Symbol:
Srp72
Name:
signal recognition particle 72
RGD ID:
1314482
MGI Page
MGI
Description:
Predicted to enable 7S RNA binding activity; TPR domain binding activity; and signal recognition particle binding activity. Predicted to contribute to ribosome binding activity. Predicted to be involved in SRP-dependent cotranslational protein targeting to membrane. Predicted to be located in endoplasmic reticulum and nucleolus. Predicted to be part of signal recognition particle, endoplasmic reticulum targeting. Orthologous to human SRP72 (signal recognition particle 72).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
5730576P14Rik; 72kD; 72kDa; AI132477; BC019196; C77589; signal recognition particle; signal recognition particle 72 kDa; signal recognition particle subunit SRP72
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SRP72 (signal recognition particle 72) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Srp72 (signal recognition particle 72) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Srp72 (signal recognition particle 72) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SRP72 (signal recognition particle 72) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SRP72 (signal recognition particle 72) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Srp72 (signal recognition particle 72) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SRP72 (signal recognition particle 72) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SRP72 (signal recognition particle 72) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Srp72 (signal recognition particle 72) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SRP72 (signal recognition particle 72)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Srp72 (signal recognition particle 72)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
srp72 (signal recognition particle 72)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Srp72
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SRP72
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
srpa-72
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
srp72
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Related Pseudogenes:
Gm18534
Gm18549
Gm18550
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 77,122,548 - 77,147,782 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 77,122,530 - 77,147,784 (+) Ensembl GRCm39 Ensembl GRCm38 5 76,974,701 - 76,999,935 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 76,974,683 - 76,999,937 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 77,403,726 - 77,428,960 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 78,049,475 - 78,074,709 (+) NCBI MGSCv36 mm8 Celera 5 74,242,566 - 74,267,829 (+) NCBI Celera Cytogenetic Map 5 C3.3 NCBI cM Map 5 41.45 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Srp72 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SRP72 mRNA CTD PMID:22206623 Srp72 Mouse 1,2-dimethylhydrazine affects expression EXP 6480464 1 and 2-Dimethylhydrazine affects the expression of SRP72 mRNA CTD PMID:22206623 Srp72 Mouse 1-chloro-2,4-dinitrobenzene decreases expression ISO SRP72 (Homo sapiens) 6480464 Dinitrochlorobenzene results in decreased expression of SRP72 mRNA CTD PMID:17374397 Srp72 Mouse 1-chloro-2,4-dinitrobenzene affects binding ISO SRP72 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to SRP72 protein CTD PMID:32991956 Srp72 Mouse 17beta-estradiol decreases expression ISO SRP72 (Homo sapiens) 6480464 Estradiol results in decreased expression of SRP72 mRNA CTD PMID:19167446 Srp72 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of SRP72 mRNA CTD PMID:39298647 Srp72 Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2 more ... CTD PMID:30294300 Srp72 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SRP72 mRNA CTD PMID:21570461 Srp72 Mouse 2,6-dimethoxyphenol multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of SRP72 protein CTD PMID:38598786 Srp72 Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of SRP72 mRNA CTD PMID:26251327 Srp72 Mouse 3,4-methylenedioxymethamphetamine increases methylation EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of SRP72 promoter CTD PMID:26251327 Srp72 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SRP72 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SRP72 mRNA CTD PMID:28628672 Srp72 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of SRP72 mRNA CTD PMID:39298647 Srp72 Mouse 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO SRP72 (Homo sapiens) 6480464 Oxazolone results in decreased expression of SRP72 mRNA CTD PMID:17374397 Srp72 Mouse 5-fluorouracil increases expression ISO SRP72 (Homo sapiens) 6480464 Fluorouracil results in increased expression of SRP72 mRNA CTD PMID:16584549 Srp72 Mouse acrolein multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SRP72 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SRP72 mRNA CTD PMID:32699268 Srp72 Mouse all-trans-retinoic acid decreases expression ISO SRP72 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SRP72 mRNA CTD PMID:33167477 Srp72 Mouse alpha-pinene multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SRP72 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SRP72 mRNA CTD PMID:32699268 Srp72 Mouse aristolochic acid A decreases expression ISO SRP72 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SRP72 mRNA CTD PMID:33212167 Srp72 Mouse Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of SRP72 mRNA CTD PMID:23650126 Srp72 Mouse atazanavir sulfate multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of SRP72 mRNA CTD PMID:33819548 Srp72 Mouse azoxystrobin increases expression ISO SRP72 (Homo sapiens) 6480464 azoxystrobin results in increased expression of SRP72 mRNA CTD PMID:33512557 Srp72 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of SRP72 mRNA CTD PMID:20504355 Srp72 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SRP72 mRNA CTD PMID:22228805 Srp72 Mouse benzo[a]pyrene diol epoxide I increases expression ISO SRP72 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Srp72 Mouse beta-lapachone decreases expression ISO SRP72 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of SRP72 mRNA CTD PMID:38218311 Srp72 Mouse bisphenol A affects expression ISO SRP72 (Homo sapiens) 6480464 bisphenol A affects the expression of SRP72 mRNA CTD PMID:30903817 Srp72 Mouse bisphenol A increases expression ISO SRP72 (Homo sapiens) 6480464 bisphenol A results in increased expression of SRP72 protein CTD PMID:34186270 Srp72 Mouse bisphenol AF increases expression ISO SRP72 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SRP72 protein CTD PMID:34186270 Srp72 Mouse Bisphenol B increases expression ISO SRP72 (Homo sapiens) 6480464 bisphenol B results in increased expression of SRP72 protein CTD PMID:34186270 Srp72 Mouse bisphenol F multiple interactions ISO SRP72 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SRP72 mRNA CTD PMID:28628672 Srp72 Mouse caffeine decreases phosphorylation ISO SRP72 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of SRP72 protein CTD PMID:35688186 Srp72 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Srp72 Mouse chenodeoxycholic acid multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of SRP72 mRNA more ... CTD PMID:33819548 Srp72 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of SRP72 mRNA CTD PMID:37019170 Srp72 Mouse coumarin increases phosphorylation ISO SRP72 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of SRP72 protein CTD PMID:35688186 Srp72 Mouse cyclosporin A increases expression ISO SRP72 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SRP72 mRNA CTD PMID:20106945 more ... Srp72 Mouse cyclosporin A multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in increased expression of SRP72 mRNA CTD PMID:33819548 Srp72 Mouse deguelin increases expression ISO SRP72 (Homo sapiens) 6480464 deguelin results in increased expression of SRP72 mRNA CTD PMID:33512557 Srp72 Mouse deoxycholic acid multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of SRP72 mRNA more ... CTD PMID:33819548 Srp72 Mouse dexamethasone multiple interactions ISO SRP72 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SRP72 mRNA CTD PMID:28628672 Srp72 Mouse dibenzo[a,l]pyrene decreases expression EXP 6480464 dibenzo(a and l)pyrene results in decreased expression of SRP72 mRNA CTD PMID:25908611 Srp72 Mouse dicrotophos decreases expression ISO SRP72 (Homo sapiens) 6480464 dicrotophos results in decreased expression of SRP72 mRNA CTD PMID:28302478 Srp72 Mouse disodium selenite increases expression ISO SRP72 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of SRP72 mRNA CTD PMID:18175754 Srp72 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of SRP72 mRNA CTD PMID:30319688 Srp72 Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SRP72 mRNA CTD PMID:22206623 Srp72 Mouse formaldehyde decreases expression ISO SRP72 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SRP72 mRNA CTD PMID:23649840 Srp72 Mouse