Advanced Search (OLGA)

Gene: IRX3 (iroquois homeobox 3) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

IRX3

Name:

iroquois homeobox 3

RGD ID:

1316613

HGNC Page

HGNC:14360

Description:

Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in several processes, including His-Purkinje system development; positive regulation of gap junction assembly; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within mesoderm development; negative regulation of neuron differentiation; and positive regulation of neuron differentiation. Predicted to be located in chromatin. Predicted to be active in nucleus.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

FLJ99187; homeodomain protein IRXB1; iroquois homeobox protein 3; iroquois-class homeodomain protein IRX-1; iroquois-class homeodomain protein IRX-3; IRX-1; IRXB1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Irx3 (Iroquois related homeobox 3)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Irx3 (iroquois homeobox 3)	HGNC	Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Irx3 (iroquois homeobox 3)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	IRX3 (iroquois homeobox 3)	NCBI	Ortholog
Canis lupus familiaris (dog):	IRX3 (iroquois homeobox 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Irx3 (iroquois homeobox 3)	NCBI	Ortholog
Sus scrofa (pig):	IRX3 (iroquois homeobox 3)	HGNC	EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):	IRX3 (iroquois homeobox 3)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Irx3 (iroquois homeobox 3)	NCBI	Ortholog
Other homologs ²
Rattus norvegicus (Norway rat):	Tuba8 (tubulin, alpha 8)	HGNC	OMA
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Irx3 (iroquois homeobox 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Irx3 (Iroquois related homeobox 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	irx3b (iroquois homeobox 3b)	Alliance	DIOPT (Ensembl Compara\|PANTHER\|ZFIN)
Danio rerio (zebrafish):	irx3a (iroquois homeobox 3a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	irx-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ara	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Drosophila melanogaster (fruit fly):	caup	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Drosophila melanogaster (fruit fly):	mirr	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Xenopus laevis (African clawed frog):	irx3.L	Alliance	DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):	irx3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	irx3.S	Alliance	DIOPT (Xenbase)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	54,283,304 - 54,286,787 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	54,283,304 - 54,286,787 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	54,317,216 - 54,320,699 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	52,874,713 - 52,877,879 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	52,874,712 - 52,877,879	NCBI
Celera	16	38,831,683 - 38,834,849 (-)	NCBI		Celera
Cytogenetic Map	16	q12.2	NCBI
HuRef	16	40,203,767 - 40,206,921 (-)	NCBI		HuRef
CHM1_1	16	55,724,203 - 55,727,369 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	60,081,297 - 60,084,780 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IRX3	Human	Chromosome 16q12 Duplication Syndrome		IAGP	RGD:407429775	8554872	ClinVar Annotator: match by term: Chromosome 16q12 duplication syndrome	ClinVar	PMID:25741868
IRX3	Human	Joubert syndrome 1		IAGP	RGD:156447993	8554872	ClinVar Annotator: match by term: Familial aplasia of the vermis	ClinVar	PMID:17558409\|PMID:28492532
IRX3	Human	Joubert syndrome 1		IAGP	RGD:156448002	8554872	ClinVar Annotator: match by term: Familial aplasia of the vermis	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IRX3	Human	lung disease		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21238641

