Symbol:
Hus1
Name:
HUS1 checkpoint clamp component
RGD ID:
1318031
MGI Page
MGI
Description:
Involved in double-strand break repair via homologous recombination; embryo development; and regulation of protein phosphorylation. Acts upstream of or within DNA damage checkpoint signaling; protein phosphorylation; and response to UV. Predicted to be located in nucleus. Predicted to be part of checkpoint clamp complex. Predicted to be active in site of double-strand break. Is expressed in several structures, including brain; exocrine system; gonad; hemolymphoid system gland; and liver. Orthologous to human HUS1 (HUS1 checkpoint clamp component).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
checkpoint protein HUS1; Hus1 homolog; mHus1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HUS1 (HUS1 checkpoint clamp component) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Hus1 (HUS1 checkpoint clamp component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hus1 (HUS1 checkpoint clamp component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HUS1 (HUS1 checkpoint clamp component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HUS1 (HUS1 checkpoint clamp component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hus1 (HUS1 checkpoint clamp component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HUS1 (HUS1 checkpoint clamp component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HUS1 (HUS1 checkpoint clamp component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hus1 (HUS1 checkpoint clamp component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
HUS1 (HUS1 checkpoint clamp component)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Hus1 (HUS1 checkpoint clamp component)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zgc:162895
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
hus-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Hus1-like
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
hus1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 8,943,137 - 8,961,240 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 8,943,137 - 8,961,191 (-) Ensembl GRCm39 Ensembl GRCm38 11 8,993,137 - 9,011,236 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 8,993,137 - 9,011,191 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 8,893,145 - 8,911,140 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 8,893,145 - 8,911,140 (-) NCBI MGSCv36 mm8 Celera 11 9,425,958 - 9,443,972 (-) NCBI Celera Cytogenetic Map 11 A1 NCBI cM Map 11 5.74 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hus1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of HUS1 mRNA CTD PMID:22206623 Hus1 Mouse 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO RGD:1318030 6480464 Metribolone results in increased expression of HUS1 mRNA CTD PMID:19318562 Hus1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1591976 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of HUS1 mRNA CTD PMID:27291303 Hus1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HUS1 mRNA CTD PMID:15310856 Hus1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HUS1 mRNA CTD PMID:21570461 Hus1 Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of HUS1 mRNA CTD PMID:26251327 Hus1 Mouse 4-hydroxynon-2-enal decreases expression EXP 6480464 4-hydroxy-2-nonenal results in decreased expression of HUS1 mRNA CTD PMID:19191707 Hus1 Mouse amiodarone increases expression ISO RGD:1318030 6480464 Amiodarone results in increased expression of HUS1 mRNA CTD PMID:19774075 Hus1 Mouse aristolochic acid A decreases expression ISO RGD:1318030 6480464 aristolochic acid I results in decreased expression of HUS1 mRNA CTD PMID:33212167 Hus1 Mouse arsane affects methylation ISO RGD:1318030 6480464 Arsenic affects