF22	Human	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	150520179		UniProt	GO_REF:0000044
ZNF22	Human	nucleus	is_active_in	IBA	FB:FBgn0035625 more ...	150520179		GO_Central	GO_REF:0000033
ZNF22	Human	nucleus	located_in	ISS	UniProtKB:Q9ERU2	150520179		UniProt	GO_REF:0000024
ZNF22	Human	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043
ZNF22	Human	nucleus	located_in	IEA	UniProtKB:Q9ERU2 and ensembl:ENSRNOP00000076367	150520179		Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ZNF22	Human	DNA binding	enables	ISS	UniProtKB:Q9ERU3	150520179		UniProt	GO_REF:0000024
ZNF22	Human	DNA binding	enables	IEA	UniProtKB-KW:KW-0238	150520179		UniProt	GO_REF:0000043
ZNF22	Human	DNA binding	enables	IEA	UniProtKB:Q9ERU3 and ensembl:ENSMUSP00000078685	150520179		Ensembl	GO_REF:0000107
ZNF22	Human	DNA-binding transcription factor activity	enables	NAS		150520179	PMID:34673265	ARUK-UCL	PMID:34673265
ZNF22	Human	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	150520179		UniProt	GO_REF:0000043
ZNF22	Human	protein binding	enables	IPI	UniProtKB:P13569	150520179	PMID:35156780	IntAct	PMID:35156780
ZNF22	Human	zinc ion binding	enables	TAS		150520179	PMID:1946370	PINC	PMID:1946370
ZNF22	Human	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	150520179		UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1421376	PMID:1505991	PMID:1639412	PMID:1946370	PMID:2014798	PMID:2288909	PMID:12477932	PMID:14630903	PMID:15489334	PMID:17207965	PMID:18029348	PMID:19274049
PMID:21244100	PMID:21832049	PMID:21873635	PMID:26186194	PMID:28298427	PMID:28514442	PMID:29180619	PMID:29509190	PMID:29802200	PMID:30884312	PMID:31343991	PMID:32203420
PMID:32687490	PMID:32807901	PMID:33301849	PMID:33961781	PMID:34673265	PMID:35013218	PMID:35156780	PMID:35271311	PMID:35819319	PMID:36897256	PMID:37372979

ZNF22
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	45,000,923 - 45,005,326 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	45,000,923 - 45,005,326 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	45,496,371 - 45,500,774 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	44,815,928 - 44,820,780 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	44,815,927 - 44,820,779	NCBI
Celera	10	41,499,447 - 41,503,956 (+)	NCBI		Celera
Cytogenetic Map	10	q11.21	NCBI
HuRef	10	42,021,639 - 42,026,148 (+)	NCBI		HuRef
CHM1_1	10	45,535,250 - 45,539,759 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	45,881,879 - 45,886,287 (+)	NCBI		T2T-CHM13v2.0

Zfp422
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	116,600,977 - 116,605,960 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	116,600,977 - 116,605,960 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	116,624,016 - 116,628,999 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	116,624,016 - 116,628,999 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	116,574,034 - 116,578,995 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	116,589,635 - 116,594,596 (-)	NCBI		MGSCv36	mm8
Celera	6	118,464,009 - 118,468,970 (-)	NCBI		Celera
Cytogenetic Map	6	E3	NCBI
cM Map	6	53.83	NCBI

Zfp422
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	151,558,254 - 151,565,730 (-)	NCBI		GRCr8
mRatBN7.2	4	149,885,805 - 149,893,287 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	149,885,600 - 149,893,257 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	156,127,719 - 156,131,903 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	151,911,761 - 151,915,945 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	150,534,653 - 150,538,837 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	148,757,362 - 148,761,594 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	148,757,363 - 148,761,547 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	214,696,097 - 214,703,529 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	152,975,181 - 152,979,366 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	153,220,022 - 153,222,083 (-)	NCBI
Celera	4	138,761,375 - 138,765,560 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

Znf22
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955546	2,308,714 - 2,313,334 (+)	NCBI	ChiLan1.0	ChiLan1.0