FR900359 increases phosphorylation ISO SRP72 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of SRP72 protein CTD PMID:37730182 Srp72 Mouse furfural multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of SRP72 protein CTD PMID:38598786 Srp72 Mouse glycochenodeoxycholic acid multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of SRP72 mRNA more ... CTD PMID:33819548 Srp72 Mouse glycocholic acid multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of SRP72 mRNA more ... CTD PMID:33819548 Srp72 Mouse glycodeoxycholic acid multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of SRP72 mRNA more ... CTD PMID:33819548 Srp72 Mouse glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of SRP72 protein CTD PMID:36173347 Srp72 Mouse hydralazine multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SRP72 mRNA CTD PMID:17183730 Srp72 Mouse hydrogen peroxide affects expression ISO SRP72 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of SRP72 mRNA CTD PMID:20044591 Srp72 Mouse indometacin multiple interactions ISO SRP72 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SRP72 mRNA CTD PMID:28628672 Srp72 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SRP72 mRNA CTD PMID:36331819 Srp72 Mouse ivermectin decreases expression ISO SRP72 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SRP72 protein CTD PMID:32959892 Srp72 Mouse methyl methanesulfonate decreases expression ISO SRP72 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SRP72 mRNA CTD PMID:23649840 Srp72 Mouse nefazodone multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in increased expression of SRP72 mRNA CTD PMID:33819548 Srp72 Mouse nickel sulfate decreases expression ISO SRP72 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of SRP72 mRNA CTD PMID:17374397 and PMID:18651567 Srp72 Mouse oxaliplatin decreases expression ISO SRP72 (Homo sapiens) 6480464 oxaliplatin results in decreased expression of SRP72 mRNA CTD PMID:17762391 Srp72 Mouse ozone multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SRP72 mRNA more ... CTD PMID:32699268 and PMID:35430440 Srp72 Mouse p-menthan-3-ol decreases expression ISO SRP72 (Homo sapiens) 6480464 Menthol results in decreased expression of SRP72 mRNA CTD PMID:26760959 Srp72 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SRP72 mRNA CTD PMID:36331819 Srp72 Mouse perfluorooctanoic acid decreases expression ISO SRP72 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of SRP72 protein CTD PMID:26879310 Srp72 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of SRP72 mRNA CTD PMID:23091169 Srp72 Mouse picoxystrobin increases expression ISO SRP72 (Homo sapiens) 6480464 picoxystrobin results in increased expression of SRP72 mRNA CTD PMID:33512557 Srp72 Mouse resveratrol increases expression EXP 6480464 resveratrol results in increased expression of SRP72 protein CTD PMID:25505154 Srp72 Mouse rimonabant multiple interactions EXP 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of SRP72 mRNA] CTD PMID:19030233 Srp72 Mouse sodium arsenite decreases expression ISO SRP72 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SRP72 protein CTD PMID:30528433 Srp72 Mouse sodium chloride multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of SRP72 protein more ... CTD PMID:38598786 Srp72 Mouse sunitinib increases expression ISO SRP72 (Homo sapiens) 6480464 Sunitinib results in increased expression of SRP72 mRNA CTD PMID:31533062 Srp72 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SRP72 mRNA CTD PMID:31919559 Srp72 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of SRP72 gene CTD PMID:35295148 Srp72 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of SRP72 gene CTD PMID:35295148 Srp72 Mouse triphenyl phosphate affects expression ISO SRP72 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SRP72 mRNA CTD PMID:37042841 Srp72 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of SRP72 mRNA CTD PMID:33045310 Srp72 Mouse tungsten decreases expression EXP 6480464 Tungsten results in decreased expression of SRP72 mRNA CTD PMID:30912803 Srp72 Mouse valproic acid multiple interactions ISO SRP72 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SRP72 mRNA CTD PMID:17183730 Srp72 Mouse valproic acid affects expression ISO SRP72 (Homo sapiens) 6480464 Valproic Acid affects the expression of SRP72 mRNA CTD PMID:25979313 Srp72 Mouse valproic acid decreases expression ISO SRP72 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SRP72 mRNA CTD PMID:19101580 more ...