the methylation of HUS1 gene CTD PMID:25304211 Hus1 Mouse arsenic atom affects methylation ISO RGD:1318030 6480464 Arsenic affects the methylation of HUS1 gene CTD PMID:25304211 Hus1 Mouse arsenite(3-) multiple interactions ISO RGD:1318030 6480464 arsenite promotes the reaction [G3BP1 protein binds to HUS1 mRNA] CTD PMID:32406909 Hus1 Mouse arsenous acid increases expression ISO RGD:1318030 6480464 Arsenic Trioxide results in increased expression of HUS1 mRNA CTD PMID:22521957 Hus1 Mouse atrazine increases expression ISO RGD:1318030 6480464 Atrazine results in increased expression of HUS1 mRNA CTD PMID:22378314 Hus1 Mouse belinostat increases expression EXP 6480464 belinostat results in increased expression of HUS1 mRNA CTD PMID:29733868 Hus1 Mouse benzo[a]pyrene affects methylation ISO RGD:1318030 6480464 Benzo(a)pyrene affects the methylation of HUS1 promoter CTD PMID:27901495 Hus1 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of HUS1 mRNA CTD PMID:34319233 Hus1 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HUS1 mRNA CTD PMID:21932408 Hus1 Mouse bisphenol A increases methylation ISO RGD:1591976 6480464 bisphenol A results in increased methylation of HUS1 gene CTD PMID:28505145 Hus1 Mouse bisphenol A affects expression ISO RGD:1591976 6480464 bisphenol A affects the expression of HUS1 mRNA CTD PMID:25181051 Hus1 Mouse cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of HUS1 mRNA CTD PMID:20883709 Hus1 Mouse cadmium sulfate decreases expression EXP 6480464 cadmium sulfate results in decreased expression of HUS1 mRNA CTD PMID:19274763 Hus1 Mouse CGP 52608 multiple interactions ISO RGD:1318030 6480464 CGP 52608 promotes the reaction [RORA protein binds to HUS1 gene] CTD PMID:28238834 Hus1 Mouse cisplatin decreases expression ISO RGD:1318030 6480464 Cisplatin results in decreased expression of HUS1 mRNA CTD PMID:27594783 Hus1 Mouse cisplatin multiple interactions ISO RGD:1318030 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of HUS1 mRNA CTD PMID:30871063 Hus1 Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of HUS1 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Hus1 Mouse CU-O LINKAGE increases expression ISO RGD:1318030 6480464 cupric oxide results in increased expression of HUS1 mRNA CTD PMID:22077320 Hus1 Mouse cyclosporin A increases expression ISO RGD:1318030 6480464 Cyclosporine results in increased expression of HUS1 mRNA CTD PMID:25562108 Hus1 Mouse cylindrospermopsin increases expression ISO RGD:1318030 6480464 cylindrospermopsin results in increased expression of HUS1 mRNA CTD PMID:23726867 Hus1 Mouse diarsenic trioxide increases expression ISO RGD:1318030 6480464 Arsenic Trioxide results in increased expression of HUS1 mRNA CTD PMID:22521957 Hus1 Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of HUS1 mRNA CTD PMID:21266533 Hus1 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of HUS1 mRNA CTD PMID:30319688 Hus1 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of HUS1 mRNA CTD PMID:30319688 Hus1 Mouse flutamide increases expression ISO RGD:1591976 6480464 Flutamide results in increased expression of HUS1 mRNA CTD PMID:24136188 Hus1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of HUS1 mRNA CTD PMID:25629700 Hus1 Mouse furosemide affects expression ISO RGD:1591976 6480464 Furosemide affects the expression of HUS1 mRNA CTD PMID:17497460 Hus1 Mouse gentamycin increases expression ISO RGD:1591976 6480464 Gentamicins results in increased expression of HUS1 mRNA CTD PMID:33387578 Hus1 Mouse isotretinoin decreases expression ISO RGD:1318030 6480464 Isotretinoin results in decreased expression of HUS1 mRNA CTD PMID:20436886 Hus1 Mouse ivermectin decreases expression ISO RGD:1318030 6480464 Ivermectin results in decreased expression of HUS1 