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IRX3	Human	(S)-nicotine	multiple interactions	ISO	RGD:1316614	6480464	[Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of IRX3 mRNA; Nicotine inhibits the reaction more ...	CTD	PMID:20230807
IRX3	Human	1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	multiple interactions	ISO	RGD:1316614	6480464	[Caffeine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of IRX3 mRNA; [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] more ...	CTD	PMID:20230807
IRX3	Human	1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	decreases expression	ISO	RGD:1316614	6480464	1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine results in decreased expression of IRX3 mRNA	CTD	PMID:20230807
IRX3	Human	17alpha-ethynylestradiol	affects expression	ISO	RGD:1316614	6480464	Ethinyl Estradiol affects the expression of IRX3 mRNA	CTD	PMID:17555576
IRX3	Human	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1316614	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of IRX3 mRNA	CTD	PMID:17942748
IRX3	Human	17alpha-ethynylestradiol	decreases expression	ISO	RGD:1316614	6480464	Ethinyl Estradiol results in decreased expression of IRX3 mRNA	CTD	PMID:17942748
IRX3	Human	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of IRX3 mRNA	CTD	PMID:21185374
IRX3	Human	17beta-estradiol	increases expression	ISO	RGD:1316614	6480464	Estradiol results in increased expression of IRX3 mRNA	CTD	PMID:19484750
IRX3	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1316614	6480464	Tetrachlorodibenzodioxin affects the expression of IRX3 mRNA	CTD	PMID:24058054\|PMID:28922406
IRX3	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of IRX3 mRNA	CTD	PMID:20106945\|PMID:21632981\|PMID:26238291
IRX3	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1316614	6480464	Tetrachlorodibenzodioxin results in increased expression of IRX3 mRNA	CTD	PMID:17586704\|PMID:19770486
IRX3	Human	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1316614	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of IRX3 mRNA	CTD	PMID:17942748
IRX3	Human	2-palmitoylglycerol	increases expression	EXP		6480464	2-palmitoylglycerol results in increased expression of IRX3 mRNA	CTD	PMID:37199045
IRX3	Human	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1316614	6480464	bisphenol S results in decreased expression of IRX3 mRNA	CTD	PMID:39298647
IRX3	Human	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1316614	6480464	Fenretinide results in decreased expression of IRX3 mRNA	CTD	PMID:28973697
IRX3	Human	5-aza-2'-deoxycytidine	affects expression	EXP		6480464	Decitabine affects the expression of IRX3 mRNA	CTD	PMID:23300844
IRX3	Human	aflatoxin B1	increases expression	ISO	RGD:1316614	6480464	Aflatoxin B1 results in increased expression of IRX3 mRNA	CTD	PMID:19770486
IRX3	Human	aflatoxin B1	increases methylation	EXP		6480464	Aflatoxin B1 results in increased methylation of IRX3 gene	CTD	PMID:28458013
IRX3	Human	all-trans-retinoic acid	increases expression	ISO	RGD:1316614	6480464	Tretinoin results in increased expression of IRX3 mRNA	CTD	PMID:16604517
IRX3	Human	all-trans-retinoic acid	affects expression	EXP		6480464	Tretinoin affects the expression of IRX3 mRNA	CTD	PMID:31600526
IRX3	Human	all-trans-retinoic acid	increases expression	EXP		6480464	Tretinoin results in increased expression of IRX3 mRNA	CTD	PMID:21934132
IRX3	Human	all-trans-retinoic acid	decreases expression	EXP		6480464	Tretinoin results in decreased expression of IRX3 mRNA	CTD	PMID:17218384\|PMID:33167477
IRX3	Human	arsane	increases methylation	EXP		6480464	Arsenic results in increased methylation of IRX3 gene	CTD	PMID:38030093
IRX3	Human	arsenic atom	increases methylation	EXP		6480464	Arsenic results in increased methylation of IRX3 gene	CTD	PMID:38030093
IRX3	Human	atrazine	affects methylation	ISO	RGD:1307424	6480464	Atrazine affects the methylation of IRX3 gene	CTD	PMID:28931070
IRX3	Human	avobenzone	decreases expression	EXP		6480464	avobenzone results in decreased expression of IRX3 mRNA	CTD	PMID:31016361
IRX3	Human	azathioprine	decreases expression	EXP		6480464	Azathioprine results in decreased expression of IRX3 mRNA	CTD	PMID:22623647
IRX3	Human	benzo[a]pyrene	decreases expression	ISO	RGD:1316614	6480464	Benzo(a)pyrene results in decreased expression of IRX3 mRNA	CTD	PMID:22228805
IRX3	Human	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of IRX3 mRNA	CTD	PMID:26238291
IRX3	Human	bis(2-ethylhexyl) phthalate	multiple interactions	EXP		6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of IRX3 more ...	CTD	PMID:33872906
IRX3	Human	bisphenol A	decreases expression	ISO	RGD:1307424	6480464	bisphenol A results in decreased expression of IRX3 mRNA	CTD	PMID:25181051
IRX3	Human	bisphenol A	increases expression	ISO	RGD:1316614	6480464	bisphenol A results in increased expression of IRX3 mRNA	CTD	PMID:32156529
IRX3	Human	bisphenol A	affects methylation	ISO	RGD:1316614	6480464	bisphenol A affects the methylation of IRX3 promoter	CTD	PMID:27334623
IRX3	Human	butan-1-ol	multiple interactions	EXP		6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ...	CTD	PMID:29432896
IRX3	Human	C60 fullerene	increases expression	ISO	RGD:1307424	6480464	fullerene C60 results in increased expression of IRX3 mRNA	CTD	PMID:19167457
IRX3	Human	cadmium dichloride	increases methylation	ISO	RGD:1307424	6480464	Cadmium Chloride results in increased methylation of IRX3 promoter	CTD	PMID:22457795
IRX3	Human	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of IRX3 mRNA	CTD	PMID:38568856
IRX3	Human	caffeine	multiple interactions	ISO	RGD:1316614	6480464	[Caffeine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of IRX3 mRNA; Caffeine inhibits the reaction more ...	CTD	PMID:20230807
IRX3	Human	calcitriol	decreases expression	EXP		6480464	Calcitriol results in decreased expression of IRX3 mRNA	CTD	PMID:16002434
IRX3	Human	carbamazepine	affects expression	EXP		6480464	Carbamazepine affects the expression of IRX3 mRNA	CTD	PMID:25979313
IRX3	Human	carbon nanotube	decreases expression	ISO	RGD:1316614	6480464	Nanotubes, Carbon analog results in decreased expression of IRX3 mRNA; Nanotubes, Carbon results in decreased more ...	CTD	PMID:25554681
IRX3	Human	chlorpyrifos	increases expression	ISO	RGD:1316614	6480464	Chlorpyrifos results in increased expression of IRX3 mRNA	CTD	PMID:37019170
IRX3	Human	cisplatin	affects expression	EXP		6480464	Cisplatin affects the expression of IRX3 mRNA	CTD	PMID:23300844
IRX3	Human	cisplatin	multiple interactions	EXP		6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of IRX3 mRNA	CTD	PMID:27392435
IRX3	Human	copper(II) chloride	decreases expression	EXP		6480464	cupric chloride results in decreased expression of IRX3 mRNA	CTD	PMID:38568856
IRX3	Human	copper(II) sulfate	decreases expression	EXP		6480464	Copper Sulfate results in decreased expression of IRX3 mRNA	CTD	PMID:19549813
IRX3	Human	cyclosporin A	increases expression	ISO	RGD:1316614	6480464	Cyclosporine results in increased expression of IRX3 mRNA	CTD	PMID:19770486
IRX3	Human	cyclosporin A	decreases expression	EXP		6480464	Cyclosporine results in decreased expression of IRX3 mRNA	CTD	PMID:20106945\|PMID:25562108
IRX3	Human	decabromodiphenyl ether	increases expression	ISO	RGD:1307424	6480464	decabromobiphenyl ether results in increased expression of IRX3 mRNA	CTD	PMID:23914054
IRX3	Human	diethyl phthalate	decreases expression	ISO	RGD:1307424	6480464	diethyl phthalate results in decreased expression of IRX3 mRNA	CTD	PMID:32341500
IRX3	Human	dioxygen	multiple interactions	ISO	RGD:1316614	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of IRX3 mRNA	CTD	PMID:30529165
IRX3	Human	dorsomorphin	multiple interactions	EXP		6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
IRX3	Human	doxorubicin	decreases expression	EXP		6480464	Doxorubicin results in decreased expression of IRX3 mRNA	CTD	PMID:29803840
IRX3	Human	entinostat	increases expression	EXP		6480464	entinostat results in increased expression of IRX3 mRNA	CTD	PMID:26272509
IRX3	Human	entinostat	multiple interactions	EXP		6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
IRX3	Human	epoxiconazole	increases expression	ISO	RGD:1316614	6480464	epoxiconazole results in increased expression of IRX3 mRNA	CTD	PMID:35436446
IRX3	Human	formaldehyde	decreases expression	EXP		6480464	Formaldehyde results in decreased expression of IRX3 mRNA	CTD	PMID:20655997
IRX3	Human	furan	decreases expression	ISO	RGD:1307424	6480464	furan results in decreased expression of IRX3 mRNA	CTD	PMID:27387713
IRX3	Human	hydralazine	multiple interactions	EXP		6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of IRX3 mRNA	CTD	PMID:17183730
IRX3	Human	methylmercury chloride	increases expression	EXP		6480464	methylmercuric chloride results in increased expression of IRX3 mRNA	CTD	PMID:26272509
IRX3	Human	methylmercury chloride	multiple interactions	EXP		6480464	[NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
IRX3	Human	mono(2-ethylhexyl) phthalate	affects expression	ISO	RGD:1316614	6480464	mono-(2-ethylhexyl)phthalate affects the expression of IRX3 mRNA	CTD	PMID:21195148
IRX3	Human	mono(2-ethylhexyl) phthalate	multiple interactions	EXP		6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of IRX3 more ...	CTD	PMID:33872906
IRX3	Human	Monobutylphthalate	affects expression	ISO	RGD:1316614	6480464	monobutyl phthalate affects the expression of IRX3 mRNA	CTD	PMID:21195148
IRX3	Human	Monobutylphthalate	increases expression	ISO	RGD:1307424	6480464	monobutyl phthalate results in increased expression of IRX3 mRNA	CTD	PMID:29162477
IRX3	Human	N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal	decreases expression	ISO	RGD:1316614	6480464	benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of IRX3 mRNA	CTD	PMID:25566086
IRX3	Human	N-nitrosodiethylamine	increases expression	ISO	RGD:1316614	6480464	Diethylnitrosamine results in increased expression of IRX3 mRNA	CTD	PMID:24535843
IRX3	Human	nicotine	multiple interactions	ISO	RGD:1316614	6480464	[Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of IRX3 mRNA; Nicotine inhibits the reaction more ...	CTD	PMID:20230807
IRX3	Human	nitrofen	increases expression	ISO	RGD:1307424	6480464	nitrofen results in increased expression of IRX3 mRNA; nitrofen results in increased expression of IRX3 more ...	CTD	PMID:21238641
IRX3	Human	oxaliplatin	multiple interactions	ISO	RGD:1307424	6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of IRX3 mRNA; [Topotecan co-treated with oxaliplatin] more ...	CTD	PMID:25729387
IRX3	Human	oxaliplatin	increases expression	ISO	RGD:1307424	6480464	oxaliplatin results in increased expression of IRX3 mRNA	CTD	PMID:25729387
IRX3	Human	panobinostat	multiple interactions	EXP		6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
IRX3	Human	panobinostat	increases expression	EXP		6480464	panobinostat results in increased expression of IRX3 mRNA	CTD	PMID:26272509
IRX3	Human	perfluorohexanesulfonic acid	decreases expression	ISO	RGD:1316614	6480464	perfluorohexanesulfonic acid results in decreased expression of IRX3 mRNA	CTD	PMID:37995155
IRX3	Human	pirinixic acid	multiple interactions	ISO	RGD:1316614	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
IRX3	Human	quercetin	decreases expression	EXP		6480464	Quercetin results in decreased expression of IRX3 mRNA	CTD	PMID:21632981
IRX3	Human	resveratrol	multiple interactions	EXP		6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of IRX3 mRNA	CTD	PMID:23557933
IRX3	Human	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of IRX3 mRNA	CTD	PMID:29955902
IRX3	Human	SB 431542	multiple interactions	EXP		6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
IRX3	Human	silicon dioxide	increases expression	EXP		6480464	Silicon Dioxide analog results in increased expression of IRX3 mRNA	CTD	PMID:23806026
IRX3	Human	silver atom	decreases expression	EXP		6480464	Silver results in decreased expression of IRX3 mRNA	CTD	PMID:26014281
IRX3	Human	silver(0)	decreases expression	EXP		6480464	Silver results in decreased expression of IRX3 mRNA	CTD	PMID:26014281
IRX3	Human	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of IRX3 mRNA	CTD	PMID:38568856
IRX3	Human	sodium dodecyl sulfate	decreases expression	EXP		6480464	Sodium Dodecyl Sulfate results in decreased expression of IRX3 mRNA	CTD	PMID:31734321
IRX3	Human	tamoxifen	affects expression	ISO	RGD:1316614	6480464	Tamoxifen affects the expression of IRX3 mRNA	CTD	PMID:17555576
IRX3	Human	temozolomide	decreases expression	EXP		6480464	Temozolomide results in decreased expression of IRX3 mRNA	CTD	PMID:31758290
IRX3	Human	testosterone	increases expression	ISO	RGD:1316614	6480464	Testosterone deficiency results in increased expression of IRX3 mRNA	CTD	PMID:33848595
IRX3	Human	testosterone	increases expression	EXP		6480464	Testosterone results in increased expression of IRX3 mRNA	CTD	PMID:33359661
IRX3	Human	thapsigargin	decreases expression	EXP		6480464	Thapsigargin results in decreased expression of IRX3 mRNA	CTD	PMID:29453283
IRX3	Human	thioacetamide	increases expression	ISO	RGD:1307424	6480464	Thioacetamide results in increased expression of IRX3 mRNA	CTD	PMID:34492290
IRX3	Human	thiram	decreases expression	EXP		6480464	Thiram results in decreased expression of IRX3 mRNA	CTD	PMID:38568856
IRX3	Human	titanium dioxide	decreases methylation	ISO	RGD:1316614	6480464	titanium dioxide results in decreased methylation of IRX3 enhancer; titanium dioxide results in decreased methylation more ...	CTD	PMID:35295148
IRX3	Human	topotecan	multiple interactions	ISO	RGD:1307424	6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of IRX3 mRNA; [Topotecan co-treated with oxaliplatin] more ...	CTD	PMID:25729387
IRX3	Human	topotecan	increases expression	ISO	RGD:1307424	6480464	Topotecan results in increased expression of IRX3 mRNA	CTD	PMID:25729387
IRX3	Human	trichostatin A	increases expression	EXP		6480464	trichostatin A results in increased expression of IRX3 mRNA	CTD	PMID:24935251\|PMID:26272509
IRX3	Human	trichostatin A	multiple interactions	EXP		6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
IRX3	Human	triclosan	decreases expression	EXP		6480464	Triclosan results in decreased expression of IRX3 mRNA	CTD	PMID:30510588
IRX3	Human	troglitazone	decreases expression	ISO	RGD:1316614	6480464	troglitazone results in decreased expression of IRX3 mRNA	CTD	PMID:12732648
IRX3	Human	urethane	decreases expression	EXP		6480464	Urethane results in decreased expression of IRX3 mRNA	CTD	PMID:28818685
IRX3	Human	valproic acid	multiple interactions	EXP		6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of IRX3 mRNA; [NOG protein co-treated more ...	CTD	PMID:17183730\|PMID:27188386
IRX3	Human	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of IRX3 mRNA	CTD	PMID:23179753\|PMID:27188386
IRX3	Human	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of IRX3 mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:26272509\|PMID:29154799
IRX3	Human	valproic acid	increases methylation	EXP		6480464	Valproic Acid results in increased methylation of IRX3 gene	CTD	PMID:29154799
IRX3	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of IRX3 mRNA	CTD	PMID:25979313
IRX3	Human	vinclozolin	affects expression	ISO	RGD:1307424	6480464	vinclozolin affects the expression of IRX3 mRNA	CTD	PMID:19015723
IRX3	Human	zoledronic acid	decreases expression	EXP		6480464	zoledronic acid results in decreased expression of IRX3 mRNA	CTD	PMID:24714768