1,2-dimethylhydrazine (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,6-dimethoxyphenol (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 5-fluorouracil (ISO) acrolein (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) atazanavir sulfate (ISO) azoxystrobin (ISO) benzo[a]pyrene (EXP) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bisphenol A (ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) caffeine (ISO) carbon nanotube (EXP) chenodeoxycholic acid (ISO) chlorpyrifos (EXP) coumarin (ISO) cyclosporin A (ISO) deguelin (ISO) deoxycholic acid (ISO) dexamethasone (ISO) dibenzo[a,l]pyrene (EXP) dicrotophos (ISO) disodium selenite (ISO) ethanol (EXP) folic acid (EXP) formaldehyde (ISO) FR900359 (ISO) furfural (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) glyphosate (EXP) hydralazine (ISO) hydrogen peroxide (ISO) indometacin (ISO) inulin (EXP) ivermectin (ISO) methyl methanesulfonate (ISO) nefazodone (ISO) nickel sulfate (ISO) oxaliplatin (ISO) ozone (ISO) p-menthan-3-ol (ISO) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (ISO) phenobarbital (EXP) picoxystrobin (ISO) resveratrol (EXP) rimonabant (EXP) sodium arsenite (ISO) sodium chloride (ISO) sunitinib (ISO) tetrachloromethane (EXP) titanium dioxide (EXP) triphenyl phosphate (ISO) triptonide (EXP) tungsten (EXP) valproic acid (ISO)
Srp72 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 77,122,548 - 77,147,782 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 77,122,530 - 77,147,784 (+) Ensembl GRCm39 Ensembl GRCm38 5 76,974,701 - 76,999,935 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 76,974,683 - 76,999,937 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 77,403,726 - 77,428,960 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 78,049,475 - 78,074,709 (+) NCBI MGSCv36 mm8 Celera 5 74,242,566 - 74,267,829 (+) NCBI Celera Cytogenetic Map 5 C3.3 NCBI cM Map 5 41.45 NCBI
SRP72 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 56,467,617 - 56,503,681 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 56,467,617 - 56,503,681 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 57,333,783 - 57,369,847 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 57,028,519 - 57,064,604 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 57,174,717 - 57,210,775 NCBI Celera 4 54,840,136 - 54,876,261 (+) NCBI Celera Cytogenetic Map 4 q12 NCBI HuRef 4 53,287,903 - 53,323,943 (+) NCBI HuRef CHM1_1 4 57,368,898 - 57,404,983 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 59,955,623 - 59,991,687 (+) NCBI T2T-CHM13v2.0
Srp72 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 31,522,424 - 31,549,978 (-) NCBI GRCr8 mRatBN7.2 14 31,168,175 - 31,195,717 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 31,168,293 - 31,195,729 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 31,546,080 - 31,573,369 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 32,854,412 - 32,881,701 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 31,339,085 - 31,366,374 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 33,447,583 - 33,453,788 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 14 33,325,108 - 33,351,416 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 33,462,627 - 33,489,312 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 14 30,481,417 - 30,508,939 (-) NCBI Celera Cytogenetic Map 14 p11 NCBI
Srp72 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955447 14,519,064 - 14,552,758 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955447 14,519,978 - 14,552,758 (-) NCBI ChiLan1.0 ChiLan1.0
SRP72 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 73,276,204 - 73,312,588 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 73,481,727 - 73,518,107 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 67,420,551 - 67,456,065 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 73,989,304 - 74,025,906 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 73,989,304 - 74,025,906 (-) Ensembl panpan1.1 panPan2
SRP72 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 48,688,295 - 48,717,826 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 48,688,295 - 48,717,824 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 48,578,763 - 48,608,289 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 49,302,508 - 49,332,068 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 49,302,504 - 49,332,069 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 48,974,564 - 49,004,098 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 48,503,375 - 48,532,917 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 49,449,469 - 49,479,000 (+) NCBI UU_Cfam_GSD_1.0
Srp72 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 27,576,494 - 27,611,170 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936482 18,687,046 - 18,721,757 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936482 18,687,088 - 18,721,734 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SRP72 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 55,729,116 - 55,762,015 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 55,729,202 - 55,762,298 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 57,788,069 - 57,820,984 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SRP72 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 12,127,817 - 12,162,992 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 12,126,607 - 12,162,951 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666066 12,801,516 - 12,838,175 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Srp72
.