ZNF22
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	57,732,409 - 57,740,037 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	57,740,749 - 57,745,366 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	41,995,117 - 41,999,954 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	45,174,724 - 45,179,566 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	45,177,605 - 45,178,279 (+)	Ensembl	panpan1.1		panPan2

ZNF22
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	2,442,533 - 2,446,900 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	2,443,817 - 2,444,494 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	2,677,916 - 2,682,377 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	2,621,396 - 2,625,769 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	2,616,873 - 2,625,770 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	2,419,957 - 2,424,336 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	2,457,201 - 2,461,679 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	2,588,391 - 2,592,850 (-)	NCBI		UU_Cfam_GSD_1.0

Znf22
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	82,015,950 - 82,020,323 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936617	4,763,617 - 4,767,974 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936617	4,763,374 - 4,768,035 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZNF22
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	91,085,561 - 91,094,406 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	91,092,440 - 91,096,888 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	99,555,640 - 99,560,085 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ZNF22
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	40,625,251 - 40,630,492 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	40,628,570 - 40,629,244 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666056	45,773,918 - 45,779,096 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Znf22
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624966	3,088 - 18,549 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in ZNF22
9 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 10q11.21-21.2(chr10:42335305-60284876)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052506]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052506]\|See cases [RCV000052506]	Chr10:42335305..60284876 [GRCh38] Chr10:42830753..62044634 [GRCh37] Chr10:42150759..61714640 [NCBI36] Chr10:10q11.21-21.2	pathogenic
GRCh38/hg38 10q11.21-21.1(chr10:42884294-52265317)x3	copy number gain	See cases [RCV000134381]	Chr10:42884294..52265317 [GRCh38] Chr10:43379742..54025077 [GRCh37] Chr10:42699748..53695083 [NCBI36] Chr10:10q11.21-21.1	pathogenic
GRCh38/hg38 10q11.21-11.23(chr10:42395201-50877059)x3	copy number gain	See cases [RCV000134846]	Chr10:42395201..50877059 [GRCh38] Chr10:42890649..52636819 [GRCh37] Chr10:42210655..52306825 [NCBI36] Chr10:10q11.21-11.23	pathogenic
GRCh37/hg19 10p15.3-q26.3(chr10:93297-135378918)x3	copy number gain	See cases [RCV000448750]	Chr10:93297..135378918 [GRCh37] Chr10:10p15.3-q26.3	pathogenic
GRCh38/hg38 10q11.21-22.2(chr10:42685306-73715908)x3	copy number gain	See cases [RCV000134848]	Chr10:42685306..73715908 [GRCh38] Chr10:43180754..75475666 [GRCh37] Chr10:42500760..75145672 [NCBI36] Chr10:10q11.21-22.2	pathogenic
GRCh38/hg38 10p15.1-q11.22(chr10:4604734-48074662)x3	copy number gain	See cases [RCV000141497]	Chr10:4604734..48074662 [GRCh38] Chr10:4646926..47531169 [GRCh37] Chr10:4636926..47125152 [NCBI36] Chr10:10p15.1-q11.22	benign
GRCh38/hg38 10q11.21-21.3(chr10:42112187-67400675)x3	copy number gain	See cases [RCV000142967]	Chr10:42112187..67400675 [GRCh38] Chr10:42607635..69160433 [GRCh37] Chr10:41927641..68830439 [NCBI36] Chr10:10q11.21-21.3	pathogenic
GRCh37/hg19 10p13-q26.3(chr10:12829206-135427143)	copy number loss	Distal 10q deletion syndrome [RCV003319583]	Chr10:12829206..135427143 [GRCh37] Chr10:10p13-q26.3	pathogenic
