Symbol:
Bin3
Name:
bridging integrator 3
RGD ID:
1317922
MGI Page
MGI
Description:
Predicted to contribute to lipid binding activity. Acts upstream of or within myoblast migration involved in skeletal muscle regeneration; regulation of lamellipodium assembly; and skeletal muscle fiber development. Located in actin cytoskeleton. Is expressed in several structures, including 1st branchial arch; lens; limb; and testis. Orthologous to human BIN3 (bridging integrator 3).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1700015F07Rik; bridging integrator-3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BIN3 (bridging integrator 3) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Bin3 (bridging integrator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bin3 (bridging integrator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BIN3 (bridging integrator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BIN3 (bridging integrator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BIN3 (bridging integrator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BIN3 (bridging integrator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bin3 (bridging integrator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Bin3 (bridging integrator 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BIN3 (bridging integrator 3)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bin3 (bridging integrator 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RVS161
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
bin3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Related Pseudogenes:
Gm15636
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 70,337,538 - 70,375,413 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 70,337,554 - 70,375,655 (+) Ensembl GRCm39 Ensembl GRCm38 14 70,100,089 - 70,137,964 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 70,100,105 - 70,138,206 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 70,499,952 - 70,538,013 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 68,835,225 - 68,873,286 (+) NCBI MGSCv36 mm8 Celera 14 67,640,607 - 67,678,945 (+) NCBI Celera Cytogenetic Map 14 D2 NCBI cM Map 14 36.21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bin3 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO BIN3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BIN3 mRNA CTD PMID:22079256 Bin3 Mouse 1,2-dichloroethane increases expression EXP 6480464 ethylene dichloride results in increased expression of BIN3 mRNA CTD PMID:28960355 Bin3 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of BIN3 mRNA CTD PMID:22206623 Bin3 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BIN3 mRNA CTD PMID:17942748 Bin3 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BIN3 mRNA CTD PMID:17942748 Bin3 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Bin3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BIN3 mRNA CTD PMID:21215274 Bin3 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Bin3 (Rattus norvegicus) 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of BIN3 mRNA] CTD PMID:21215274 Bin3 Mouse aflatoxin B1 increases methylation ISO BIN3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of BIN3 gene CTD PMID:27153756 Bin3 Mouse aflatoxin B1 affects methylation ISO BIN3 (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of BIN3 intron CTD PMID:30157460 Bin3 Mouse Aflatoxin B2 alpha decreases methylation ISO BIN3 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of BIN3 intron CTD PMID:30157460 Bin3 Mouse all-trans-retinoic acid increases expression ISO BIN3 (Homo sapiens) 6480464 Tretinoin results in increased expression of BIN3 mRNA CTD PMID:33167477 Bin3 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of BIN3 mRNA CTD PMID:20504355 Bin3 Mouse benzo[a]pyrene affects methylation ISO BIN3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BIN3 intron and Benzo(a)pyrene affects the methylation of BIN3 promoter CTD PMID:27901495 and PMID:30157460 Bin3 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO BIN3 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Bin3 Mouse benzo[e]pyrene affects methylation ISO BIN3 (Homo