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IRX3	Human	atrioventricular bundle cell differentiation	involved_in	ISS	UniProtKB:P81067	150520179		BHF-UCL	GO_REF:0000024
IRX3	Human	atrioventricular bundle cell differentiation	involved_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	cell development	involved_in	IBA	FB:FBgn0014343\|FB:FBgn0015904\|MGI:1859086\|PANTHER:PTN002257217\|UniProtKB:A0A8M9PJE4\|WB:WBGene00007984\|ZFIN:ZDB-GENE-040707-1	150520179		GO_Central	GO_REF:0000033
IRX3	Human	energy homeostasis	involved_in	ISS	UniProtKB:P81067	150520179		UniProt	GO_REF:0000024
IRX3	Human	energy homeostasis	involved_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	His-Purkinje system cell differentiation	involved_in	ISS	UniProtKB:P81067	150520179		BHF-UCL	GO_REF:0000024
IRX3	Human	His-Purkinje system cell differentiation	involved_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	mesoderm development	acts_upstream_of_or_within	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	metanephros development	involved_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	negative regulation of neuron differentiation	acts_upstream_of_or_within	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	negative regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	negative regulation of transcription by RNA polymerase II	involved_in	ISS	UniProtKB:P81067	150520179	PMID:21825130	BHF-UCL	PMID:21825130
IRX3	Human	neuron differentiation	involved_in	IBA	FB:FBgn0014343\|FB:FBgn0015904\|MGI:1197522\|MGI:1859086\|MGI:1927642\|PANTHER:PTN000129978\|UniProtKB:A0A8M9PJE4\|WB:WBGene00007984\|ZFIN:ZDB-GENE-020103-1\|ZFIN:ZDB-GENE-040707-1	150520179		GO_Central	GO_REF:0000033
IRX3	Human	neuron differentiation	acts_upstream_of	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	positive regulation of gap junction assembly	involved_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	positive regulation of gap junction assembly	involved_in	ISS	UniProtKB:P81067	150520179	PMID:21825130	BHF-UCL	GO_REF:0000024\|PMID:21825130
IRX3	Human	positive regulation of neuron differentiation	acts_upstream_of_or_within	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	positive regulation of transcription by RNA polymerase II	involved_in	ISS	UniProtKB:P81067	150520179	PMID:21825130	BHF-UCL	PMID:21825130
IRX3	Human	positive regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	proximal/distal pattern formation involved in nephron development	involved_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	Purkinje myocyte development	involved_in	ISS	UniProtKB:P81067	150520179		BHF-UCL	GO_REF:0000024
IRX3	Human	Purkinje myocyte development	involved_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	regulation of cell communication by electrical coupling involved in cardiac conduction	acts_upstream_of	ISS	UniProtKB:P81067	150520179	PMID:21825130	BHF-UCL	PMID:21825130
IRX3	Human	regulation of cell communication by electrical coupling involved in cardiac conduction	acts_upstream_of	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR003893\|InterPro:IPR008422\|InterPro:IPR017970	150520179		InterPro	GO_REF:0000002
IRX3	Human	regulation of transcription by RNA polymerase II	involved_in	IBA	FB:FBgn0014343\|FB:FBgn0015904\|MGI:1197522\|MGI:2687286\|PANTHER:PTN002257217\|RGD:1309309\|RGD:1565518\|UniProtKB:P78414\|UniProtKB:Q9BZI1\|WB:WBGene00007984	150520179		GO_Central	GO_REF:0000033
IRX3	Human	specification of loop of Henle identity	involved_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IRX3	Human	axon	located_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	chromatin	located_in	ISA	tfclass:3.1.4	150520179		NTNU_SB	GO_REF:0000113
IRX3	Human	cytoplasm	located_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	nucleus	located_in	IEA	InterPro:IPR003893	150520179		InterPro	GO_REF:0000002
IRX3	Human	nucleus	located_in	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	nucleus	is_active_in	IBA	MGI:1197522\|PANTHER:PTN002257217\|WB:WBGene00007984	150520179		GO_Central	GO_REF:0000033
IRX3	Human	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043
IRX3	Human	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	150520179		UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IRX3	Human	DNA binding	enables	IEA	UniProtKB-KW:KW-0238\|UniProtKB-KW:KW-0371	150520179		UniProt	GO_REF:0000043
IRX3	Human	DNA binding	enables	IEA	InterPro:IPR001356\|InterPro:IPR003893\|InterPro:IPR008422	150520179		InterPro	GO_REF:0000002
IRX3	Human	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	ISS	UniProtKB:P81067	150520179	PMID:21825130	BHF-UCL	PMID:21825130
IRX3	Human	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	ISA	tfclass:3.1.4	150520179		NTNU_SB	GO_REF:0000113
IRX3	Human	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	FB:FBgn0014343\|FB:FBgn0015904\|MGI:1197522\|MGI:1927642\|MGI:2687286\|PANTHER:PTN002257217\|UniProtKB:P78414\|UniProtKB:Q9BZI1	150520179		GO_Central	GO_REF:0000033
IRX3	Human	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IEA	InterPro:IPR017970	150520179		InterPro	GO_REF:0000002
IRX3	Human	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	ISS	UniProtKB:P81067	150520179	PMID:21825130	BHF-UCL	PMID:21825130
IRX3	Human	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	protein binding		ISO	RGD:1565518	9068941		RGD	PMID:18815185\|REF_RGD_ID:329950576
IRX3	Human	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISS	UniProtKB:P81067	150520179	PMID:21825130	BHF-UCL	PMID:21825130
IRX3	Human	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:P81067\|ensembl:ENSMUSP00000135488	150520179		Ensembl	GO_REF:0000107
IRX3	Human	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	MGI:1197522\|MGI:2687286\|PANTHER:PTN002257217	150520179		GO_Central	GO_REF:0000033
IRX3	Human	sequence-specific double-stranded DNA binding	enables	IDA		150520179	PMID:28473536	ARUK-UCL	PMID:28473536