Predicted Target Of
Count of predictions: 1294 Count of miRNA genes: 645 Interacting mature miRNAs: 793 Transcripts: ENSMUST00000101087, ENSMUST00000120550, ENSMUST00000125732, ENSMUST00000132860, ENSMUST00000141873, ENSMUST00000144741, ENSMUST00000146167, ENSMUST00000148423, ENSMUST00000150661 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301843 Listr1_m listeriosis resistance 1 (mouse) Not determined 5 60246081 94246203 Mouse 10043993 Hbnr10_m Heligmosomoides bakeri nematode resistance 10 (mouse) Not determined 5 72418876 106419011 Mouse 27226719 Tibw6_m tibia width 6, proximal, 16 week (mouse) 5 72857343 139985755 Mouse 4140990 Lgq6_m late growth QTL 6 (mouse) Not determined 32133234 100777931 Mouse 1301010 ahl2_m age related hearing loss 2 (mouse) Not determined 5 62650568 96650688 Mouse 4141438 Skmw13_m skeletal muscle weight 13 (mouse) Not determined 5 76190263 110190479 Mouse 1301713 Dbsty2_m diabesity 2 (mouse) Not determined 5 76445064 110445225 Mouse 11041899 Lmr24a_m leishmaniasis resistance 24a (mouse) 5 52694462 107321041 Mouse 14746981 Manh57_m mandible shape 57 (mouse) 5 47169742 81169742 Mouse 1301524 Lmb2_m lupus in MRL and B6 F2 cross (mouse) Not determined 5 37581488 112465722 Mouse 25314315 Mlh1fc4_m MLH1 foci count 4 (mouse) 5 74460661 132528839 Mouse 10045972 Tir5_m trypanosome infection response 5 (mouse) Not determined 5 63705442 104387065 Mouse 4142064 Tmc1m4_m Tmc1 modifier 4 (mouse) Not determined 5 54500177 127001072 Mouse 1300931 Cocrb6_m cocaine related behavior 6 (mouse) Not determined 5 76445064 110445225 Mouse 1301698 Pcfm4_m periosteal circumference and femur length 4 (mouse) Not determined 5 44585843 78585965 Mouse 4142317 Rgcs1_m retinal ganglion cell susceptible 1 (mouse) Not determined 55388334 108762627 Mouse 1301829 Thyls2_m thymic lymphoma susceptibility 2 (mouse) Not determined 5 76445064 110445225 Mouse 4141219 W10q16_m weight 10 weeks QTL 16 (mouse) Not determined 32133234 100777931 Mouse 12904740 M1fscn2_m modifier 1 of Fscn2 (mouse) 5 66529661 100529661 Mouse 10043962 Obq27_m obesity QTL 27 (mouse) Not determined 5 56285655 90285655 Mouse 4142428 Modvl1_m modifier of vacuolated lens 1 (mouse) Not determined 62650568 96650688 Mouse 1357431 Cia27_m collagen induced arthritis 27 (mouse) Not determined 5 75315348 120018629 Mouse 11040589 Lmr3a_m leishmaniasis resistance 3a (mouse) 5 59602801 93602980 Mouse 11040590 Lmr3b_m leishmaniasis resistance 3b (mouse) 5 59602801 93602980 Mouse 11040591 Lmr3c_m leishmaniasis resistance 3c (mouse) 5 59602801 93602980 Mouse 12904739 M2fscn2_m modifier 2 of FSCN2 (mouse) 5 66529661 100529661 Mouse 1301243 Bmd2_m bone mineral density 2 (mouse) Not determined 5 55388334 100455525 Mouse 1301691 Cdcs10_m cytokine deficiency colitis susceptibility 10 (mouse) Not determined 5 76280786 110280917 Mouse 13207584 Mwmlpt4_m Morris water maze latency to platform, training, 4 (mouse) 5 46322606 80322606 Mouse 11041665 Lmr24_m leishmaniasis resistance 24 (mouse) 5 52694462 107321041 Mouse 1300986 Hdlq2_m HDL QTL 2 (mouse) Not determined 5 76280786 110280917 Mouse 13207588 Mwmlpa4_m Morris water maze latency to platform, all, 4 (mouse) 5 46322606 80322606 Mouse 1301693 Sle6_m systemic lupus erythematosus susceptibility 6 (mouse) Not determined 5 8890693 87841837 Mouse 11049560 Lmr24d_m leishmaniasis resistance 24d (mouse) 5 64374877 98374996 Mouse 26884395 Humsd2_m humerus midshaft diameter 2, 10 week (mouse) 5 70057343 132528839 Mouse 13464249 Ahl16_m age related hearing loss, early onset 16 (mouse) 5 76445064 110445225 Mouse 13464248 Ahl13_m age related hearing loss, early onset 13 (mouse) 5 55645874 89645995 Mouse 11252124 Modvl6_m modifier of vacuolated lens 6 (mouse) 5 62650568 96650688 Mouse 13464250 Ahl15_m age related hearing loss, early onset 