GRCh37/hg19 10p15.3-q11.23(chr10:100026-50961640)x3	copy number gain	See cases [RCV000510893]	Chr10:100026..50961640 [GRCh37] Chr10:10p15.3-q11.23	pathogenic
GRCh37/hg19 10p15.3-q26.3(chr10:100027-135427143)x3	copy number gain	See cases [RCV000510861]	Chr10:100027..135427143 [GRCh37] Chr10:10p15.3-q26.3	pathogenic
GRCh37/hg19 10p15.3-q26.3(chr10:100027-135427143)	copy number gain	See cases [RCV000511389]	Chr10:100027..135427143 [GRCh37] Chr10:10p15.3-q26.3	pathogenic\|uncertain significance
NC_000010.10:g.43611191_61663279inv	inversion	Pediatric metastatic thyroid tumour [RCV000585841]	Chr10:43611191..61663279 [GRCh37] Chr10:10q11.21-21.2	likely pathogenic
GRCh37/hg19 10p11.21-q11.22(chr10:37149872-46169876)x3	copy number gain	not provided [RCV000762700]	Chr10:37149872..46169876 [GRCh37] Chr10:10p11.21-q11.22	likely pathogenic
NM_006963.5(ZNF22):c.22G>C (p.Ala8Pro)	single nucleotide variant	not specified [RCV004281920]	Chr10:45003390 [GRCh38] Chr10:45498838 [GRCh37] Chr10:10q11.21	uncertain significance
GRCh37/hg19 10q11.21-26.3(chr10:42347406-135534747)x1	copy number loss	Poly (ADP-Ribose) polymerase inhibitor response [RCV000626438]	Chr10:42347406..135534747 [GRCh37] Chr10:10q11.21-26.3	drug response
GRCh37/hg19 10q11.21(chr10:45473220-45500221)x3	copy number gain	not provided [RCV000737088]	Chr10:45473220..45500221 [GRCh37] Chr10:10q11.21	benign
GRCh37/hg19 10p15.3-q26.3(chr10:98087-135477883)x3	copy number gain	not provided [RCV000749465]	Chr10:98087..135477883 [GRCh37] Chr10:10p15.3-q26.3	pathogenic
GRCh37/hg19 10p15.3-q26.3(chr10:73232-135524321)x3	copy number gain	not provided [RCV000749464]	Chr10:73232..135524321 [GRCh37] Chr10:10p15.3-q26.3	pathogenic
NM_006963.5(ZNF22):c.392G>A (p.Arg131Lys)	single nucleotide variant	not specified [RCV004134078]	Chr10:45003760 [GRCh38] Chr10:45499208 [GRCh37] Chr10:10q11.21	uncertain significance
NM_006963.5(ZNF22):c.562G>A (p.Val188Met)	single nucleotide variant	not specified [RCV004184946]	Chr10:45003930 [GRCh38] Chr10:45499378 [GRCh37] Chr10:10q11.21	uncertain significance
GRCh37/hg19 10p14-q26.3(chr10:11138692-135427143)	copy number gain	Distal trisomy 10q [RCV003319593]	Chr10:11138692..135427143 [GRCh37] Chr10:10p14-q26.3	pathogenic
GRCh37/hg19 10q11.21-24.2(chr10:42709645-100834951)x3	copy number gain	not provided [RCV003484798]	Chr10:42709645..100834951 [GRCh37] Chr10:10q11.21-24.2	pathogenic
NM_006963.5(ZNF22):c.131G>C (p.Ser44Thr)	single nucleotide variant	not specified [RCV004688174]	Chr10:45003499 [GRCh38] Chr10:45498947 [GRCh37] Chr10:10q11.21	uncertain significance
NM_006963.5(ZNF22):c.455C>T (p.Ser152Phe)	single nucleotide variant	not specified [RCV004688172]	Chr10:45003823 [GRCh38] Chr10:45499271 [GRCh37] Chr10:10q11.21	uncertain significance
NM_006963.5(ZNF22):c.25G>T (p.Gly9Cys)	single nucleotide variant	not specified [RCV004688171]	Chr10:45003393 [GRCh38] Chr10:45498841 [GRCh37] Chr10:10q11.21	uncertain significance
NM_006963.5(ZNF22):c.502C>A (p.Gln168Lys)	single nucleotide variant	not specified [RCV004890890]	Chr10:45003870 [GRCh38] Chr10:45499318 [GRCh37] Chr10:10q11.21	uncertain significance
GRCh37/hg19 10p15.3-q11.22(chr10:135655-47688677)x4	copy number gain	Mosaic supernumerary isodicentric chromosome 10 [RCV001825164]	Chr10:135655..47688677 [GRCh37] Chr10:10p15.3-q11.22	not provided
NM_006963.5(ZNF22):c.345G>C (p.Glu115Asp)	single nucleotide variant	not specified [RCV004491819]	Chr10:45003713 [GRCh38] Chr10:45499161 [GRCh37] Chr10:10q11.21	uncertain significance
NM_006963.5(ZNF22):c.109A>C (p.Ile37Leu)	single nucleotide variant	not specified [RCV004688173]	Chr10:45003477 [GRCh38] Chr10:45498925 [GRCh37] Chr10:10q11.21	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	400
Count of miRNA genes:	351
Interacting mature miRNAs:	365
Transcripts:	ENST00000298299
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