protein CTD PMID:32959892 Hus1 Mouse maneb multiple interactions EXP 6480464 [Maneb co-treated with Paraquat] results in decreased expression of HUS1 mRNA CTD PMID:36117858 Hus1 Mouse methoxyacetic acid affects expression ISO RGD:1591976 6480464 methoxyacetic acid affects the expression of HUS1 mRNA CTD PMID:20864626 Hus1 Mouse methyl methanesulfonate increases expression ISO RGD:1318030 6480464 Methyl Methanesulfonate results in increased expression of HUS1 mRNA CTD PMID:23649840 Hus1 Mouse myristicin decreases expression ISO RGD:1318030 6480464 myristicin results in decreased expression of HUS1 mRNA CTD PMID:24792648 Hus1 Mouse Nonidet P-40 increases expression ISO RGD:1318030 6480464 Nonidet P-40 results in increased expression of HUS1 mRNA CTD PMID:26552463 Hus1 Mouse okadaic acid increases expression ISO RGD:1318030 6480464 Okadaic Acid results in increased expression of HUS1 mRNA CTD PMID:38832940 Hus1 Mouse ozone multiple interactions ISO RGD:1318030 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of HUS1 mRNA CTD PMID:35430440 Hus1 Mouse paracetamol multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of HUS1 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Hus1 Mouse paraquat multiple interactions EXP 6480464 [Maneb co-treated with Paraquat] results in decreased expression of HUS1 mRNA CTD PMID:36117858 Hus1 Mouse phenobarbital affects expression ISO RGD:1318030 6480464 Phenobarbital affects the expression of HUS1 mRNA CTD PMID:19159669 Hus1 Mouse resveratrol decreases expression ISO RGD:1591976 6480464 Resveratrol results in decreased expression of HUS1 mRNA CTD PMID:33775663 Hus1 Mouse rotenone increases expression ISO RGD:1318030 6480464 Rotenone results in increased expression of HUS1 mRNA CTD PMID:18191903 Hus1 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of HUS1 mRNA CTD PMID:20883709 Hus1 Mouse sodium arsenite increases expression ISO RGD:1318030 6480464 sodium arsenite results in increased expression of HUS1 mRNA CTD PMID:38568856 Hus1 Mouse sunitinib decreases expression ISO RGD:1318030 6480464 Sunitinib results in decreased expression of HUS1 mRNA CTD PMID:31533062 Hus1 Mouse T-2 toxin increases expression ISO RGD:1591976 6480464 T-2 Toxin results in increased expression of HUS1 mRNA CTD PMID:26141394 Hus1 Mouse theophylline decreases expression ISO RGD:1318030 6480464 Theophylline results in decreased expression of HUS1 mRNA CTD PMID:18951874 Hus1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of HUS1 gene CTD PMID:35295148 Hus1 Mouse triphenyl phosphate affects expression ISO RGD:1318030 6480464 triphenyl phosphate affects the expression of HUS1 mRNA CTD PMID:37042841 Hus1 Mouse triptonide decreases expression EXP 6480464 triptonide results in decreased expression of HUS1 mRNA CTD PMID:33045310 Hus1 Mouse urethane increases expression ISO RGD:1318030 6480464 Urethane results in increased expression of HUS1 mRNA CTD PMID:28818685 Hus1 Mouse valproic acid decreases expression ISO RGD:1318030 6480464 Valproic Acid results in decreased expression of HUS1 mRNA CTD PMID:20585447 Hus1 Mouse valproic acid affects expression ISO RGD:1318030 6480464 Valproic Acid affects the expression of HUS1 mRNA CTD PMID:25979313
1,2-dimethylhydrazine (EXP) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3,4-methylenedioxymethamphetamine (EXP) 4-hydroxynon-2-enal (EXP) amiodarone (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) belinostat (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) cadmium dichloride (EXP) cadmium sulfate (EXP) CGP 52608 (ISO) cisplatin (ISO) clofibrate (EXP) CU-O LINKAGE (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) ethanol (EXP) flutamide (ISO) folic acid (EXP) furosemide (ISO) gentamycin (ISO) isotretinoin (ISO) ivermectin (ISO) maneb (EXP) methoxyacetic acid (ISO) methyl methanesulfonate (ISO) myristicin (ISO) Nonidet P-40 (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (EXP) paraquat (EXP) phenobarbital (ISO) resveratrol (ISO) rotenone (ISO) sodium arsenite (EXP,ISO) sunitinib (ISO) T-2 toxin (ISO) theophylline (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) triptonide (EXP) urethane (ISO) valproic acid (ISO)