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:9427753	PMID:10370142	PMID:12477932	PMID:15489334	PMID:19240061	PMID:19274049	PMID:20080751	PMID:21546767	PMID:21825130	PMID:21873635	PMID:24646999	PMID:25512384
PMID:26287746	PMID:26440677	PMID:27222047	PMID:27241637	PMID:27560134	PMID:27609421	PMID:28316138	PMID:28473536	PMID:28988979	PMID:30232004	PMID:30246301	PMID:30522931
PMID:31126299	PMID:31751577	PMID:32035736	PMID:32651404	PMID:32924191	PMID:33232597	PMID:33776928	PMID:34083488	PMID:35328612	PMID:35957832	PMID:36415696

IRX3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	54,283,304 - 54,286,787 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	54,283,304 - 54,286,787 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	54,317,216 - 54,320,699 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	52,874,713 - 52,877,879 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	52,874,712 - 52,877,879	NCBI
Celera	16	38,831,683 - 38,834,849 (-)	NCBI		Celera
Cytogenetic Map	16	q12.2	NCBI
HuRef	16	40,203,767 - 40,206,921 (-)	NCBI		HuRef
CHM1_1	16	55,724,203 - 55,727,369 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	60,081,297 - 60,084,780 (-)	NCBI		T2T-CHM13v2.0

Irx3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	92,525,139 - 92,528,282 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	92,525,153 - 92,528,695 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	91,798,511 - 91,801,654 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	91,798,525 - 91,802,067 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	94,322,424 - 94,325,273 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	94,687,653 - 94,690,502 (-)	NCBI		MGSCv36	mm8
Celera	8	96,103,077 - 96,105,918 (-)	NCBI		Celera
Cytogenetic Map	8	C5	NCBI
cM Map	8	44.55	NCBI

Irx3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	31,384,803 - 31,388,241 (+)	NCBI		GRCr8
mRatBN7.2	19	15,211,882 - 15,215,317 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	15,211,878 - 15,215,317 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	16,902,097 - 16,905,213 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	22,096,906 - 22,100,022 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	25,042,791 - 25,045,908 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	15,838,714 - 15,842,135 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	15,838,714 - 15,840,990 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	26,917,882 - 26,921,326 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	16,345,179 - 16,347,455 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	16,349,206 - 16,352,281 (+)	NCBI
Celera	19	15,124,412 - 15,126,688 (+)	NCBI		Celera
Cytogenetic Map	19	p11	NCBI

Irx3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	11,944,890 - 11,948,369 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955433	11,944,890 - 11,948,372 (-)	NCBI	ChiLan1.0	ChiLan1.0

IRX3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	63,708,015 - 63,712,146 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	69,626,818 - 69,630,821 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	34,514,107 - 34,517,576 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	53,622,028 - 53,627,033 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	53,622,409 - 53,624,653 (-)	Ensembl	panpan1.1		panPan2

IRX3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	61,555,608 - 61,559,185 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	61,555,492 - 61,558,958 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	58,190,062 - 58,192,778 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	62,094,083 - 62,096,798 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	62,094,083 - 62,096,571 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	58,923,158 - 58,925,876 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	59,949,850 - 59,952,564 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	60,825,325 - 60,828,040 (+)	NCBI		UU_Cfam_GSD_1.0