WI-21656

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	10	45,500,461 - 45,500,734	UniSTS	GRCh37
Build 36	10	44,820,467 - 44,820,740	RGD	NCBI36
Celera	10	41,503,640 - 41,503,913	RGD
Cytogenetic Map	10	q11	UniSTS
HuRef	10	42,025,832 - 42,026,105	UniSTS
GeneMap99-GB4 RH Map	10	274.63	UniSTS
Whitehead-RH Map	10	324.1	UniSTS
NCBI RH Map	10	591.5	UniSTS

RH91090

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	10	45,500,521 - 45,500,682	UniSTS	GRCh37
Build 36	10	44,820,527 - 44,820,688	RGD	NCBI36
Celera	10	41,503,700 - 41,503,861	RGD
Cytogenetic Map	10	q11	UniSTS
HuRef	10	42,025,892 - 42,026,053	UniSTS
GeneMap99-GB4 RH Map	10	270.11	UniSTS

GDB:280588

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	10	45,499,252 - 45,499,498	UniSTS	GRCh37
Build 36	10	44,819,258 - 44,819,504	RGD	NCBI36
Celera	10	41,502,426 - 41,502,672	RGD
Cytogenetic Map	10	q11	UniSTS
HuRef	10	42,024,618 - 42,024,864	UniSTS

WI-17820

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	10	45,499,740 - 45,499,873	UniSTS	GRCh37
Build 36	10	44,819,746 - 44,819,879	RGD	NCBI36
Celera	10	41,502,914 - 41,503,047	RGD
Cytogenetic Map	10	q11	UniSTS
HuRef	10	42,025,106 - 42,025,239	UniSTS
GeneMap99-GB4 RH Map	10	256.61	UniSTS
Whitehead-RH Map	10	339.3	UniSTS
NCBI RH Map	10	591.5	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
1204	2427	2788	2248	4950	1724	2342	3	623	1948	465	2268	7284	6458	51	3714	849	1733	1607	171


RefSeq Transcripts	NM_006963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK291508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK312278	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL353801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AU310379	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY137767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC010642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC026193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC041139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC053687	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BT009806	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068268	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M77172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S50223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X52346	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000298299 ⟹ ENSP00000298299

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	10	45,000,923 - 45,005,326 (+)	Ensembl

RefSeq Acc Id:

NM_006963 ⟹ NP_008894

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	10	45,000,923 - 45,005,326 (+)	NCBI
GRCh37	10	45,496,273 - 45,500,777 (+)	RGD
Build 36	10	44,815,928 - 44,820,780 (+)	NCBI Archive
Celera	10	41,499,447 - 41,503,956 (+)	RGD
HuRef	10	42,021,639 - 42,026,148 (+)	RGD
CHM1_1	10	45,535,250 - 45,539,759 (+)	NCBI
T2T-CHM13v2.0	10	45,881,879 - 45,886,287 (+)	NCBI