Hus1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 8,943,137 - 8,961,240 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 8,943,137 - 8,961,191 (-) Ensembl GRCm39 Ensembl GRCm38 11 8,993,137 - 9,011,236 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 8,993,137 - 9,011,191 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 8,893,145 - 8,911,140 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 8,893,145 - 8,911,140 (-) NCBI MGSCv36 mm8 Celera 11 9,425,958 - 9,443,972 (-) NCBI Celera Cytogenetic Map 11 A1 NCBI cM Map 11 5.74 NCBI
HUS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 47,963,288 - 47,979,615 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 47,961,882 - 47,979,615 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 48,002,885 - 48,019,212 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 47,970,308 - 47,985,771 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 47,777,022 - 47,792,486 NCBI Celera 7 48,103,051 - 48,118,524 (-) NCBI Celera Cytogenetic Map 7 p12.3 NCBI HuRef 7 47,888,421 - 47,904,763 (-) NCBI HuRef CHM1_1 7 48,006,647 - 48,022,950 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 48,125,574 - 48,141,862 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 48,042,830 - 48,059,174 (-) NCBI
Hus1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 87,902,458 - 87,917,221 (-) NCBI GRCr8 mRatBN7.2 14 83,688,702 - 83,703,466 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 83,688,708 - 83,703,442 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 88,078,925 - 88,093,608 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 89,318,825 - 89,333,508 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 85,785,994 - 85,800,673 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 89,194,086 - 89,208,825 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 89,194,092 - 89,208,825 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 88,991,462 - 89,006,201 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 89,527,997 - 89,542,730 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 14 82,724,930 - 82,739,682 (-) NCBI Celera Cytogenetic Map 14 q21 NCBI
Hus1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955456 5,465,182 - 5,474,303 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955456 5,465,180 - 5,476,380 (+) NCBI ChiLan1.0 ChiLan1.0
HUS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 52,827,109 - 52,856,425 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 101,151,875 - 101,181,134 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 48,606,848 - 48,622,194 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 48,714,028 - 48,731,038 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 48,714,668 - 48,731,005 (-) Ensembl panpan1.1 panPan2
HUS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 93,596 - 104,908 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 93,626 - 125,597 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 865,769 - 879,528 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 71,091 - 84,888 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 75,012 - 112,036 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 65,830 - 79,607 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 811 - 14,587 (+) NCBI UNSW_CanFamBas_1.0