Irx3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	52,775,883 - 52,778,397 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	6,810,666 - 6,813,192 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	6,810,678 - 6,813,186 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IRX3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	31,046,146 - 31,049,054 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	31,044,919 - 31,049,067 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	28,167,076 - 28,171,233 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IRX3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	40,064,471 - 40,069,630 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	40,066,008 - 40,068,505 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	36,306,655 - 36,310,144 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Irx3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624757	2,543,992 - 2,547,464 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624757	2,543,968 - 2,547,452 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in IRX3
39 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 16q12.1-12.2(chr16:50784329-55566715)x1	copy number loss	See cases [RCV000053332]	Chr16:50784329..55566715 [GRCh38] Chr16:50818240..55600627 [GRCh37] Chr16:49375741..54158128 [NCBI36] Chr16:16q12.1-12.2	pathogenic
GRCh38/hg38 16q12.2-24.3(chr16:52899183-90088654)x3	copy number gain	See cases [RCV000143425]	Chr16:52899183..90088654 [GRCh38] Chr16:52933095..90155062 [GRCh37] Chr16:51490596..88682563 [NCBI36] Chr16:16q12.2-24.3	pathogenic
GRCh38/hg38 16q12.1-22.1(chr16:49685521-68401712)x3	copy number gain	See cases [RCV000143752]	Chr16:49685521..68401712 [GRCh38] Chr16:49719432..68435615 [GRCh37] Chr16:48276933..66993116 [NCBI36] Chr16:16q12.1-22.1	pathogenic
GRCh37/hg19 16q11.2-24.3(chr16:46615804-90142285)x1	copy number loss	Breast ductal adenocarcinoma [RCV000207138]	Chr16:46615804..90142285 [GRCh37] Chr16:16q11.2-24.3	uncertain significance
GRCh37/hg19 16q11.2-24.3(chr16:46464488-90155062)x3	copy number gain	See cases [RCV000446110]	Chr16:46464488..90155062 [GRCh37] Chr16:16q11.2-24.3	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:69193-90274381)x3	copy number gain	See cases [RCV000446684]	Chr16:69193..90274381 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p11.2-q21(chr16:34197492-64509054)x3	copy number gain	See cases [RCV000511791]	Chr16:34197492..64509054 [GRCh37] Chr16:16p11.2-q21	pathogenic
GRCh37/hg19 16p13.2-q24.3(chr16:9273328-89548493)x3	copy number gain	See cases [RCV000511622]	Chr16:9273328..89548493 [GRCh37] Chr16:16p13.2-q24.3	uncertain significance
NM_024336.3(IRX3):c.1121C>T (p.Pro374Leu)	single nucleotide variant	not specified [RCV004325590]	Chr16:54284760 [GRCh38] Chr16:54318672 [GRCh37] Chr16:16q12.2	uncertain significance
GRCh37/hg19 16q11.2-24.3(chr16:46455960-90354753)x1	copy number loss	Poly (ADP-Ribose) polymerase inhibitor response [RCV000626435]	Chr16:46455960..90354753 [GRCh37] Chr16:16q11.2-24.3	drug response
GRCh37/hg19 16p13.3-q24.3(chr16:85881-90155062)	copy number gain	See cases [RCV000511296]	Chr16:85881..90155062 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:85881-90155062)x3	copy number gain	See cases [RCV000512138]	Chr16:85881..90155062 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16q11.2-24.3(chr16:46497599-90354753)x1	copy number loss	Poly (ADP-Ribose) polymerase inhibitor response [RCV000626429]	Chr16:46497599..90354753 [GRCh37] Chr16:16q11.2-24.3	drug response
GRCh37/hg19 16p13.3-q24.3(chr16:88165-90274695)x3	copy number gain	not provided [RCV000738918]	Chr16:88165..90274695 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:61451-90294632)x3	copy number gain	not provided [RCV000738915]	Chr16:61451..90294632 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:88165-90163275)x3	copy number gain	not provided [RCV000738917]	Chr16:88165..90163275 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
NM_024336.3(IRX3):c.459C>A (p.Pro153=)	single nucleotide variant	not provided [RCV000873878]	Chr16:54285422 [GRCh38] Chr16:54319334 [GRCh37] Chr16:16q12.2	benign
NM_024336.3(IRX3):c.411G>A (p.Glu137=)	single nucleotide variant	not provided [RCV000874617]	Chr16:54285470 [GRCh38] Chr16:54319382 [GRCh37] Chr16:16q12.2	benign
NM_024336.3(IRX3):c.1335G>A (p.Pro445=)	single nucleotide variant	not provided [RCV000891701]	Chr16:54284546 [GRCh38] Chr16:54318458 [GRCh37] Chr16:16q12.2	likely benign
GRCh37/hg19 16q12.2-21(chr16:53455650-64006604)x3	copy number gain	not provided [RCV000848548]	Chr16:53455650..64006604 [GRCh37] Chr16:16q12.2-21	uncertain significance
NM_024336.3(IRX3):c.809T>A (p.Leu270Gln)	single nucleotide variant	not specified [RCV004326306]	Chr16:54285072 [GRCh38] Chr16:54318984 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.88G>T (p.Ala30Ser)	single nucleotide variant	not specified [RCV004291652]	Chr16:54285963 [GRCh38] Chr16:54319875 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1200G>A (p.Ala400=)	single nucleotide variant	not provided [RCV000920908]	Chr16:54284681 [GRCh38] Chr16:54318593 [GRCh37] Chr16:16q12.2	likely benign
Single allele	duplication	not provided [RCV001542388]	Chr16:46385317..61223349 [GRCh38] Chr16:16q11.2-21	pathogenic
NM_024336.3(IRX3):c.664G>C (p.Gly222Arg)	single nucleotide variant	not specified [RCV004265596]	Chr16:54285217 [GRCh38] Chr16:54319129 [GRCh37] Chr16:16q12.2	uncertain significance
GRCh37/hg19 16q12.2(chr16:53771653-54384400)x3	copy number gain	not provided [RCV001827747]	Chr16:53771653..54384400 [GRCh37] Chr16:16q12.2	uncertain significance
GRCh37/hg19 16q11.2-24.3(chr16:46503968-90155062)x3	copy number gain	not provided [RCV002221458]	Chr16:46503968..90155062 [GRCh37] Chr16:16q11.2-24.3	pathogenic
NC_000016.9:g.(?_53635988)_(55539614_?)del	deletion	Familial aplasia of the vermis [RCV003119548]	Chr16:53635988..55539614 [GRCh37] Chr16:16q12.2	pathogenic
NC_000016.9:g.(?_53635988)_(54967785_?)dup	duplication	Familial aplasia of the vermis [RCV003119557]	Chr16:53635988..54967785 [GRCh37] Chr16:16q12.2	uncertain significance
Single allele	deletion	not provided [RCV002266766]	Chr16:53818483..57631312 [GRCh38] Chr16:16q12.2-21	pathogenic
GRCh37/hg19 16q11.2-21(chr16:46503573-62203182)x3	copy number gain	not provided [RCV002472562]	Chr16:46503573..62203182 [GRCh37] Chr16:16q11.2-21	pathogenic
NM_024336.3(IRX3):c.1247C>T (p.Pro416Leu)	single nucleotide variant	not specified [RCV004098005]	Chr16:54284634 [GRCh38] Chr16:54318546 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1003G>T (p.Ala335Ser)	single nucleotide variant	not specified [RCV004141303]	Chr16:54284878 [GRCh38] Chr16:54318790 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.349T>G (p.Phe117Val)	single nucleotide variant	not specified [RCV004075977]	Chr16:54285532 [GRCh38] Chr16:54319444 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.955G>A (p.Val319Met)	single nucleotide variant	not specified [RCV004094512]	Chr16:54284926 [GRCh38] Chr16:54318838 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.155T>G (p.Val52Gly)	single nucleotide variant	not specified [RCV004104297]	Chr16:54285896 [GRCh38] Chr16:54319808 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1083C>G (p.Asn361Lys)	single nucleotide variant	not specified [RCV004197242]	Chr16:54284798 [GRCh38] Chr16:54318710 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.785C>T (p.Ala262Val)	single nucleotide variant	not specified [RCV004163131]	Chr16:54285096 [GRCh38] Chr16:54319008 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1189C>G (p.Leu397Val)	single nucleotide variant	not specified [RCV004181779]	Chr16:54284692 [GRCh38] Chr16:54318604 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1136C>T (p.Ala379Val)	single nucleotide variant	not specified [RCV004199773]	Chr16:54284745 [GRCh38] Chr16:54318657 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1322C>T (p.Ala441Val)	single nucleotide variant	not specified [RCV004235388]	Chr16:54284559 [GRCh38] Chr16:54318471 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1112G>T (p.Gly371Val)	single nucleotide variant	not specified [RCV004237844]	Chr16:54284769 [GRCh38] Chr16:54318681 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1030C>A (p.Leu344Met)	single nucleotide variant	not specified [RCV004105402]	Chr16:54284851 [GRCh38] Chr16:54318763 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.161C>T (p.Ser54Leu)	single nucleotide variant	not specified [RCV004254040]	Chr16:54285890 [GRCh38] Chr16:54319802 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.25C>G (p.Gln9Glu)	single nucleotide variant	not specified [RCV004351772]	Chr16:54286026 [GRCh38] Chr16:54319938 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.983C>A (p.Pro328His)	single nucleotide variant	not specified [RCV004336635]	Chr16:54284898 [GRCh38] Chr16:54318810 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.44A>G (p.Tyr15Cys)	single nucleotide variant	not specified [RCV004363739]	Chr16:54286007 [GRCh38] Chr16:54319919 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1016C>A (p.Ala339Asp)	single nucleotide variant	not specified [RCV004403355]	Chr16:54284865 [GRCh38] Chr16:54318777 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1394G>C (p.Ser465Thr)	single nucleotide variant	not specified [RCV004403356]	Chr16:54284303 [GRCh38] Chr16:54318215 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.220G>C (p.Gly74Arg)	single nucleotide variant	not specified [RCV004403357]	Chr16:54285831 [GRCh38] Chr16:54319743 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.388C>G (p.Arg130Gly)	single nucleotide variant	not specified [RCV004403358]	Chr16:54285493 [GRCh38] Chr16:54319405 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.472G>A (p.Gly158Ser)	single nucleotide variant	not specified [RCV004403359]	Chr16:54285409 [GRCh38] Chr16:54319321 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.589A>T (p.Ser197Cys)	single nucleotide variant	not specified [RCV004633243]	Chr16:54285292 [GRCh38] Chr16:54319204 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1294C>T (p.Pro432Ser)	single nucleotide variant	not specified [RCV004633242]	Chr16:54284587 [GRCh38] Chr16:54318499 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.351C>A (p.Phe117Leu)	single nucleotide variant	not specified [RCV004626455]	Chr16:54285530 [GRCh38] Chr16:54319442 [GRCh37] Chr16:16q12.2	uncertain significance
NC_000016.9:g.(?_48799549)_(70756330_?)dup	duplication	Chromosome 16q12 duplication syndrome [RCV004595820]	Chr16:48799549..70756330 [GRCh37] Chr16:16q12.1-22.1	likely pathogenic
NM_024336.3(IRX3):c.313G>C (p.Ala105Pro)	single nucleotide variant	not specified [RCV004926908]	Chr16:54285568 [GRCh38] Chr16:54319480 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.224C>G (p.Ala75Gly)	single nucleotide variant	not specified [RCV004926909]	Chr16:54285827 [GRCh38] Chr16:54319739 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.1076C>G (p.Pro359Arg)	single nucleotide variant	not specified [RCV004926910]	Chr16:54284805 [GRCh38] Chr16:54318717 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.473G>C (p.Gly158Ala)	single nucleotide variant	not specified [RCV004926911]	Chr16:54285408 [GRCh38] Chr16:54319320 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.258C>A (p.Phe86Leu)	single nucleotide variant	not specified [RCV004926912]	Chr16:54285793 [GRCh38] Chr16:54319705 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.696G>C (p.Glu232Asp)	single nucleotide variant	not specified [RCV004926913]	Chr16:54285185 [GRCh38] Chr16:54319097 [GRCh37] Chr16:16q12.2	uncertain significance
NM_024336.3(IRX3):c.330T>G (p.Phe110Leu)	single nucleotide variant	not specified [RCV004926914]	Chr16:54285551 [GRCh38] Chr16:54319463 [GRCh37] Chr16:16q12.2	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	747
Count of miRNA genes:	480
Interacting mature miRNAs:	540
Transcripts:	ENST00000329734, ENST00000558054, ENST00000558180
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597148291	GWAS1244365_H	prostate carcinoma QTL GWAS1244365 (human)		0.0000002	prostate carcinoma		16	54286285	54286286	Human
597149519	GWAS1245593_H	prostate carcinoma QTL GWAS1245593 (human)		2e-09	prostate carcinoma		16	54286285	54286286	Human