sapiens) 6480464 benzo(e)pyrene affects the methylation of BIN3 intron CTD PMID:30157460 Bin3 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of BIN3 mRNA CTD PMID:34319233 Bin3 Mouse bisphenol A increases expression ISO Bin3 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of BIN3 mRNA CTD PMID:34947998 Bin3 Mouse bisphenol A increases methylation ISO BIN3 (Homo sapiens) 6480464 bisphenol A results in increased methylation of BIN3 gene CTD PMID:31601247 Bin3 Mouse CGP 52608 multiple interactions ISO BIN3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BIN3 gene] CTD PMID:28238834 Bin3 Mouse clofibric acid affects expression ISO Bin3 (Rattus norvegicus) 6480464 Clofibric Acid affects the expression of BIN3 mRNA CTD PMID:17602206 Bin3 Mouse copper(II) sulfate increases expression ISO BIN3 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of BIN3 mRNA CTD PMID:19549813 Bin3 Mouse coumestrol multiple interactions ISO BIN3 (Homo sapiens) 6480464 [Coumestrol co-treated with ESR1 protein] results in increased expression of BIN3 mRNA and ESR2 protein affects the reaction [[Coumestrol co-treated with ESR1 protein] results in increased expression of BIN3 mRNA] CTD PMID:18310284 Bin3 Mouse diazinon affects expression ISO Bin3 (Rattus norvegicus) 6480464 Diazinon affects the expression of BIN3 mRNA CTD PMID:22546817 Bin3 Mouse Dibutyl phosphate affects expression ISO BIN3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of BIN3 mRNA CTD PMID:37042841 Bin3 Mouse dieldrin affects expression ISO Bin3 (Rattus norvegicus) 6480464 Dieldrin affects the expression of BIN3 mRNA CTD PMID:22546817 Bin3 Mouse doxorubicin increases expression ISO BIN3 (Homo sapiens) 6480464 Doxorubicin results in increased expression of BIN3 mRNA CTD PMID:29803840 Bin3 Mouse etoposide affects response to substance ISO BIN3 (Homo sapiens) 6480464 BIN3 protein affects the susceptibility to Etoposide CTD PMID:16217747 Bin3 Mouse flutamide increases expression ISO Bin3 (Rattus norvegicus) 6480464 Flutamide results in increased expression of BIN3 mRNA CTD PMID:24136188 Bin3 Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of BIN3 mRNA CTD PMID:22206623 Bin3 Mouse methapyrilene affects methylation ISO BIN3 (Homo sapiens) 6480464 Methapyrilene affects the methylation of BIN3 intron CTD PMID:30157460 Bin3 Mouse mitomycin C affects response to substance ISO BIN3 (Homo sapiens) 6480464 BIN3 protein affects the susceptibility to Mitomycin CTD PMID:16217747 Bin3 Mouse monosodium L-glutamate multiple interactions EXP 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of BIN3 mRNA CTD PMID:22078008 Bin3 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of BIN3 mRNA CTD PMID:35964746 Bin3 Mouse ozone multiple interactions ISO BIN3 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of BIN3 mRNA CTD PMID:35430440 Bin3 Mouse paclitaxel decreases expression ISO BIN3 (Homo sapiens) 6480464 Paclitaxel results in decreased expression of BIN3 protein CTD PMID:15907983 Bin3 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of BIN3 mRNA CTD PMID:17562736 Bin3 Mouse pirinixic acid multiple interactions ISO BIN3 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of BIN3 mRNA CTD PMID:19710929 Bin3 Mouse potassium chromate multiple interactions ISO BIN3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BIN3 mRNA CTD PMID:22079256 Bin3 Mouse potassium chromate decreases expression ISO BIN3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of BIN3 mRNA CTD PMID:22079256 Bin3 Mouse resveratrol multiple interactions ISO BIN3 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of BIN3 mRNA CTD PMID:23557933 Bin3 Mouse sodium arsenite multiple interactions ISO BIN3 (Homo sapiens) 6480464 sodium arsenite promotes the reaction [BIN3 protein binds to CAPRIN1 protein] CTD PMID:33939924 Bin3 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of BIN3 gene CTD PMID:35295148 Bin3 Mouse triphenyl phosphate affects expression ISO BIN3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BIN3 mRNA CTD PMID:37042841 Bin3 Mouse valproic acid increases methylation ISO BIN3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of BIN3 gene CTD PMID:29154799 Bin3 Mouse valproic acid increases expression ISO BIN3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of BIN3 mRNA CTD PMID:29154799 Bin3 Mouse vinclozolin decreases expression ISO Bin3 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of BIN3 mRNA CTD PMID:23555832