Hus1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 103,172,833 - 103,202,691 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936478 22,400,111 - 22,414,115 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936478 22,393,952 - 22,414,349 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HUS1
HUS1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 10,826,799 - 10,841,579 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 10,826,846 - 10,841,382 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666062 11,380,792 - 11,397,402 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hus1
.
Predicted Target Of
Count of predictions: 3070 Count of miRNA genes: 801 Interacting mature miRNAs: 1043 Transcripts: ENSMUST00000020683, ENSMUST00000127578, ENSMUST00000129115, ENSMUST00000139877, ENSMUST00000146002, ENSMUST00000152890 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
26884446 Sklq10_m skull length QTL 10, 10 week (mouse) 11 3250000 62890826 Mouse 1302171 Pgia28_m proteoglycan induced arthritis 28 (mouse) Not determined 11 8906097 42906218 Mouse 1357722 Vtbt11_m vertebral trabecular bone trait 11 (mouse) Not determined 11 1 23880487 Mouse 1301765 Skull15_m skull morphology 15 (mouse) Not determined 11 1 25976374 Mouse 1357518 Tgyl1_m triglyceride level 1 (mouse) Not determined 11 6880277 33916219 Mouse 1300599 Cocrb11_m cocaine related behavior 11 (mouse) Not determined 11 2670355 36671472 Mouse 1300661 Lmr6_m leishmaniasis resistance 6 (mouse) Not determined 11 1 25976374 Mouse 13208559 Wght10_m weight 10 (mouse) 11 3950000 88890826 Mouse 13208558 Lgth12_m body length 12 (mouse) 11 3950000 94890826 Mouse 27095925 Pglq5_m pelvic girdle length QTL 5, 5 week (mouse) 11 3250000 19750000 Mouse 27226741 Metcl5_m metatarsal-calcaneal length 5, 5 week (mouse) 11 4650000 46290827 Mouse 1300990 Bits3_m bitterness sensitivity 3 (mouse) Not determined 11 8372121 42372260 Mouse 27226738 Metcl11_m metatarsal-calcaneal length 11, 10 week (mouse) 11 8850000 61390826 Mouse 27226735 Metcl16_m metatarsal-calcaneal length 16, 16 week (mouse) 11 5250000 35090827 Mouse 10044008 Hbnr15_m Heligmosomoides bakeri nematode resistance 15 (mouse) Not determined 11 227052 34227232 Mouse 27226798 Scvln18_m sacral vertebrae length 2, 16 week (mouse) 11 3250000 60690826 Mouse 27095919 Pglq10_m pelvic girdle length QTL 10, 10 week (mouse) 11 3250000 18450000 Mouse 1300768 Tshp9_m tooth shape 9 (mouse) Not determined 11 1 25976374 Mouse 10053676 Eae44a_m experimental allergic encephalomyelitis susceptibility 44a (mouse) Not determined 11 4507896 21379532 Mouse 27226794 Feml9_m femur length 9, 5 week (mouse) 11 7050000 16750000 Mouse 27095914 Pglq16_m pelvic girdle length QTL 16, 16 week (mouse) 11 3250000 18150000 Mouse 27095909 Scvln6_m sacral vertebrae length 2, 5 week (mouse) 11 3250000 44090827 Mouse 1300905 Scc6_m colon tumor susceptibility 6 (mouse) Not determined 11 6880277 89019734 Mouse 27095904 Scvln12_m sacral vertebrae length 2, 10 week (mouse) 11 3250000 34495048 Mouse 26884453 Sklq16_m skull length QTL 16, 16 week (mouse) 11 3250000 72690826 Mouse
AF076845
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 8,996,766 - 8,996,859 UniSTS GRCm38 MGSCv37 11 8,896,769 - 8,896,862 UniSTS GRCm37 Celera 11 9,429,582 - 9,429,675 UniSTS Cytogenetic Map 11 A1 UniSTS cM Map 11 3.0 UniSTS Whitehead/MRC_RH 11 43.67 UniSTS