15 (mouse) 5 62650568 96650688 Mouse 11040592 Lmr3d_m leishmaniasis resistance 3d (mouse) 5 59602801 93602980 Mouse 11341716 Rvfs3_m Rift Valley fever susceptibility 3 (mouse) 5 26441234 138455402 Mouse 13464247 Ahl14_m age related hearing loss, early onset 14 (mouse) 5 60403062 94403160 Mouse 10412069 Desp3_m despair 3 (mouse) Not determined 5 72932684 77246203 Mouse 4141124 Dshv2_m dorsal hippocampal volume 2 (mouse) Not determined 5 75315348 98019803 Mouse 10044005 Ahl7_m age related hearing loss 7 (mouse) Not determined 5 58330502 92330641 Mouse 13506928 Recrq8_m recombination rate in male meiosis QTL 8 (mouse) 5 74460661 132528839 Mouse 4141505 Chlq14_m circulating hormone level QTL 14 (mouse) Not determined 5 76280786 110280917 Mouse
AI132477
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 76,999,104 - 76,999,224 UniSTS GRCm38 MGSCv37 5 77,428,129 - 77,428,249 UniSTS GRCm37 Celera 5 74,266,998 - 74,267,118 UniSTS Cytogenetic Map 5 C3.3 UniSTS Whitehead/MRC_RH 5 1013.26 UniSTS
RH126191
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 76,998,492 - 76,998,714 UniSTS GRCm38 MGSCv37 5 77,427,517 - 77,427,739 UniSTS GRCm37 Celera 5 74,266,386 - 74,266,608 UniSTS Cytogenetic Map 5 C3.3 UniSTS Whitehead/MRC_RH 5 1052.93 UniSTS
D10Mit157.2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 D1 UniSTS Cytogenetic Map 16 B4 UniSTS Cytogenetic Map 18 E2 UniSTS Cytogenetic Map 4 C3 UniSTS Cytogenetic Map 7 B2 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 14 E2.2 UniSTS Cytogenetic Map 4 C7 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 1 F UniSTS Cytogenetic Map 6 C3 UniSTS Cytogenetic Map 11 D UniSTS Cytogenetic Map 3 G2 UniSTS Cytogenetic Map 17 A1 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 3 B UniSTS Cytogenetic Map 8 C1 UniSTS Cytogenetic Map 18 A2 UniSTS Cytogenetic Map 3 F2 UniSTS Cytogenetic Map 14 C3 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 8 E2 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 18 B1 UniSTS Cytogenetic Map 9 C UniSTS Cytogenetic Map 14 C2 UniSTS Cytogenetic Map 6 A1 UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 13 D2.1 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 11 B1.3 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 17 E3 UniSTS Cytogenetic Map 11 B3 UniSTS Cytogenetic Map 1 H4 UniSTS Cytogenetic Map 6 A3 UniSTS Cytogenetic Map 5 E4-E5 UniSTS Cytogenetic Map 15 E1 UniSTS Cytogenetic Map 13 D UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 14 D1 UniSTS Cytogenetic Map 7 B4 UniSTS Cytogenetic Map 8 D3 UniSTS Cytogenetic Map X D UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 7 E2 UniSTS Cytogenetic Map 1 H2.3 UniSTS Cytogenetic Map 7 A2 UniSTS Cytogenetic Map 7 F3 UniSTS Cytogenetic Map 9 F1 UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 15 D2 UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 16 B2 UniSTS Cytogenetic Map 7 C UniSTS Cytogenetic Map 3 F2.1 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 1 C4 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 9 F3 UniSTS Cytogenetic Map 2 B UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 9 A4 UniSTS Cytogenetic Map 5 A3 UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 16 B1 UniSTS Cytogenetic Map 1 A5 UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 9 E1 UniSTS Cytogenetic Map 6 G1 UniSTS Cytogenetic Map X A2 UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 5 E2 UniSTS Cytogenetic Map 12 C1 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 10 C2 UniSTS Cytogenetic Map 9 B UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 10 A4 UniSTS Cytogenetic Map 8 A2 UniSTS Cytogenetic Map 18 A1 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 1 C2 UniSTS Cytogenetic Map 11 B2 UniSTS Cytogenetic Map 6 E3 UniSTS