Bin3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 70,337,538 - 70,375,413 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 70,337,554 - 70,375,655 (+) Ensembl GRCm39 Ensembl GRCm38 14 70,100,089 - 70,137,964 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 70,100,105 - 70,138,206 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 70,499,952 - 70,538,013 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 68,835,225 - 68,873,286 (+) NCBI MGSCv36 mm8 Celera 14 67,640,607 - 67,678,945 (+) NCBI Celera Cytogenetic Map 14 D2 NCBI cM Map 14 36.21 NCBI
BIN3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 22,620,418 - 22,669,121 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 22,620,418 - 22,669,148 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 22,477,931 - 22,526,634 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 22,533,876 - 22,582,606 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 22,533,890 - 22,582,540 NCBI Celera 8 21,439,785 - 21,488,652 (-) NCBI Celera Cytogenetic Map 8 p21.3 NCBI HuRef 8 21,021,078 - 21,070,156 (-) NCBI HuRef CHM1_1 8 22,680,143 - 22,728,895 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 22,894,322 - 22,943,373 (-) NCBI T2T-CHM13v2.0
Bin3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 51,583,474 - 51,622,329 (+) NCBI GRCr8 mRatBN7.2 15 45,173,725 - 45,212,607 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 45,173,732 - 45,212,604 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 49,291,591 - 49,330,460 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 50,403,086 - 50,441,954 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 47,262,410 - 47,301,270 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 51,799,339 - 51,818,697 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 51,779,839 - 51,818,699 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 55,525,398 - 55,544,850 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 50,519,884 - 50,539,242 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 50,535,662 - 50,555,015 (+) NCBI Celera 15 44,872,895 - 44,892,253 (+) NCBI Celera Cytogenetic Map 15 p11 NCBI
Bin3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 46,042,885 - 46,085,029 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 46,042,885 - 46,085,029 (-) NCBI ChiLan1.0 ChiLan1.0
BIN3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 41,127,684 - 41,173,953 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 16,852,857 - 16,901,510 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 21,870,784 - 21,919,077 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 18,809,582 - 18,858,912 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 18,809,582 - 18,858,912 (-) Ensembl panpan1.1 panPan2
BIN3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 34,615,683 - 34,659,739 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 34,615,249 - 34,659,755 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 35,205,447 - 35,249,488 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 34,825,227 - 34,869,290 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 34,825,174 - 34,869,586 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 34,771,458 - 34,815,744 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 34,625,780 - 34,669,825 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 34,781,289 - 34,825,349 (+) NCBI UU_Cfam_GSD_1.0
BIN3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 6,874,300 - 6,889,133 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 6,874,281 - 6,926,950 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 7,354,594 - 7,403,650 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BIN3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 20,700,664 - 20,748,775 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 20,701,390 - 20,725,210 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666052 21,478,444 - 21,526,859 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bin3