Sequence:

show sequence

ACTTCCGGCGGCGCGGGAGGCGCCCAGCGAGCCAGAGTGGTGGCTGGTCCCGCGCGAAAATTCTGAGCTGTACACCTCTAGGAAATGAAACACTAGTTCAGAAGAAGCCTGTAAACTCTCTTACAAAT
ACATTTGGTTATTCACCATGAGGTTAGCAAAGCCTAAAGCGGGTATTTCTCGGAGCTCAAGCCAAGGAAAGGCCTATGAGAACAAGCGCAAAACAGGCCGGCAGCGGCAGAAGTGGGGCATGACTATT
CGATTTGACTCAAGCTTCAGTAGACTCAGAAGAAGCTTGGATGACAAACCCTATAAATGTACTGAATGTGAAAAGAGTTTCAGTCAGAGTTCAACTCTTTTTCAACACCAGAAGATCCATACTGGAAA
GAAATCCCATAAATGTGCTGATTGTGGGAAAAGTTTCTTTCAGAGTTCTAATCTCATTCAGCATCGACGGATCCATACGGGGGAAAAGCCCTACAAATGTGATGAGTGTGGAGAAAGCTTCAAACAGA
GCTCAAATCTCATTCAGCACCAGAGAATTCATACTGGAGAAAAACCCTATCAGTGTGATGAGTGTGGCCGGTGTTTCAGCCAGAGCTCCCACCTTATTCAACATCAGAGAACCCACACTGGGGAGAAA
CCCTACCAGTGCAGTGAATGTGGCAAATGTTTCAGTCAGAGCTCTCATCTGAGGCAGCACATGAAGGTGCATAAAGAAGAGAAGCCTCGTAAAACCCGGGGCAAAAATATCAGGGTGAAGACTCACTT
ACCCTCTTGGAAAGCTGGTACAGGAAGGAAGTCTGTGGCTGGTCTCCGTTAAGTATAGGGCTTTTTGACAGCTTTTTGAGACCTCTTAAGAAAAAATAAAAAGTAAAAAATGAAAGGAATCTTTTTTA
GAAATAGAGATGCTTTATAGTAGATCACTTAAATACTGGATCTTTTGCTAGTGTGAAAACATTGGGAATTTAATGACATTATTGAGCTGAAAGAAATTACATGAGTCCAGCTACCCTCATTTCTTTTT
TATGTGACATGGAGCACAAAGAACTGAAAATATGTTTTGAGGGAGCATGACATCCTTGACCTCATTTGAAATTACTTCCATTTTCAAAAACCATCATGTTTTGTAGATACATTTTGAGAAAAACCATC
ATGTTTTGAGGATACATTTGTGAAAGTGCAGGCATGCCAATGACTACTCAGTTTTAGGACTTTCTGTGGAAGAAAAAAGGGAGAAGAAATCAATTCCACTACTTTTGAAGTTCTGCAACAGATGAGAT
TTTGTTTGTAAAGTTTTGTAGTATATTAACCATTGGTTTATCACTCTAGATTCAACATATTAAAATGTATTCAAGCTCACAGATTTTTAATCAGTAAGGCCTATCTATATTAGTTGTCTTTTATTTCT
TCTCCTTGTGGACAGTTGTTAATGAAAGGAGTAAGGATTTCCCTTTTTTTGTTTTGTTTGTTTTGTTTTTTTTAACCAAATTCTTAGAGATACTATAGAATCCAAATGAGAACTGAATTGGACCTCAA
GTCTTCTATTCCTACTAATAGAGTTCTTTGTGATGGTAACTGCTGTGTCGTTTGTTTTCCACAAGTTGGGATGGATTCATGTCGATACATCCCCATGCCCTTGACCTCTTCTGGCATTCTCCTGTGCT
CTGACAAACTGAGCCAGCCTTTTAGATCTACATGAATAAACAAACTATTTTACCAAGAAAAATCTCAGCTTGCTTACTGCTTAATTAAAAACCTACAATTTACACACCTCCCTGCCTTCAAGACTGTG
AGCTTTGGATAGCCCTGCTTAAATGTTTGTCAACAACAAGAGTCGTAATGTGTCAGTACATTGTAGCTCCTTTGAAATTTAACTCTTTCTGTGTTACATGAATTGTTTTAAGGAGTCCGGCAAACATG
TTTCTTCACTTCCATGAGAATGGTGCCAAGTGTCAGACTCTAATGAGCCCTCAGCTCAGGTTTTAATTTCTATTGAATGCTAACATTCTTCTGATTTTTTGGTATCTTTTATAATCATATCGGTTTCT
GCTGTATTAATGACAATTATTCATGAAAATAAAAAATGAAATATTTTGTATACTA