SHGC-61146

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	16	54,317,334 - 54,317,488	UniSTS	GRCh37
Build 36	16	52,874,835 - 52,874,989	RGD	NCBI36
Celera	16	38,831,805 - 38,831,959	RGD
Cytogenetic Map	16	q12.2	UniSTS
HuRef	16	40,203,889 - 40,204,043	UniSTS
GeneMap99-GB4 RH Map	16	352.11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2368	2788	2236	4923	1715	2333	6	616	1335	454	2268	6640	5872	48	3682	1	851	1733	1610	175	1


RefSeq Transcripts	NM_024336	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_005256139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054313909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC018553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK309146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY335942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY335943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC023667	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC034328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068262	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KT585225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U90308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000329734 ⟹ ENSP00000331608

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	16	54,283,304 - 54,286,787 (-)	Ensembl

Ensembl Acc Id:

ENST00000558054 ⟹ ENSP00000463991

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	16	54,283,436 - 54,285,855 (-)	Ensembl

Ensembl Acc Id:

ENST00000558180

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	16	54,284,120 - 54,286,724 (-)	Ensembl

RefSeq Acc Id:

NM_024336 ⟹ NP_077312

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	54,283,304 - 54,286,787 (-)	NCBI
GRCh37	16	54,317,212 - 54,320,724 (-)	NCBI
Build 36	16	52,874,713 - 52,877,879 (-)	NCBI Archive
Celera	16	38,831,683 - 38,834,849 (-)	RGD
HuRef	16	40,203,767 - 40,206,921 (-)	RGD
CHM1_1	16	55,724,203 - 55,727,369 (-)	NCBI
T2T-CHM13v2.0	16	60,081,297 - 60,084,780 (-)	NCBI

Sequence:

show sequence

AGACAGACACCGACACACACCCCCCGCGCGGCACCCTAAGTGTCCACAACTTTTGGCTGCCTTACTTAGCCCAGGGCGCAGAGGCTGGAAAGGTCGCGGGGAGTATCGTGTGAGTAAAGAGAGAGATT
TACAAAATAGAAGTAGTGAGAAAGGAAGAAGTGAAGGGAACGGACCGGAGAGCAAAAGCCCTCGTGAGAAAGGGAAAGAGAAGGGGAGAGGAGAAAGGAGAGTTTCATAGCGTCCAGGGCAGTGCAGG
AGCCCGAAGCAGCGGAAGCGATCCTGGGGGGAAGAGGAGTGCGGAGAGGGGAGGGGAGAGGAAGGGCGAGGAGGGGGAGTGAAAACTAGAGGAGGGCGAAGGAAGCGAGGCGCGACACTGCTGGGGAG
AGGAGGGCAGTGAGGAGCGAGGAGCGGGCAGAGGCAGCTCCGGCGGCCGAGAGGAGGGAGCGCGGCGCAGAGAGGAGGGGCTTGCGCCCCGTAGAAATGTCAATCAGAGCCCGGAGCCCCGGGAATCT
CCGCCAATCTGTTCGGACCTGACCTGGCTCCTCGCCGCCGCCCTCGCCGCCGCCGTCGCCGCCGCGGAGCAGATCAATAGGCGAACGCGGAGCACAGCGCAGCGCGGGCGGCAGCGCGGCCCCAAGCC
CGGCCCAGCCCCCGATGCGCGCCGGAGCCCGCGGGCGGCGCTGAGCTGGGCGGCCCGGGGGTCGGCCCCCCTCTCCGTCCGTGCCCCGCGGGCCACCATGTCCTTCCCCCAGCTGGGATACCAATACA
TCCGCCCGCTTTACCCGTCCGAGCGCCCGGGGGCCGCTGGCGGCAGCGGCGGCAGCGCGGGGGCCCGGGGCGGCCTGGGTGCCGGAGCCTCGGAGCTGAACGCCTCGGGGTCCCTGTCCAACGTGCTC
TCGTCCGTGTACGGGGCGCCCTACGCCGCGGCCGCTGCGGCCGCCGCCGCCCAAGGCTACGGCGCCTTCCTGCCCTACGCCGCGGAGCTGCCCATCTTCCCGCAGCTGGGCGCGCAGTATGAGCTGAA
GGACAGCCCCGGGGTGCAGCATCCGGCCGCGGCTGCCGCGTTTCCGCACCCGCACCCCGCCTTCTACCCGTATGGCCAGTACCAGTTCGGGGACCCGTCCCGTCCCAAGAACGCCACCAGGGAGAGCA
CCAGCACGCTGAAGGCCTGGCTCAACGAGCACCGCAAGAACCCCTACCCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTGTCCACCTGGTTCGCCAACGCG
CGCCGGCGCCTCAAGAAGGAGAATAAGATGACTTGGGCGCCTCGCAGCCGCACTGACGAGGAGGGAAACGCTTATGGGAGCGAGCGCGAGGAGGAAGACGAAGAGGAGGACGAGGAGGACGGCAAACG
CGAGCTAGAGCTGGAGGAGGAGGAGCTCGGGGGGGAGGAGGAGGACACGGGGGGCGAGGGCCTGGCTGACGACGACGAGGACGAGGAGATCGATTTGGAGAACTTAGACGGCGCGGCCACCGAGCCTG
AGCTGTCCCTGGCTGGGGCGGCGCGCAGGGATGGCGACCTAGGCCTGGGACCCATTTCGGACTCCAAAAATAGCGACTCGGAAGATAGCTCTGAGGGCTTAGAGGACCGGCCACTACCGGTCCTGAGT
CTGGCTCCAGCGCCACCACCAGTGGCCGTGGCCTCGCCGTCTCTGCCGTCGCCCCCCGTGAGCCTGGACCCCTGCGCTCCCGCACCAGCCCCCGCCTCCGCCCTGCAGAAGCCCAAGATCTGGTCCCT
CGCGGAGACTGCCACAAGCCCGGACAACCCGCGCCGCTCGCCTCCCGGCGCGGGGGGGTCTCCACCGGGGGCAGCGGTCGCGCCTTCCGCCCTGCAGCTCTCTCCGGCCGCCGCCGCCGCCGCCGCTC
ACAGACTGGTCTCAGCGCCGCTGGGCAAGTTCCCGGCTTGGACCAACCGGCCGTTTCCAGGCCCACCGCCCGGCCCCCGCCTGCACCCGCTCTCCCTGCTGGGCTCTGCCCCTCCGCACCTGCTGGGA
CTTCCCGGAGCCGCGGGCCACCCGGCTGCCGCCGCCGCCTTCGCTCGGCCAGCGGAGCCCGAAGGCGGAACAGATCGCTGTAGTGCCTTGGAAGTGGAGAAAAAGTTACTCAAGACAGCTTTCCAGCC
CGTGCCCAGGCGGCCCCAGAACCATCTGGACGCCGCCCTGGTCTTATCGGCTCTCTCCTCATCCTAGTTCTTTAAAAAAAACAAAAAAACAAAAAAAACTTTTTTTAATCGTTGTAATAATTGTATAA
AAAAAATCGCTCTGTATAGTTACAACTTGTAAGCATGTCCGTGTATAAATACCTAAAAGCAAAACTAAACAAAGAAAGTAAGAAAAAGAAATAAAACCAGTCCTCCTCAGCCCTCCCCAAGTCGCTTC
TGTGGCACCCCGCATTCGCTGTGAGGTTTGTTTGTCCGGTTGATTTTGGGGGGTGGAGTTTCAGTGAGAATAAACGTGTCTGCCTTTGTGTGTGTGTATATATACAGAGAAATGTACATATGTGTGAA
CCAAATTGTACGAGAAAGTATCTATTTTTGGCTAAATAAATGAGCTGCTGCCACTTTGACTATAA