D10Mit157.2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 D1 UniSTS Cytogenetic Map 16 B4 UniSTS Cytogenetic Map 18 E2 UniSTS Cytogenetic Map 4 C3 UniSTS Cytogenetic Map 7 B2 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 14 E2.2 UniSTS Cytogenetic Map 4 C7 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 1 F UniSTS Cytogenetic Map 6 C3 UniSTS Cytogenetic Map 11 D UniSTS Cytogenetic Map 3 G2 UniSTS Cytogenetic Map 17 A1 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 3 B UniSTS Cytogenetic Map 8 C1 UniSTS Cytogenetic Map 18 A2 UniSTS Cytogenetic Map 3 F2 UniSTS Cytogenetic Map 14 C3 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 8 E2 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 18 B1 UniSTS Cytogenetic Map 9 C UniSTS Cytogenetic Map 14 C2 UniSTS Cytogenetic Map 6 A1 UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 13 D2.1 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 11 B1.3 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 17 E3 UniSTS Cytogenetic Map 11 B3 UniSTS Cytogenetic Map 1 H4 UniSTS Cytogenetic Map 6 A3 UniSTS Cytogenetic Map 5 E4-E5 UniSTS Cytogenetic Map 15 E1 UniSTS Cytogenetic Map 13 D UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 14 D1 UniSTS Cytogenetic Map 7 B4 UniSTS Cytogenetic Map 8 D3 UniSTS Cytogenetic Map X D UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 7 E2 UniSTS Cytogenetic Map 1 H2.3 UniSTS Cytogenetic Map 7 A2 UniSTS Cytogenetic Map 7 F3 UniSTS Cytogenetic Map 9 F1 UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 15 D2 UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 16 B2 UniSTS Cytogenetic Map 7 C UniSTS Cytogenetic Map 3 F2.1 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 1 C4 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 9 F3 UniSTS Cytogenetic Map 2 B UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 9 A4 UniSTS Cytogenetic Map 5 A3 UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 16 B1 UniSTS Cytogenetic Map 1 A5 UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 9 E1 UniSTS Cytogenetic Map 6 G1 UniSTS Cytogenetic Map X A2 UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 5 E2 UniSTS Cytogenetic Map 12 C1 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 10 C2 UniSTS Cytogenetic Map 9 B UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 10 A4 UniSTS Cytogenetic Map 8 A2 UniSTS Cytogenetic Map 18 A1 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 1 C2 UniSTS Cytogenetic Map 11 B2 UniSTS Cytogenetic Map 6 E3 UniSTS Cytogenetic Map 5 C3.3 UniSTS Cytogenetic Map 1 B UniSTS Cytogenetic Map 17 A3.1 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 4 B1 UniSTS Cytogenetic Map 15 A2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 5 G3 UniSTS Cytogenetic Map 4 A3 UniSTS Cytogenetic Map 2 H3 UniSTS Cytogenetic Map 8 A1 UniSTS Cytogenetic Map 8 A1.1 UniSTS Cytogenetic Map 16 A3 UniSTS Cytogenetic Map 10 B1 UniSTS Cytogenetic Map 19 A UniSTS Cytogenetic Map 10 A1 UniSTS Cytogenetic Map 13 D1 UniSTS Cytogenetic Map 4 A1 UniSTS Cytogenetic Map 9 A3 UniSTS Cytogenetic Map 17 C UniSTS Cytogenetic Map 1 D UniSTS Cytogenetic Map 5 E3 UniSTS Cytogenetic Map 15 D3 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 7 D3 UniSTS Cytogenetic Map 2 A1 UniSTS Cytogenetic Map 14 C1 UniSTS Cytogenetic Map 14 E5 UniSTS Cytogenetic Map 10 C UniSTS Cytogenetic Map 18 B2 UniSTS Cytogenetic Map 2 F1 UniSTS Cytogenetic Map 10 D3 UniSTS Cytogenetic Map 17 A2 UniSTS Cytogenetic Map 2 C3 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 17 B2 UniSTS Cytogenetic Map 5 B2 UniSTS Cytogenetic Map 5 G1 UniSTS Cytogenetic Map 4 C6 UniSTS Cytogenetic Map 13 C3 UniSTS Cytogenetic Map 2 E1 UniSTS Cytogenetic Map 17 A3.2-A3.3 UniSTS Cytogenetic Map 19 C3 UniSTS Cytogenetic Map 7 E3 UniSTS Cytogenetic Map 13 C1 UniSTS Cytogenetic Map 9 E3.1 UniSTS Cytogenetic Map 15 E3 UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X E3 UniSTS Cytogenetic Map 4 C4 UniSTS Cytogenetic Map 3 E3 UniSTS Cytogenetic Map 11 A4 UniSTS Cytogenetic Map 4 C5 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 9 A2 UniSTS Cytogenetic Map 7 E1 UniSTS Cytogenetic Map 5 D-E1 UniSTS Cytogenetic Map 5 B3 