.
Predicted Target Of
Count of predictions: 366 Count of miRNA genes: 264 Interacting mature miRNAs: 304 Transcripts: ENSMUST00000022680 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1357589 Kdnw2_m kidney weight 2 (mouse) Not determined 14 20887473 121269804 Mouse 1301777 Bglq15_m body growth late QTL 15 (mouse) Not determined 14 42962416 76962593 Mouse 1301489 Lbm10_m lean body mass 10 (mouse) Not determined 14 53761296 87761529 Mouse 1357527 Epfpq1_m epididymal fat percentage QTL 1 (mouse) Not determined 14 21062450 71885801 Mouse 1301424 Skull21_m skull morphology 21 (mouse) Not determined 14 42962416 76962593 Mouse 4142364 Pbwg18_m postnatal body weight growth 18 (mouse) Not determined 14 52281984 86282125 Mouse 4141400 Nilac8_m nicotine induced locomotor activity 8 (mouse) Not determined 14 43065847 77066045 Mouse 10043889 Cia52_m collagen induced arthritis QTL 52 (mouse) Not determined 14 56082381 90082509 Mouse 27226774 Tibl15_m tibia length 15, 10 week (mouse) 14 30321957 87937436 Mouse 1301562 Hwq1_m heart weight quantitative locus 1 (mouse) Not determined 14 56546745 90546941 Mouse 1357565 wrmod1_m wobbler modifier 1 (mouse) Not determined 14 58179640 101859473 Mouse 1300666 Fembm2_m femoral bone morphometry 2 (mouse) Not determined 14 62397460 96397680 Mouse 4142419 Tgq26_m triglyceride QTL 26 (mouse) Not determined 40337319 74337319 Mouse 1300605 El5_m epilepsy 5 (mouse) Not determined 14 49455425 83455556 Mouse 11039527 Ccc2_m colitis susceptibility in the Collaborative Cross 2 (mouse) 14 59918612 94138217 Mouse 1301091 Bbaa21_m B.burgdorferi-associated arthritis 21 (mouse) Not determined 14 43065847 77066045 Mouse 12880432 Fgf23lq3_m FGF23 serum level QTL 3 (mouse) 14 53937440 87937440 Mouse 10043887 Cia50_m collagen induced arthritis QTL 50 (mouse) Not determined 14 37430185 71430320 Mouse 1300805 Mors3_m modifier of obesity related sterility 3 (mouse) Not determined 14 43037270 77037418 Mouse 14747006 Mancz12_m mandible centroid size 12 (mouse) 14 70071977 104071977 Mouse
Bin3
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 14 D2 UniSTS cM Map 14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000022680 ⟹ ENSMUSP00000022680
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 70,337,554 - 70,375,655 (+) Ensembl GRCm38.p6 Ensembl 14 70,100,105 - 70,138,206 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000226385
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 70,337,572 - 70,371,928 (+) Ensembl GRCm38.p6 Ensembl 14 70,100,123 - 70,134,479 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000227841
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 70,337,555 - 70,361,692 (+) Ensembl GRCm38.p6 Ensembl 14 70,100,106 - 70,124,243 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000228049
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 70,337,614 - 70,371,975 (+) Ensembl GRCm38.p6 Ensembl 14 70,100,165 - 70,134,526 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000228717 ⟹ ENSMUSP00000154413
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 70,337,587 - 70,366,331 (+) Ensembl GRCm38.p6 Ensembl 14 70,100,138 - 70,128,882 (+) Ensembl
RefSeq Acc Id:
NM_001360404 ⟹ NP_001347333
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 70,337,542 - 70,375,410 (+) NCBI GRCm38 14 70,100,093 - 70,137,961 (+) NCBI
Sequence:
CCTCATCACTTCCTGGAGACTGGCCGAATCCGGAAGTGATCCTCGAGAACCTACTTTTCTACCGAGGACCCCGGCAGTCGGCGTGGGTTTAGGACCATGAGCTGGATTCCATTTAAGATCGGGCAGCC
hide sequence
RefSeq Acc Id:
NM_021328 ⟹ NP_067303
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 70,337,542 - 70,375,410 (+) NCBI GRCm38 14 70,100,093 - 70,137,961 (+) NCBI MGSCv37 14 70,499,952 - 70,538,013 (+) RGD Celera 14 67,640,607 - 67,678,945 (+) RGD cM Map 14 ENTREZGENE
Sequence:
CCTCATCACTTCCTGGAGACTGGCCGAATCCGGAAGTGATCCTCGAGAACCTACTTTTCTACCGAGGACCCCGGCAGTCGGCGTGGGTTTAGGACCATGAGCTGGATTCCATTTAAGATCGGGCAGCC
hide sequence
RefSeq Acc Id:
XM_006519330 ⟹ XP_006519393
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 70,337,538 - 70,375,413 (+) NCBI GRCm38 14 70,100,089 - 70,137,247 (+) NCBI
Sequence:
TGTCCCTCATCACTTCCTGGAGACTGGCCGAATCCGGAAGTGATCCTCGAGAACCTACTTTTCT
hide sequence
RefSeq Acc Id:
XM_006519332 ⟹ XP_006519395
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 70,337,539 - 70,375,413 (+) NCBI GRCm38 14 70,100,090 - 70,137,964 (+) NCBI
Sequence:
GTCCCTCATCACTTCCTGGAGACTGGCCGAATCCGGAAGTGATCCTCGAGAACCTACTTTTCTA
hide sequence
RefSeq Acc Id:
XM_011245124 ⟹ XP_011243426
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 70,361,290 - 70,375,413 (+) NCBI GRCm38 14 70,123,841 - 70,137,964 (+) NCBI
Sequence:
GTGGAGAGAGACTTTGAAAGGGAGTATGGAAAACTGCAGCAGCTGGAAGAGCAAACTAAACGCCTGCAGAAGGACATGAAGAAAAGCACCGATGCCGACCTGGCCATGTCCAAATCTGCTGTGAAGAT
hide sequence
RefSeq Acc Id:
XM_030247901 ⟹ XP_030103761
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 70,337,539 - 70,375,413 (+) NCBI GRCm38 14 70,100,090 - 70,137,964 (+) NCBI
Sequence:
GTCCCTCATCACTTCCTGGAGACTGGCCGAATCCGGAAGTGATCCTCGAGAACCTACTTTTCTACCGAGGACCCCGGCAGTCGGCGTGGGTTTAGGACCATGAGCTGGATTCCATTTAAGATCGGGCA
hide sequence
RefSeq Acc Id:
XM_030247902 ⟹ XP_030103762
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 70,337,539 - 70,375,413 (+) NCBI GRCm38 14 70,100,090 - 70,137,964 (+) NCBI
Sequence:
GTCCCTCATCACTTCCTGGAGACTGGCCGAATCCGGAAGTGATCCTCGAGAACCTACTTTTCTA
hide sequence
RefSeq Acc Id:
XM_036158770 ⟹ XP_036014663
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 70,337,546 - 70,375,413 (+) NCBI
Sequence:
ATCACTTCCTGGAGACTGGCCGAATCCGGAAGTGATCCTCGAGAACCTACTTTTCTACCGAGGA
hide sequence
RefSeq Acc Id:
XM_036158771 ⟹ XP_036014664
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 70,343,377 - 70,375,413 (+) NCBI
Sequence:
TAGACTTACTCAACACCTCAGCAGCCTATAGGCTAAGCAGACGTTTACCCTATCTTACAGGATTCCATTTAAGATCGGGCAGCCCAAGAAGCAGATTGTTTCCAAAACAGCTGGAAGAGCAAACTAAA
hide sequence
RefSeq Acc Id:
NP_067303 ⟸ NM_021328
- Peptide Label:
isoform 1
- UniProtKB:
Q9JI08 (UniProtKB/Swiss-Prot), Q3TC47 (UniProtKB/TrEMBL)
- Sequence:
MSWIPFKIGQPKKQIVSKTVERDFEREYGKLQQLEEQTKRLQKDMKKSTDADLAMSKSAVKISQDLLSNPLCEQDQDFLHMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFSSIFPSLNMAVKRR
hide sequence
RefSeq Acc Id:
XP_006519393 ⟸ XM_006519330
- Peptide Label:
isoform X1
- UniProtKB:
Q3TC47 (UniProtKB/TrEMBL)
- Sequence:
MSWIPFKIGQPKKQIVSKTVERDFEREYGKLQQLEEQTKRLQKDMKKSTDADLAMSKSAVKISQDLLSNPLCEQDQDFLHMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFSSIFPSLNMAVKRR
hide sequence
RefSeq Acc Id:
XP_006519395 ⟸ XM_006519332
- Peptide Label:
isoform X2
- UniProtKB:
Q3TC47 (UniProtKB/TrEMBL)
- Sequence:
MKKSTDADLAMSKSAVKISQDLLSNPLCEQDQDFLHMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFSSIFPSLNMAVKRREQALQDYGRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDF
hide sequence
RefSeq Acc Id:
XP_011243426 ⟸ XM_011245124
- Peptide Label:
isoform X3
- Sequence:
MAVKRREQALQDYGRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNKQLLDEMPRFYGSRLDYFQPSFESLIRAQVIYYSEMHKIFGDLTQQLDQPGHSDEQRERENETKLSELRALSIV
hide sequence
RefSeq Acc Id:
XP_030103761 ⟸ XM_030247901
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_030103762 ⟸ XM_030247902
- Peptide Label:
isoform X3
RefSeq Acc Id:
NP_001347333 ⟸ NM_001360404
- Peptide Label:
isoform 2
- UniProtKB:
Q3TC47 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000022680 ⟸ ENSMUST00000022680
Ensembl Acc Id:
ENSMUSP00000154413 ⟸ ENSMUST00000228717
RefSeq Acc Id:
XP_036014663 ⟸ XM_036158770
- Peptide Label:
isoform X2
- UniProtKB:
Q3TC47 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036014664 ⟸ XM_036158771
- Peptide Label:
isoform X2
- UniProtKB:
Q3TC47 (UniProtKB/TrEMBL)
RGD ID: 8682880 Promoter ID: EPDNEW_M19471 Type: initiation region Name: Bin3_1 Description: Mus musculus bridging integrator 3 , transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 14 70,100,137 - 70,100,197 EPDNEW
RGD ID: 6824726 Promoter ID: MM_KWN:17355 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000111041 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 14 70,499,614 - 70,500,114 (+) MPROMDB
RGD ID: 6849023 Promoter ID: MM_XEF:2320 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_4Hour Transcripts: NM_001095301 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 14 70,523,776 - 70,524,276 (+) MPROMDB