hide sequence

RefSeq Acc Id:

XM_005256139 ⟹ XP_005256196

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	54,283,304 - 54,286,787 (-)	NCBI
GRCh37	16	54,317,212 - 54,320,724 (-)	NCBI

Sequence:

show sequence

CACACCCCCCGCGCGGCACCCTAAGTGTCCACAACTTTTGGCTGCCTTACTTAGCCCAGGGCGCAGAGGCTGGAAAGGTCGCGGGGAGTATCGTGTGAGTAAAGAGAGAGATTTACAAAATAGAAGTA
GTGAGAAAGGAAGAAGTGAAGGGAACGGACCGGAGAGCAAAAGCCCTCGTGAGAAAGGGAAAGAGAAGGGGAGAGGAGAAAGGAGAGTTTCATAGCGTCCAGGGCAGTGCAGGAGCCCGAAGCAGCGG
AAGCGATCCTGGGGGGAAGAGGAGTGCGGAGAGGGGAGGGGAGAGGAAGGGCGAGGAGGGGGAGTGAAAACTAGAGGAGGGCGAAGGAAGCGAGGCGCGACACTGCTGGGGAGAGGAGGGCAGTGAGG
AGCGAGGAGCGGGCAGAGGCAGCTCCGGCGGCCGAGAGGAGGGAGCGCGGCGCAGAGAGGAGGGGCTTGCGCCCCGTAGAAATGTCAATCAGAGCCCGGAGCCCCGGGAATCTCCGCCAATCTGTTCG
GACCTGACCTGGCTCCTCGCCGCCGCCCTCGCCGCCGCCGTCGCCGCCGCGGAGCAGATCAATAGGCGAACGCGGAGCACAGCGCAGCGCGGGCGGCAGCGCGGCCCCAAGCCCGGCCCAGCCCCCGA
TGCGCGCCGGAGCCCGCGGGCGGCGCTGAGCTGGGCGGCCCGGGGGTCGGCCCCCCTCTCCGTCCGTGCCCCGCGGGCCACCATGTCCTTCCCCCAGCTGGGATACCAATACATCCGCCCGCTTTACC
CGTCCGAGCGCCCGGGGGCCGCTGGCGGCAGCGGCGGCAGCGCGGGGGCCCGGGGCGGCCTGGGTGCCGGAGCCTCGGAGCTGAACGCCTCGGGGTCCCTGTCCAACGTGCTCTCGTCCGTGTACGGG
GCGCCCTACGCCGCGGCCGCTGCGGCCGCCGCCGCCCAAGGCTACGGCGCCTTCCTGCCCTACGCCGCGGAGCTGCCCATCTTCCCGCAGCTGGGCGCGCAGTATGAGCTGAAGGACAGCCCCGGGGT
GCAGCATCCGGCCGCGGCTGCCGCGTTTCCGCACCCGCACCCCGCCTTCTACCCGTATGGCCAGTACCAGTTCGGGGACCCGTCCCGTCCCAAGAACGCCACCAGGGAGAGCACCAGCACGCTGAAGG
CCTGGCTCAACGAGCACCGCAAGAACCCCTACCCCACCAAGGGCGAGAAGATCATGCTGGCCATCATCACCAAGATGACCCTCACCCAGGTGTCCACCTGGTTCGCCAACGCGCGCCGGCGCCTCAAG
AAGGAGAATAAGATGACTTGGGCGCCTCGCAGCCGCACTGACGAGGAGGGAAACGCTTATGGGAGCGAGCGCGAGGAGGAAGACGAAGAGGAGGACGAGGAGGACGGCAAACGCGAGCTAGAGCTGGA
GGAGGAGGAGCTCGGGGGGGAGGAGGAGGACACGGGGGGCGAGGGCCTGGCTGACGACGACGAGGACGAGGAGATCGATTTGGAGAACTTAGACGGCGCGGCCACCGAGCCTGAGCTGTCCCTGGCTG
GGGCGGCGCGCAGGGATGGCGACCTAGGCCTGGGACCCATTTCGGACTCCAAAAATAGCGACTCGGAAGATAGCTCTGAGGGCTTAGAGGACCGGCCACTACCGGTCCTGAGTCTGGCTCCAGCGCCA
CCACCAGTGGCCGTGGCCTCGCCGTCTCTGCCGTCGCCCCCCGTGAGCCTGGACCCCTGCGCTCCCGCACCAGCCCCCGCCTCCGCCCTGCAGAAGCCCAAGATCTGGTCCCTCGCGGAGACTGCCAC
AAGCCCGGACAACCCGCGCCGCTCGCCTCCCGGCGCGGGGGGGTCTCCACCGGGGGCAGCGGTCGCGCCTTCCGCCCTGCAGCTCTCTCCGGCCGCCGCCGCCGCCGCCGCTCACAGACTGGTCTCAG
CGCCGCTGGGCAAGTTCCCGGCTTGGACCAACCGGCCGTTTCCAGGCCCACCGCCCGGCCCCCGCCTGCACCCGCTCTCCCTGCTGGGCTCTGCCCCTCCGCACCTGCTGGGACTTCCCGGAGCCGCG
GGCCACCCGGCTGCCGCCGCCGCCTTCGCTCGGCCAGCGGAGCCCGAAGGCGGAACAGATCGCTGTAGTGCCTTGGAAGTGGAGAAAAAGTTACTCAAGACAGCTTTCCAGCCCGTGCCCAGGCGCCC
CAGACCTCGGGTCCTGACGCCTCGTGCCCACCCTACAGTTAAACCCCAACACACACATCTACAACTGGACATAATTTTACATTGCGACACCTTCCTGACGATCGGCCCCAATCCAAGTAGGATCTCCC
CGCCCTAGGCAGCCTCTGCGCTCCTGAATCTCACCTCTTTTGCTACTACTGTCTCTCTCTTCCAGGCCCCAGAACCATCTGGACGCCGCCCTGGTCTTATCGGCTCTCTCCTCATCCTAGTTCTTTAA
AAAAAACAAAAAAACAAAAAAAACTTTTTTTAATCGTTGTAATAATTGTATAAAAAAAATCGCTCTGTATAGTTACAACTTGTAAGCATGTCCGTGTATAAATACCTAAAAGCAAAACTAAACAAAGA
AAGTAAGAAAAAGAAATAAAACCAGTCCTCCTCAGCCCTCCCCAAGTCGCTTCTGTGGCACCCCGCATTCGCTGTGAGGTTTGTTTGTCCGGTTGATTTTGGGGGGTGGAGTTTCAGTGAGAATAAAC
GTGTCTGCCTTTGTGTGTGTGTATATATACAGAGAAATGTACATATGTGTGAACCAAATTGTACGAGAAAGTATCTATTTTTGGCTAAATAAATGAGCTGCTGCCACTTTGACTATAA