hide sequence


Protein RefSeqs	NP_008894	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA36815	(Get FASTA)	NCBI Sequence Viewer
	AAB24264	(Get FASTA)	NCBI Sequence Viewer
	AAH10642	(Get FASTA)	NCBI Sequence Viewer
	AAH41139	(Get FASTA)	NCBI Sequence Viewer
	AAH53687	(Get FASTA)	NCBI Sequence Viewer
	AAN15804	(Get FASTA)	NCBI Sequence Viewer
	AAP88808	(Get FASTA)	NCBI Sequence Viewer
	BAF84197	(Get FASTA)	NCBI Sequence Viewer
	CAA36572	(Get FASTA)	NCBI Sequence Viewer
	EAW86632	(Get FASTA)	NCBI Sequence Viewer
	EAW86633	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000298299
	ENSP00000298299.3
GenBank Protein	P17026	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_008894 ⟸ NM_006963

- UniProtKB:

Q5T741 (UniProtKB/Swiss-Prot), Q96FM4 (UniProtKB/Swiss-Prot), P17026 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTECEKSFSQSSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESFKQSSNLIQ
HQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRVKTHLPSWKAGTGRKSVAGLR

hide sequence

Ensembl Acc Id:

ENSP00000298299 ⟸ ENST00000298299

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P17026-F1-model_v2	AlphaFold	P17026	1-224	view protein structure

RGD ID:

6788392

Promoter ID:

HG_KWN:9292

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Jurkat

Transcripts:

UC009XMP.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	10	44,818,071 - 44,818,571 (+)	MPROMDB

RGD ID:

7217423

Promoter ID:

EPDNEW_H14456

Type:

initiation region

Name:

ZNF22_2

Description:

zinc finger protein 22

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H14457

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	10	45,000,504 - 45,000,564	EPDNEW

RGD ID:

7217421

Promoter ID:

EPDNEW_H14457

Type:

initiation region

Name:

ZNF22_1

Description:

zinc finger protein 22

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H14456

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	10	45,000,923 - 45,000,983	EPDNEW

Database	Acc Id	Source(s)
COSMIC	ZNF22	COSMIC
Ensembl Genes	ENSG00000165512	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000298299	ENTREZGENE
	ENST00000298299.4	UniProtKB/Swiss-Prot
Gene3D-CATH	Classic Zinc Finger	UniProtKB/Swiss-Prot
GTEx	ENSG00000165512	GTEx
HGNC ID	HGNC:13012	ENTREZGENE
Human Proteome Map	ZNF22	Human Proteome Map
InterPro	Znf_C2H2_sf	UniProtKB/Swiss-Prot
	Znf_C2H2_type	UniProtKB/Swiss-Prot
KEGG Report	hsa:7570	UniProtKB/Swiss-Prot
NCBI Gene	7570	ENTREZGENE
OMIM	194529	OMIM
PANTHER	ZINC FINGER PROTEIN	UniProtKB/Swiss-Prot
	ZINC FINGER PROTEIN 771	UniProtKB/Swiss-Prot
Pfam	zf-C2H2	UniProtKB/Swiss-Prot
PharmGKB	PA37591	PharmGKB
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/Swiss-Prot
	ZINC_FINGER_C2H2_2	UniProtKB/Swiss-Prot
SMART	ZnF_C2H2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57667	UniProtKB/Swiss-Prot
UniProt	P17026	ENTREZGENE
	Q5T741	ENTREZGENE
	Q96FM4	ENTREZGENE
	ZNF22_HUMAN	UniProtKB/Swiss-Prot
UniProt Secondary	Q5T741	UniProtKB/Swiss-Prot
	Q96FM4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-07-17	ZNF22	zinc finger protein 22	ZNF22	zinc finger protein 22 (KOX 15)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message