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 5 A2 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 1 E4 UniSTS Cytogenetic Map 17 E4 UniSTS Cytogenetic Map 1 G2 UniSTS Cytogenetic Map 15 B3.1 UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 6 A3.3 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 6 F2 UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 4 D2.1 UniSTS Cytogenetic Map 4 A5 UniSTS Cytogenetic Map 3 F2.2 UniSTS Cytogenetic Map 1 E3-E4 UniSTS Cytogenetic Map 9 F1-F3 UniSTS Cytogenetic Map 1 C1.1 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 12 A2 UniSTS Cytogenetic Map 17 A3-B UniSTS Cytogenetic Map 7 F5 UniSTS Cytogenetic Map 14 A3 UniSTS Cytogenetic Map 5 G1.1 UniSTS Cytogenetic Map X F2-F4 UniSTS Cytogenetic Map 7 D2 UniSTS Cytogenetic Map 2 F3 UniSTS Cytogenetic Map 10 A3 UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 9 F1-F2 UniSTS Cytogenetic Map 13 A3.2 UniSTS Cytogenetic Map 10 A2 UniSTS Cytogenetic Map 1 C1 UniSTS Cytogenetic Map 1 A1 UniSTS Cytogenetic Map 12 D3 UniSTS Cytogenetic Map 1 A3-A5 UniSTS Cytogenetic Map 2 A2 UniSTS Cytogenetic Map 3 A1 UniSTS Cytogenetic Map X A3.3 UniSTS Cytogenetic Map 16 A-B1 UniSTS Cytogenetic Map 1 D2.3 UniSTS Cytogenetic Map 6 B2.3 UniSTS Cytogenetic Map 2 G3 UniSTS Cytogenetic Map X A2-A3.1 UniSTS Cytogenetic Map 9 A5.3 UniSTS Cytogenetic Map 14 A2-B UniSTS Cytogenetic Map 8 E1-E2 UniSTS Cytogenetic Map 8 A3 UniSTS Cytogenetic Map 1 G3-H1 UniSTS Cytogenetic Map 8 B3-C1 UniSTS Cytogenetic Map 19 C1 UniSTS Cytogenetic Map 8 C5 UniSTS Cytogenetic Map 8 A4 UniSTS Cytogenetic Map 15 F3 UniSTS Cytogenetic Map 14 E4 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map X F5 UniSTS cM Map 10 40.0 UniSTS Whitehead Genetic 10 33.9 UniSTS
Hus1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 8,996,649 - 8,996,870 UniSTS GRCm38 MGSCv37 11 8,896,652 - 8,896,873 UniSTS GRCm37 Celera 11 9,429,465 - 9,429,686 UniSTS Cytogenetic Map 11 A1 UniSTS cM Map 11 3.0 UniSTS
AF076845
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 8,996,746 - 8,996,840 UniSTS GRCm38 MGSCv37 11 8,896,749 - 8,896,843 UniSTS GRCm37 Celera 11 9,429,562 - 9,429,656 UniSTS Cytogenetic Map 11 A1 UniSTS Whitehead/MRC_RH 11 43.77 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000020683 ⟹ ENSMUSP00000020683
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 8,943,137 - 8,961,191 (-) Ensembl GRCm38.p6 Ensembl 11 8,993,137 - 9,011,191 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000127578
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 8,955,989 - 8,961,128 (-) Ensembl GRCm38.p6 Ensembl 11 9,005,989 - 9,011,128 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000129115 ⟹ ENSMUSP00000114339
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 8,943,137 - 8,961,160 (-) Ensembl GRCm38.p6 Ensembl 11 8,993,137 - 9,011,160 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000139877
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 8,947,340 - 8,961,164 (-) Ensembl GRCm38.p6 Ensembl 11 8,997,340 - 9,011,164 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000146002
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 8,948,739 - 8,960,678 (-) Ensembl GRCm38.p6 Ensembl 11 8,998,739 - 9,010,678 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000152890
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 8,945,356 - 8,961,128 (-) Ensembl GRCm38.p6 Ensembl 11 8,995,356 - 9,011,128 (-) Ensembl
RefSeq Acc Id:
NM_001303532 ⟹ NP_001290461
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 8,943,137 - 8,961,191 (-) NCBI GRCm38 11 8,993,137 - 9,011,191 (-) NCBI Celera 11 9,425,953 - 9,444,026 (-) NCBI
Sequence:
GCCCAGGTTTCCCCGCCGGGACGCTCAGGGAGGGACTTTTGTCCGCCTTGGACCAACGCCGCCGTCGGCCTGGTATCCGCCATGAAGTTTCGCGCCAAGATCGTGGACCTGGCTTGTCTGAATCATTT
hide sequence
RefSeq Acc Id:
NM_001303610 ⟹ NP_001290539
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 8,943,137 - 8,961,191 (-) NCBI GRCm38 11 8,993,137 - 9,011,191 (-) NCBI Celera 11 9,425,953 - 9,444,026 (-) NCBI
Sequence:
GCCCAGGTTTCCCCGCCGGGACGCTCAGGGAGGGACTTTTGTCCGCCTTGGACCAACGCCGCCG
hide sequence
RefSeq Acc Id:
NM_008316 ⟹ NP_032342
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 8,943,137 - 8,961,191 (-) NCBI GRCm38 11 8,993,137 - 9,011,191 (-) NCBI MGSCv37 11 8,893,145 - 8,911,140 (-) RGD Celera 11 9,425,953 - 9,444,026 (-) NCBI cM Map 11 ENTREZGENE
Sequence:
GCCCAGGTTTCCCCGCCGGGACGCTCAGGGAGGGACTTTTGTCCGCCTTGGACCAACGCCGCCG
hide sequence
RefSeq Acc Id:
NR_130178
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 8,943,137 - 8,961,191 (-) NCBI GRCm38 11 8,993,137 - 9,011,191 (-) NCBI Celera 11 9,425,953 - 9,444,026 (-) NCBI
Sequence:
GCCCAGGTTTCCCCGCCGGGACGCTCAGGGAGGGACTTTTGTCCGCCTTGGACCAACGCCGCCGTCGGCCTGGTATCCGCCATGAAGTTTCGCGCCAAGATCGTGGACCTGGCTTGTCTGAATCATTT
hide sequence
RefSeq Acc Id:
XM_006514531 ⟹ XP_006514594
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 8,946,939 - 8,961,240 (-) NCBI GRCm38 11 8,996,939 - 9,011,236 (-) NCBI
Sequence:
TGGGCGGACCTCTCCGGCCGCACCATCCCCACGGAACCTCTGTGCCCGCGCCCAGGTTTCCCCGCCGGGACGCTCAGGGAGGGACTTTTGTCCGCCTTGGACCAACGCCGCCGTCGGCCTGGTATCCG
hide sequence
RefSeq Acc Id:
XR_004936781
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 8,943,137 - 8,961,232 (-) NCBI
Sequence:
CCTCTCCGGCCGCACCATCCCCACGGAACCTCTGTGCCCGCGCCCAGGTTTCCCCGCCGGGACG
hide sequence
RefSeq Acc Id:
NP_032342 ⟸ NM_008316
- Peptide Label:
isoform 1
- UniProtKB:
Q8BQY8 (UniProtKB/Swiss-Prot)
- Sequence:
MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCDKLASGGVSMWCELEQENFFSEFQMEGVSEENNEIYLELTSENLSRALKTAQNSRALKIKLTNKHFPCLTVSVELQVSSSSSSR
hide sequence
RefSeq Acc Id:
XP_006514594 ⟸ XM_006514531
- Peptide Label:
isoform X1
- UniProtKB:
Q8BQY8 (UniProtKB/Swiss-Prot)
- Sequence:
MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCDKLASGGVSMWCELEQENFF
hide sequence
RefSeq Acc Id:
NP_001290461 ⟸ NM_001303532
- Peptide Label:
isoform 2
- UniProtKB:
O70543 (UniProtKB/Swiss-Prot), Q6P8H5 (UniProtKB/Swiss-Prot), Q8BQY8 (UniProtKB/Swiss-Prot)
- Sequence:
MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCDKLASGGVSMWCELEQENFFSEFQMEGVSEENNEIYLELTSENLSRALKTAQNSRALKIKLTNKHFPCLTVSVELVSSSSSSRI
hide sequence
RefSeq Acc Id:
NP_001290539 ⟸ NM_001303610
- Peptide Label:
isoform 3
- Sequence:
MIAKLAKTCTLRISPEKLNFILCDKLASGGVSMWCELEQENFFSEFQMEGVSEENNEIYLELTS
hide sequence
Ensembl Acc Id:
ENSMUSP00000020683 ⟸ ENSMUST00000020683
Ensembl Acc Id:
ENSMUSP00000114339 ⟸ ENSMUST00000129115
RGD ID: 6821086 Promoter ID: MM_KWN:6418 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000011503, OTTMUST00000011504, OTTMUST00000011505, OTTMUST00000011506, OTTMUST00000011507, OTTMUST00000072684, UC007HZP.1, UC007HZR.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 8,910,849 - 8,911,349 (-) MPROMDB
RGD ID: 8673944 Promoter ID: EPDNEW_M15001 Type: multiple initiation site Name: Hus1_2 Description: Mus musculus HUS1 checkpoint clamp component , transcript variant4, non-coding RNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M15002 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 9,005,616 - 9,005,676 EPDNEW
RGD ID: 8673942 Promoter ID: EPDNEW_M15002 Type: initiation region Name: Hus1_1 Description: Mus musculus HUS1 checkpoint clamp component , transcript variant4, non-coding RNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M15001 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 9,011,128 - 9,011,188 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-29
Hus1
HUS1 checkpoint clamp component
Hus1 homolog (S. pombe)
Symbol and/or name change
5135510 APPROVED