Cytogenetic Map 5 C3.3 UniSTS Cytogenetic Map 1 B UniSTS Cytogenetic Map 17 A3.1 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 4 B1 UniSTS Cytogenetic Map 15 A2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 5 G3 UniSTS Cytogenetic Map 4 A3 UniSTS Cytogenetic Map 2 H3 UniSTS Cytogenetic Map 8 A1 UniSTS Cytogenetic Map 8 A1.1 UniSTS Cytogenetic Map 16 A3 UniSTS Cytogenetic Map 10 B1 UniSTS Cytogenetic Map 19 A UniSTS Cytogenetic Map 10 A1 UniSTS Cytogenetic Map 13 D1 UniSTS Cytogenetic Map 4 A1 UniSTS Cytogenetic Map 9 A3 UniSTS Cytogenetic Map 17 C UniSTS Cytogenetic Map 1 D UniSTS Cytogenetic Map 5 E3 UniSTS Cytogenetic Map 15 D3 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 7 D3 UniSTS Cytogenetic Map 2 A1 UniSTS Cytogenetic Map 14 C1 UniSTS Cytogenetic Map 14 E5 UniSTS Cytogenetic Map 10 C UniSTS Cytogenetic Map 18 B2 UniSTS Cytogenetic Map 2 F1 UniSTS Cytogenetic Map 10 D3 UniSTS Cytogenetic Map 17 A2 UniSTS Cytogenetic Map 2 C3 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 17 B2 UniSTS Cytogenetic Map 5 B2 UniSTS Cytogenetic Map 5 G1 UniSTS Cytogenetic Map 4 C6 UniSTS Cytogenetic Map 13 C3 UniSTS Cytogenetic Map 2 E1 UniSTS Cytogenetic Map 17 A3.2-A3.3 UniSTS Cytogenetic Map 19 C3 UniSTS Cytogenetic Map 7 E3 UniSTS Cytogenetic Map 13 C1 UniSTS Cytogenetic Map 9 E3.1 UniSTS Cytogenetic Map 15 E3 UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X E3 UniSTS Cytogenetic Map 4 C4 UniSTS Cytogenetic Map 3 E3 UniSTS Cytogenetic Map 11 A4 UniSTS Cytogenetic Map 4 C5 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 9 A2 UniSTS Cytogenetic Map 7 E1 UniSTS Cytogenetic Map 5 D-E1 UniSTS Cytogenetic Map 5 B3 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 5 A2 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 1 E4 UniSTS Cytogenetic Map 17 E4 UniSTS Cytogenetic Map 1 G2 UniSTS Cytogenetic Map 15 B3.1 UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 6 A3.3 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 6 F2 UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 4 D2.1 UniSTS Cytogenetic Map 4 A5 UniSTS Cytogenetic Map 3 F2.2 UniSTS Cytogenetic Map 1 E3-E4 UniSTS Cytogenetic Map 9 F1-F3 UniSTS Cytogenetic Map 1 C1.1 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 12 A2 UniSTS Cytogenetic Map 17 A3-B UniSTS Cytogenetic Map 7 F5 UniSTS Cytogenetic Map 14 A3 UniSTS Cytogenetic Map 5 G1.1 UniSTS Cytogenetic Map X F2-F4 UniSTS Cytogenetic Map 7 D2 UniSTS Cytogenetic Map 2 F3 UniSTS Cytogenetic Map 10 A3 UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 9 F1-F2 UniSTS Cytogenetic Map 13 A3.2 UniSTS Cytogenetic Map 10 A2 UniSTS Cytogenetic Map 1 C1 UniSTS Cytogenetic Map 1 A1 UniSTS Cytogenetic Map 12 D3 UniSTS Cytogenetic Map 1 A3-A5 UniSTS Cytogenetic Map 2 A2 UniSTS Cytogenetic Map 3 A1 UniSTS Cytogenetic Map X A3.3 UniSTS Cytogenetic Map 16 A-B1 UniSTS Cytogenetic Map 1 D2.3 UniSTS Cytogenetic Map 6 B2.3 UniSTS Cytogenetic Map 2 G3 UniSTS Cytogenetic Map X A2-A3.1 UniSTS Cytogenetic Map 9 A5.3 UniSTS Cytogenetic Map 14 A2-B UniSTS Cytogenetic Map 8 E1-E2 UniSTS Cytogenetic Map 8 A3 UniSTS Cytogenetic Map 1 G3-H1 UniSTS Cytogenetic Map 8 B3-C1 UniSTS Cytogenetic Map 19 C1 UniSTS Cytogenetic Map 8 C5 UniSTS Cytogenetic Map 8 A4 UniSTS Cytogenetic Map 15 F3 UniSTS Cytogenetic Map 14 E4 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map X F5 UniSTS cM Map 10 40.0 UniSTS Whitehead Genetic 10 33.9 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000101087 ⟹ ENSMUSP00000098648
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 77,122,530 - 77,147,784 (+) Ensembl GRCm38.p6 Ensembl 5 76,974,683 - 76,999,937 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000120550 ⟹ ENSMUSP00000113312
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 77,122,554 - 77,146,663 (+) Ensembl GRCm38.p6 Ensembl 5 76,974,707 - 76,998,816 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000125732
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 77,141,840 - 77,142,750 (+) Ensembl GRCm38.p6 Ensembl 5 76,993,993 - 76,994,903 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000132860
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 77,144,821 - 77,147,784 (+) Ensembl GRCm38.p6 Ensembl 5 76,996,974 - 76,999,937 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000141873
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 77,131,942 - 77,142,993 (+) Ensembl GRCm38.p6 Ensembl 5 76,984,095 - 76,995,146 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000144741
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 77,145,252 - 77,146,188 (+) Ensembl GRCm38.p6 Ensembl 5 76,997,405 - 76,998,341 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000146167
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 77,143,104 - 77,145,336 (+) Ensembl GRCm38.p6 Ensembl 5 76,995,257 - 76,997,489 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000148423
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 77,128,426 - 77,130,561 (+) Ensembl GRCm38.p6 Ensembl 5 76,980,579 - 76,982,714 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000150661
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 77,122,568 - 77,128,437 (+) Ensembl GRCm38.p6 Ensembl 5 76,974,721 - 76,980,590 (+) Ensembl
RefSeq Acc Id:
NM_025691 ⟹ NP_079967
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 77,122,548 - 77,147,782 (+) NCBI GRCm38 5 76,974,701 - 76,999,935 (+) ENTREZGENE MGSCv37 5 77,403,726 - 77,428,960 (+) RGD Celera 5 74,242,566 - 74,267,829 (+) RGD cM Map 5 ENTREZGENE
Sequence:
ACCTCACCCCCACCTCCTCCAAGATGGCGAGCGGCGGCAGTGGTGGGGTGTCAGTCCCTGCGCTGTGGAGTGAGGTGAACCGTTATGGGCAGAACAGCGACTTCACGCGTGCCCTCAAGACTGTCAAC
hide sequence
RefSeq Acc Id:
NP_079967 ⟸ NM_025691
- UniProtKB:
E9Q740 (UniProtKB/TrEMBL), F8VQC1 (UniProtKB/TrEMBL)
- Sequence:
MASGGSGGVSVPALWSEVNRYGQNSDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESATQQTDKLKELYGQVLYRLERYDEC
hide sequence
Ensembl Acc Id:
ENSMUSP00000113312 ⟸ ENSMUST00000120550
Ensembl Acc Id:
ENSMUSP00000098648 ⟸ ENSMUST00000101087
RGD ID: 6886962 Promoter ID: EPDNEW_M6932 Type: multiple initiation site Name: Srp72_1 Description: Mus musculus signal recognition particle 72 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M6933 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 76,974,713 - 76,974,773 EPDNEW
RGD ID: 6886964 Promoter ID: EPDNEW_M6933 Type: multiple initiation site Name: Srp72_2 Description: Mus musculus signal recognition particle 72 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M6932 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 76,984,168 - 76,984,228 EPDNEW
RGD ID: 6838416 Promoter ID: MM_KWN:42663 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000120550, OTTMUST00000065682, OTTMUST00000065686 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 77,403,476 - 77,404,202 (+) MPROMDB
RGD ID: 6838415 Promoter ID: MM_KWN:42665 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Liver Transcripts: OTTMUST00000065684 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 77,411,891 - 77,412,391 (+) MPROMDB
RGD ID: 6838417 Promoter ID: MM_KWN:42667 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Liver Transcripts: OTTMUST00000065689 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 77,423,206 - 77,423,706 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-21
Srp72
signal recognition particle 72
Srp72
signal recognition particle 72 kDa
Symbol and/or name change
5135510 APPROVED
2024-08-21
Srp72
signal recognition particle 72 kDa
Srp72
signal recognition particle 72
Symbol and/or name change
5135510 APPROVED