hide sequence

RefSeq Acc Id:

XM_054313909 ⟹ XP_054169884

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	16	60,081,297 - 60,084,780 (-)	NCBI


Protein RefSeqs	NP_077312	(Get FASTA)	NCBI Sequence Viewer
	XP_005256196	(Get FASTA)	NCBI Sequence Viewer
	XP_054169884	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB50006	(Get FASTA)	NCBI Sequence Viewer
	AAH23667	(Get FASTA)	NCBI Sequence Viewer
	AAH34328	(Get FASTA)	NCBI Sequence Viewer
	AAQ16548	(Get FASTA)	NCBI Sequence Viewer
	AAQ16549	(Get FASTA)	NCBI Sequence Viewer
	EAW82815	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000331608
	ENSP00000331608.3
GenBank Protein	P78415	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_077312 ⟸ NM_024336

- UniProtKB:

Q7Z4A5 (UniProtKB/Swiss-Prot), Q7Z4A4 (UniProtKB/Swiss-Prot), Q8IVC6 (UniProtKB/Swiss-Prot), P78415 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSFPQLGYQYIRPLYPSERPGAAGGSGGSAGARGGLGAGASELNASGSLSNVLSSVYGAPYAAAAAAAAAQGYGAFLPYAAELPIFPQLGAQYELKDSPGVQHPAAAAAFPHPHPAFYPYGQYQFGDP
SRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDGKRELELEEEELGGEEEDTGGEGLADDDEDEEIDL
ENLDGAATEPELSLAGAARRDGDLGLGPISDSKNSDSEDSSEGLEDRPLPVLSLAPAPPPVAVASPSLPSPPVSLDPCAPAPAPASALQKPKIWSLAETATSPDNPRRSPPGAGGSPPGAAVAPSALQ
LSPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGPRLHPLSLLGSAPPHLLGLPGAAGHPAAAAAFARPAEPEGGTDRCSALEVEKKLLKTAFQPVPRRPQNHLDAALVLSALSSS

hide sequence

RefSeq Acc Id:

XP_005256196 ⟸ XM_005256139

- Peptide Label:

isoform X1

- Sequence:

show sequence

MSFPQLGYQYIRPLYPSERPGAAGGSGGSAGARGGLGAGASELNASGSLSNVLSSVYGAPYAAAAAAAAAQGYGAFLPYAAELPIFPQLGAQYELKDSPGVQHPAAAAAFPHPHPAFYPYGQYQFGDP
SRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDGKRELELEEEELGGEEEDTGGEGLADDDEDEEIDL
ENLDGAATEPELSLAGAARRDGDLGLGPISDSKNSDSEDSSEGLEDRPLPVLSLAPAPPPVAVASPSLPSPPVSLDPCAPAPAPASALQKPKIWSLAETATSPDNPRRSPPGAGGSPPGAAVAPSALQ
LSPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGPRLHPLSLLGSAPPHLLGLPGAAGHPAAAAAFARPAEPEGGTDRCSALEVEKKLLKTAFQPVPRRPRPRVLTPRAHPTVKPQHTHLQLDIILH
CDTFLTIGPNPSRISPP

hide sequence

Ensembl Acc Id:

ENSP00000463991 ⟸ ENST00000558054

Ensembl Acc Id:

ENSP00000331608 ⟸ ENST00000329734

RefSeq Acc Id:	XP_054169884 ⟸ XM_054313909
- Peptide Label:	isoform X1

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P78415-F1-model_v2	AlphaFold	P78415	1-501	view protein structure

RGD ID:

6810951

Promoter ID:

HG_ACW:30745

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

HeLa_S3, NB4

Transcripts:

IRX3.DAPR07-UNSPLICED, IRX3.FAPR07

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	16	52,875,394 - 52,875,894 (-)	MPROMDB

RGD ID:

6793057

Promoter ID:

HG_KWN:23818

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

HeLa_S3, NB4

Transcripts:

ENST00000394640

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	16	52,876,356 - 52,877,107 (-)	MPROMDB

RGD ID:

6793197

Promoter ID:

HG_KWN:23819

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

HeLa_S3, Jurkat, NB4

Transcripts:

NM_024336

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	16	52,877,391 - 52,877,891 (-)	MPROMDB

RGD ID:

7232233

Promoter ID:

EPDNEW_H21862

Type:

initiation region

Name:

IRX3_2

Description:

iroquois homeobox 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H21863

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	54,286,205 - 54,286,265	EPDNEW

RGD ID:

7232235

Promoter ID:

EPDNEW_H21863

Type:

initiation region

Name:

IRX3_1

Description:

iroquois homeobox 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H21862

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	54,286,724 - 54,286,784	EPDNEW

Database	Acc Id	Source(s)
COSMIC	IRX3	COSMIC
Ensembl Genes	ENSG00000177508	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000329734	ENTREZGENE
	ENST00000329734.4	UniProtKB/Swiss-Prot
Gene3D-CATH	Homeodomain-like	UniProtKB/Swiss-Prot
GTEx	ENSG00000177508	GTEx
HGNC ID	HGNC:14360	ENTREZGENE
Human Proteome Map	IRX3	Human Proteome Map
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_CS	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
	Homeobox_KN_domain	UniProtKB/Swiss-Prot
	Iroquois_homeo	UniProtKB/Swiss-Prot
KEGG Report	hsa:79191	UniProtKB/Swiss-Prot
NCBI Gene	79191	ENTREZGENE
OMIM	612985	OMIM
PANTHER	IROQUOIS-CLASS HOMEODOMAIN PROTEIN IRX	UniProtKB/Swiss-Prot
	IROQUOIS-CLASS HOMEODOMAIN PROTEIN IRX-3	UniProtKB/Swiss-Prot
Pfam	Homeobox_KN	UniProtKB/Swiss-Prot
PharmGKB	PA29926	PharmGKB
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot
	HOMEOBOX_2	UniProtKB/Swiss-Prot
SMART	HOX	UniProtKB/Swiss-Prot
	IRO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
UniProt	IRX3_HUMAN	UniProtKB/Swiss-Prot
	J3QR11_HUMAN	UniProtKB/TrEMBL
	P78415	ENTREZGENE
	Q7Z4A4	ENTREZGENE
	Q7Z4A5	ENTREZGENE
	Q8IVC6	ENTREZGENE
	Q8N4G7_HUMAN	UniProtKB/TrEMBL
UniProt Secondary	Q7Z4A4	UniProtKB/Swiss-Prot
	Q7Z4A5	UniProtKB/Swiss-Prot
	Q8IVC6	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD