Symbol:
Cdc14a
Name:
CDC14 cell division cycle 14A
RGD ID:
1312212
MGI Page
MGI
Description:
Predicted to enable protein serine/threonine phosphatase activity and protein tyrosine phosphatase activity. Involved in sensory perception of sound. Located in kinociliary basal body and stereocilium tip. Is expressed in several structures, including alimentary system; brain; cardiovascular system; genitourinary system; and sensory organ. Used to study autosomal recessive nonsyndromic deafness 32. Human ortholog(s) of this gene implicated in autosomal recessive nonsyndromic deafness 32. Orthologous to human CDC14A (cell division cycle 14A).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A830059A17Rik; Cdc14; CDC14 cell division cycle 14 homolog A; CDC14a1; CDC14A2; dual specificity protein phosphatase CDC14A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CDC14A (cell division cycle 14A) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Cdc14a (cell division cycle 14A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cdc14a (cell division cycle 14A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CDC14A (cell division cycle 14A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CDC14A (cell division cycle 14A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101972535 (dual specificity protein phosphatase CDC14A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CDC14A (cell division cycle 14A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CDC14A (cell division cycle 14A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cdc14a (cell division cycle 14A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Cdc14a (cell division cycle 14A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CDC14A (cell division cycle 14A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cdc14aa (cell division cycle 14Aa)
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Danio rerio (zebrafish):
cdc14ab (cell division cycle 14Ab)
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
CDC14
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
cdc-14
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
cdc14
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cdc14a
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 116,066,202 - 116,222,390 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 116,066,202 - 116,222,394 (-) Ensembl GRCm39 Ensembl GRCm38 3 116,272,553 - 116,428,741 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 116,272,553 - 116,428,745 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 115,975,471 - 116,126,950 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 116,608,926 - 116,759,661 (-) NCBI MGSCv36 mm8 MGSCv36 3 116,264,557 - 116,416,036 (-) NCBI MGSCv36 mm8 Celera 3 122,716,884 - 122,851,142 (-) NCBI Celera Cytogenetic Map 3 G1 NCBI cM Map 3 50.24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cdc14a Mouse 1,2-dimethylhydrazine affects expression EXP 6480464 1 and 2-Dimethylhydrazine affects the expression of CDC14A mRNA CTD PMID:22206623 Cdc14a Mouse 17beta-estradiol multiple interactions ISO Cdc14a (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CDC14A mRNA CTD PMID:26496021 Cdc14a Mouse 17beta-estradiol multiple interactions ISO CDC14A (Homo sapiens) 6480464 Estradiol promotes the reaction [CDC14A protein binds to ESR1 protein] CTD PMID:27156127 Cdc14a Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cdc14a (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of CDC14A mRNA CTD PMID:22298810 and PMID:32109520 Cdc14a Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cdc14a (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CDC14A mRNA CTD PMID:33387578 Cdc14a Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cdc14a (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CDC14A mRNA CTD PMID:34747641 Cdc14a Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of CDC14A gene CTD PMID:31683443 Cdc14a Mouse acetamide increases expression ISO Cdc14a (Rattus norvegicus) 6480464 acetamide results in increased expression of CDC14A mRNA CTD PMID:31881176 Cdc14a Mouse arsenite(3-) multiple interactions ISO CDC14A (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to CDC14A mRNA] CTD PMID:32406909 Cdc14a Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of CDC14A mRNA CTD PMID:19770486 Cdc14a Mouse benzo[a]pyrene decreases expression ISO CDC14A (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CDC14A mRNA CTD PMID:22316170 Cdc14a Mouse bisphenol A multiple interactions ISO Cdc14a (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CDC14A mRNA and [bisphenol A co-treated with tributyltin] results in decreased expression of CDC14A mRNA CTD PMID:26496021 and PMID:31129395 Cdc14a Mouse bisphenol A increases methylation ISO CDC14A (Homo sapiens) 6480464 bisphenol A results in increased methylation of CDC14A gene CTD PMID:31601247 Cdc14a Mouse bisphenol A decreases expression ISO Cdc14a (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of CDC14A mRNA CTD PMID:30816183 and PMID:32528016 Cdc14a Mouse bisphenol A affects expression ISO Cdc14a (Rattus norvegicus) 6480464 bisphenol A affects the expression of CDC14A mRNA CTD PMID:25181051 Cdc14a Mouse bisphenol AF increases expression ISO Cdc14a (Rattus norvegicus) 6480464 bisphenol AF results in increased expression of CDC14A mRNA CTD PMID:27567155 Cdc14a Mouse capsaicin increases expression ISO Cdc14a (Rattus norvegicus) 6480464 Capsaicin results in increased expression of CDC14A mRNA CTD PMID:20349343 Cdc14a Mouse carbon nanotube decreases expression ISO CDC14A (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of CDC14A mRNA CTD PMID:15585362 Cdc14a Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Cdc14a Mouse CGP 52608 multiple interactions ISO CDC14A (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CDC14A gene] CTD PMID:28238834 Cdc14a Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of CDC14A mRNA CTD PMID:28472532 Cdc14a Mouse cisplatin multiple interactions ISO CDC14A (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of CDC14A mRNA CTD PMID:27392435 Cdc14a Mouse cobalt dichloride decreases expression ISO Cdc14a (Rattus norvegicus) 6480464 cobaltous chloride results in decreased expression of CDC14A mRNA CTD PMID:24386269 Cdc14a Mouse copper atom multiple interactions ISO CDC14A (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of CDC14A mRNA CTD PMID:30911355 Cdc14a Mouse copper(0) multiple interactions ISO CDC14A (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of CDC14A mRNA CTD PMID:30911355 Cdc14a Mouse Cuprizon increases expression ISO Cdc14a (Rattus norvegicus) 6480464 Cuprizone results in increased expression of CDC14A mRNA CTD PMID:26577399 Cdc14a Mouse desferrioxamine B increases expression ISO CDC14A (Homo sapiens) 6480464 Deferoxamine results in increased expression of CDC14A mRNA alternative form CTD PMID:16760464 Cdc14a Mouse Dibutyl phosphate affects expression ISO CDC14A (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CDC14A mRNA CTD PMID:37042841 Cdc14a Mouse dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of CDC14A mRNA CTD PMID:21266533 Cdc14a Mouse dibutyl phthalate decreases expression ISO Cdc14a (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of CDC14A mRNA CTD PMID:21266533 Cdc14a Mouse diuron decreases expression ISO CDC14A (Homo sapiens) 6480464 Diuron results in decreased expression of CDC14A mRNA CTD PMID:35967413 Cdc14a Mouse dorsomorphin multiple interactions ISO CDC14A (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cdc14a Mouse doxorubicin decreases expression ISO CDC14A (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CDC14A mRNA CTD PMID:29803840 Cdc14a Mouse endosulfan decreases expression ISO Cdc14a (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of CDC14A mRNA CTD PMID:29391264 Cdc14a Mouse entinostat multiple interactions ISO CDC14A (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CDC14A mRNA CTD PMID:27188386 Cdc14a Mouse entinostat decreases expression ISO CDC14A (Homo sapiens) 6480464 entinostat results in decreased expression of CDC14A mRNA CTD PMID:26272509 Cdc14a Mouse flutamide decreases expression ISO Cdc14a (Rattus norvegicus) 6480464 Flutamide results in decreased expression of CDC14A mRNA CTD PMID:24793618 Cdc14a Mouse FR900359 decreases phosphorylation ISO CDC14A (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of CDC14A protein CTD PMID:37730182 Cdc14a Mouse fulvestrant increases methylation ISO CDC14A (Homo sapiens) 6480464 Fulvestrant results in increased methylation of CDC14A gene CTD PMID:31601247 Cdc14a Mouse GW 3965 increases expression ISO CDC14A (Homo sapiens) 6480464 GW 3965 results in increased expression of CDC14A mRNA CTD PMID:31437187 Cdc14a Mouse leflunomide increases expression ISO CDC14A (Homo sapiens) 6480464 leflunomide results in increased expression of CDC14A mRNA CTD PMID:28988120 Cdc14a Mouse nickel atom increases expression EXP 6480464 Nickel results in increased expression of CDC14A mRNA CTD PMID:18922574 Cdc14a Mouse O-methyleugenol decreases expression ISO CDC14A (Homo sapiens) 6480464 methyleugenol results in decreased expression of CDC14A mRNA CTD PMID:32234424 Cdc14a Mouse okadaic acid increases expression ISO CDC14A (Homo sapiens) 6480464 Okadaic Acid results in increased expression of CDC14A mRNA CTD PMID:38832940 Cdc14a Mouse oxaliplatin multiple interactions ISO Cdc14a (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CDC14A mRNA CTD PMID:25729387 Cdc14a Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CDC14A mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of CDC14A mRNA CTD PMID:27106289 and PMID:34911549 Cdc14a Mouse ozone multiple interactions ISO CDC14A (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of CDC14A mRNA CTD PMID:35430440 Cdc14a Mouse paracetamol decreases expression ISO Cdc14a (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of CDC14A mRNA CTD PMID:33387578 Cdc14a Mouse phenylmercury acetate decreases expression ISO CDC14A (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of CDC14A mRNA CTD PMID:26272509 Cdc14a Mouse phenylmercury acetate multiple interactions ISO CDC14A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CDC14A mRNA CTD PMID:27188386 Cdc14a Mouse quercetin decreases expression ISO CDC14A (Homo sapiens) 6480464 Quercetin results in decreased expression of CDC14A mRNA CTD PMID:23727915 Cdc14a Mouse SB 431542 multiple interactions ISO CDC14A (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cdc14a Mouse silver(1+) nitrate increases expression ISO CDC14A (Homo sapiens) 6480464 Silver Nitrate analog results in increased expression of CDC14A mRNA CTD PMID:22831968 Cdc14a Mouse sodium arsenate decreases expression EXP 6480464 sodium arsenate results in decreased expression of CDC14A mRNA CTD PMID:30953684 Cdc14a Mouse sodium arsenite affects methylation ISO CDC14A (Homo sapiens) 6480464 sodium arsenite affects the methylation of CDC14A gene CTD PMID:28589171 Cdc14a Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of CDC14A mRNA CTD PMID:37682722 Cdc14a Mouse sodium arsenite decreases expression ISO CDC14A (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CDC14A mRNA CTD PMID:34032870 Cdc14a Mouse sodium arsenite increases expression ISO CDC14A (Homo sapiens) 6480464 sodium arsenite results in increased expression of CDC14A mRNA CTD PMID:38568856 Cdc14a Mouse sunitinib increases expression ISO CDC14A (Homo sapiens) 6480464 Sunitinib results in increased expression of CDC14A mRNA CTD PMID:31533062 Cdc14a Mouse testosterone multiple interactions EXP 6480464 1 more ... CTD PMID:33848595 Cdc14a Mouse testosterone increases expression EXP 6480464 Testosterone deficiency results in increased expression of CDC14A mRNA CTD PMID:33848595 Cdc14a Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of CDC14A mRNA CTD PMID:23557971 Cdc14a Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of CDC14A mRNA CTD PMID:35295148 Cdc14a Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of CDC14A gene CTD PMID:35295148 Cdc14a Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of CDC14A gene CTD PMID:35295148 Cdc14a Mouse topotecan multiple interactions ISO Cdc14a (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CDC14A mRNA CTD PMID:25729387 Cdc14a Mouse topotecan decreases expression ISO Cdc14a (Rattus norvegicus) 6480464 Topotecan results in decreased expression of CDC14A mRNA CTD PMID:25729387 Cdc14a Mouse tributylstannane multiple interactions ISO Cdc14a (Rattus norvegicus) 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of CDC14A mRNA CTD PMID:31129395 Cdc14a Mouse trichostatin A decreases expression ISO CDC14A (Homo sapiens) 6480464 trichostatin A results in decreased expression of CDC14A mRNA CTD PMID:24935251 and PMID:26272509 Cdc14a Mouse trichostatin A multiple interactions ISO CDC14A (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CDC14A mRNA CTD PMID:27188386 Cdc14a Mouse triclosan decreases expression ISO CDC14A (Homo sapiens) 6480464 Triclosan results in decreased expression of CDC14A mRNA CTD PMID:30510588 Cdc14a Mouse triphenyl phosphate affects expression ISO CDC14A (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CDC14A mRNA CTD PMID:37042841 Cdc14a Mouse urethane increases expression ISO CDC14A (Homo sapiens) 6480464 Urethane results in increased expression of CDC14A mRNA CTD PMID:28818685 Cdc14a Mouse valproic acid affects expression ISO CDC14A (Homo sapiens) 6480464 Valproic Acid affects the expression of CDC14A mRNA CTD PMID:25979313 Cdc14a Mouse valproic acid multiple interactions ISO CDC14A (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CDC14A mRNA CTD PMID:27188386 Cdc14a Mouse valproic acid decreases expression ISO CDC14A (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CDC14A mRNA CTD PMID:23179753 more ... Cdc14a Mouse vinclozolin affects expression ISO Cdc14a (Rattus norvegicus) 6480464 vinclozolin affects the expression of CDC14A mRNA CTD PMID:19015723 Cdc14a Mouse zoledronic acid increases expression ISO CDC14A (Homo sapiens) 6480464 zoledronic acid results in increased expression of CDC14A mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 4,4'-sulfonyldiphenol (EXP) acetamide (ISO) arsenite(3-) (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (ISO) bisphenol AF (ISO) capsaicin (ISO) carbon nanotube (EXP,ISO) CGP 52608 (ISO) chromium(6+) (EXP) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) Cuprizon (ISO) desferrioxamine B (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diuron (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (ISO) entinostat (ISO) flutamide (ISO) FR900359 (ISO) fulvestrant (ISO) GW 3965 (ISO) leflunomide (ISO) nickel atom (EXP) O-methyleugenol (ISO) okadaic acid (ISO) oxaliplatin (ISO) ozone (EXP,ISO) paracetamol (ISO) phenylmercury acetate (ISO) quercetin (ISO) SB 431542 (ISO) silver(1+) nitrate (ISO) sodium arsenate (EXP) sodium arsenite (EXP,ISO) sunitinib (ISO) testosterone (EXP) titanium dioxide (EXP) topotecan (ISO) tributylstannane (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (ISO) zoledronic acid (ISO)
1.
Updating the RNA polymerase CTD code: adding gene-specific layers.
Egloff S, etal., Trends Genet. 2012 Jul;28(7):333-41. doi: 10.1016/j.tig.2012.03.007. Epub 2012 May 21.
2.
The writers, readers, and functions of the RNA polymerase II C-terminal domain code.
Jeronimo C, etal., Chem Rev. 2013 Nov 13;113(11):8491-522. doi: 10.1021/cr4001397. Epub 2013 Jul 10.
3.
MGDs mouse GO annotations
MGD data from the GO Consortium
4.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Database resources of the National Center for Biotechnology Information.
Wheeler DL, etal., Nucleic Acids Res 2001 Jan 1;29(1):11-6.
Cdc14a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 116,066,202 - 116,222,390 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 116,066,202 - 116,222,394 (-) Ensembl GRCm39 Ensembl GRCm38 3 116,272,553 - 116,428,741 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 116,272,553 - 116,428,745 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 115,975,471 - 116,126,950 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 116,608,926 - 116,759,661 (-) NCBI MGSCv36 mm8 MGSCv36 3 116,264,557 - 116,416,036 (-) NCBI MGSCv36 mm8 Celera 3 122,716,884 - 122,851,142 (-) NCBI Celera Cytogenetic Map 3 G1 NCBI cM Map 3 50.24 NCBI
CDC14A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 100,345,001 - 100,520,277 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 100,325,629 - 100,520,277 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 100,810,557 - 100,985,833 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 100,590,611 - 100,758,421 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 99,079,156 - 99,246,987 (+) NCBI Celera Cytogenetic Map 1 p21.2 NCBI HuRef 1 98,941,758 - 99,109,581 (+) NCBI HuRef CHM1_1 1 100,934,209 - 101,101,908 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 100,192,980 - 100,368,314 (+) NCBI T2T-CHM13v2.0
Cdc14a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 206,910,475 - 207,070,537 (-) NCBI GRCr8 mRatBN7.2 2 204,225,540 - 204,380,927 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 204,225,540 - 204,380,927 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 211,889,131 - 212,044,352 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 209,783,936 - 209,945,711 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 204,600,985 - 204,762,781 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 219,302,577 - 219,458,345 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 219,302,577 - 219,458,271 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 237,754,786 - 237,915,834 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 212,495,540 - 212,652,895 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 212,459,352 - 212,615,522 (-) NCBI Celera 2 196,721,585 - 196,876,703 (-) NCBI Celera Cytogenetic Map 2 q42 NCBI
Cdc14a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955435 5,099,107 - 5,248,679 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955435 5,099,576 - 5,230,252 (+) NCBI ChiLan1.0 ChiLan1.0
CDC14A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 126,507,194 - 126,677,627 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 125,665,337 - 125,835,694 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 103,002,408 - 103,178,622 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 101,716,711 - 101,892,619 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 101,724,213 - 101,892,619 (+) Ensembl panpan1.1 panPan2
CDC14A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 49,429,675 - 49,678,376 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 49,497,939 - 49,693,665 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 52,057,984 - 52,349,812 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 49,861,063 - 50,019,311 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 49,861,010 - 50,042,321 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 49,424,649 - 49,717,496 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 49,404,432 - 49,696,446 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 49,834,388 - 50,126,448 (-) NCBI UU_Cfam_GSD_1.0
LOC101972535
CDC14A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 117,635,861 - 117,805,254 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 117,635,849 - 117,804,568 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 129,230,515 - 129,319,122 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CDC14A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 32,822,748 - 32,987,739 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 32,822,746 - 32,986,718 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 25,071,050 - 25,235,874 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cdc14a
.
Predicted Target Of
Count of predictions: 2075 Count of miRNA genes: 607 Interacting mature miRNAs: 795 Transcripts: ENSMUST00000090464, ENSMUST00000106491, ENSMUST00000127704, ENSMUST00000136994, ENSMUST00000148857 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301904 Iba2_m induction of brown adipocytes 2 (mouse) Not determined 3 82147043 116147184 Mouse 1300752 Ap6q_m alcohol preference 6 QTL (mouse) Not determined 3 100372912 147045722 Mouse 26884382 Bzwq1_m bi-zygomatic width QTL 1, 5 week (mouse) 3 52207421 137205761 Mouse 11041900 Lmr11a_m leishmaniasis resistance 11a (mouse) 3 83463991 117464137 Mouse 14746984 Manh54_m mandible shape 54 (mouse) 3 85289152 119289152 Mouse 12910796 Pwbwq6_m post-weaning body weight QTL 6 (mouse) 3 110084357 135715812 Mouse 12738440 Twq3_m testis weight QTL 3 (mouse) 3 87228015 121228015 Mouse 25314313 Syncl1_m synaptonemal complex length 1 (mouse) 3 67907333 128393649 Mouse 1301272 Cfsw1_m cystic fibrosis survival to weaning 1 (mouse) Not determined 3 83882912 117883044 Mouse 12910793 Pwbwq7_m post-weaning body weight QTL 7 (mouse) 3 110084357 135715812 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 11533920 Mvb3_m modifier of vibrator 3 (mouse) 3 98635284 132635383 Mouse 10766455 Sle22_m systematic lupus erythematosus susceptibility 22 (mouse) 3 90376936 124377072 Mouse 1301381 Bomb1_m bone marrow pre-B 1 (mouse) Not determined 3 111133243 145133417 Mouse 14747001 Mancz4_m mandible centroid size 4 (mouse) 3 90378017 124378017 Mouse 1300619 Cdcs1_m cytokine deficiency colitis susceptibility 1 (mouse) Not determined 3 109834882 143835005 Mouse 26884419 Bzwq6_m bi-zygomatic width QTL 6, 10 week (mouse) 3 100607316 137205761 Mouse 1301705 Sles3_m systemic lupus erythmatosus suppressor 3 (mouse) Not determined 3 37174862 143353183 Mouse 12910815 Ogrq1_m overall growth rate QTL 1 (mouse) 3 110084357 135715812 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 1357583 Sle18_m systematic lupus erythematosus susceptibility 18 (mouse) Not determined 3 87208904 125316236 Mouse 12792984 Modn1_m modifier of Dstn neovascularization 1 (mouse) 3 98635284 132635383 Mouse 26884422 Cvht7_m cranial vault height 7, 16 week (mouse) 3 28954149 118893649 Mouse 4142178 Ctrq2_m C. trachomatis resistance QTL 2 (mouse) Not determined 3 89139967 137453008 Mouse 1302093 Orgwq5_m organ weight QTL 5 (mouse) Not determined 3 107376936 147304689 Mouse 10043955 Wt10q4_m body weight, 10 weeks, QTL 4 (mouse) Not determined 3 98624041 132624197 Mouse 8655599 Cia5c_m collagen induced arthritis QTL 5c (mouse) Not determined 3 107376936 125316237 Mouse 4142099 Cq3_m cholesterol QTL 3 (mouse) Not determined 3 84888918 118889067 Mouse 11039512 Ltpr3b_m Leishmania tropica response 3b (mouse) 3 83463991 117464137 Mouse 1302114 Tbs1_m tuberculosis severity 1 (mouse) Not determined 3 98924105 132924250 Mouse 27226733 Tibmd6_m tibia midshaft diameter 6, 16 week (mouse) 3 101307316 149805637 Mouse 27226732 Tibmd3_m tibia midshaft diameter 3, 10 week (mouse) 3 96607316 147805636 Mouse 1301349 Pgia26_m proteoglycan induced arthritis 26 (mouse) Not determined 3 92251533 126251650 Mouse 1302052 Etohcta4_m ethanol conditioned taste aversion 4 (mouse) Not determined 3 91000105 125008748 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 11039507 Ltpr3g_m Leishmania tropica response 3g (mouse) 3 83463991 117464137 Mouse 11039508 Ltpr3f_m Leishmania tropica response 3f (mouse) 3 83463991 117464137 Mouse 11039509 Ltpr3e_m Leishmania tropica response 3e (mouse) 3 83463991 117464137 Mouse 11039510 Ltpr3d_m Leishmania tropica response 3d (mouse) 3 83463991 117464137 Mouse 1301805 Mors2_m modifier of obesity related sterility 2 (mouse) Not determined 3 103482659 137482783 Mouse 11039511 Ltpr3c_m Leishmania tropica response 3c (mouse) 3 83463991 117464137 Mouse 1301100 Bdt2_m bone density traits 2 (mouse) Not determined 3 114736617 148736784 Mouse
Cdc14a
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 116,273,336 - 116,274,106 UniSTS GRCm38 MGSCv37 3 115,976,254 - 115,977,024 UniSTS GRCm37 Cytogenetic Map 3 G1 UniSTS cM Map 3 UniSTS
UniSTS:234810
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 116,273,743 - 116,273,942 UniSTS GRCm38 MGSCv37 3 115,976,661 - 115,976,860 UniSTS GRCm37 Cytogenetic Map 3 G1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000090464 ⟹ ENSMUSP00000087950
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 116,066,202 - 116,217,681 (-) Ensembl GRCm38.p6 Ensembl 3 116,272,553 - 116,424,032 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000106491 ⟹ ENSMUSP00000102100
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 116,066,202 - 116,217,635 (-) Ensembl GRCm38.p6 Ensembl 3 116,272,553 - 116,423,986 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000127704
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 116,119,688 - 116,217,681 (-) Ensembl GRCm38.p6 Ensembl 3 116,326,039 - 116,424,032 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000136994
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 116,197,757 - 116,217,544 (-) Ensembl GRCm38.p6 Ensembl 3 116,404,108 - 116,423,895 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000148857
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 116,193,835 - 116,216,673 (-) Ensembl GRCm38.p6 Ensembl 3 116,400,186 - 116,423,024 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000197830 ⟹ ENSMUSP00000142479
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 116,115,859 - 116,216,298 (-) Ensembl GRCm38.p6 Ensembl 3 116,322,210 - 116,422,649 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000199454
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 116,197,036 - 116,199,137 (-) Ensembl GRCm38.p6 Ensembl 3 116,403,387 - 116,405,488 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000239145 ⟹ ENSMUSP00000159189
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 116,087,173 - 116,222,394 (-) Ensembl GRCm38.p6 Ensembl 3 116,293,524 - 116,428,745 (-) Ensembl
RefSeq Acc Id:
NM_001080818 ⟹ NP_001074287
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,066,202 - 116,217,681 (-) NCBI GRCm38 3 116,272,553 - 116,424,032 (-) NCBI MGSCv37 3 115,975,471 - 116,126,950 (-) RGD Celera 3 122,716,884 - 122,851,142 (-) RGD cM Map 3 ENTREZGENE
Sequence:
GGAGGAGGAGAGGGAGGAAGAGTTGCTGCTGAAAGGAGGTGGCGAAGGAGGAGTCTGAGCAGCTGCTACTAGCCCCGCGGACACCTCCGGAGTCCTGCCCGCTGCCGCACGAGTGGCCACGGGCGCGA
hide sequence
RefSeq Acc Id:
NM_001173553 ⟹ NP_001167024
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,066,202 - 116,217,681 (-) NCBI GRCm38 3 116,272,553 - 116,424,032 (-) NCBI MGSCv37 3 115,975,471 - 116,126,950 (-) RGD Celera 3 122,716,884 - 122,851,142 (-) RGD cM Map 3 ENTREZGENE
Sequence:
GGAGGAGGAGAGGGAGGAAGAGTTGCTGCTGAAAGGAGGTGGCGAAGGAGGAGTCTGAGCAGCT
hide sequence
RefSeq Acc Id:
NM_001355646 ⟹ NP_001342575
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,066,202 - 116,147,893 (-) NCBI GRCm38 3 116,272,553 - 116,354,244 (-) NCBI
Sequence:
GTACGTGTGCATACTGCTGTGTATGAGCGTGCACATGGAGGCCGTGGGGACAACCTTGGGTAGCCTTCCTCAGGGATGCATCTTTTGGAAACTGCACTTACAACCTCACCGTCCTTGACTGTTTACAA
hide sequence
RefSeq Acc Id:
NM_001378993 ⟹ NP_001365922
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,087,172 - 116,217,721 (-) NCBI GRCm38 3 116,293,523 - 116,424,072 (-) NCBI
Sequence:
GGGCGGGGAGGCAGGTCTGGGGGCGGACCTAAGAGGAGGAGGAGGAGGAGAGGGAGGAAGAGTT
hide sequence
RefSeq Acc Id:
NM_001378994 ⟹ NP_001365923
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,087,172 - 116,222,390 (-) NCBI GRCm38 3 116,293,523 - 116,428,741 (-) NCBI
Sequence:
AGTATTGTGATGCAGAGCATGGCTGAGCCCGACTAACATCTTAAGATCGATTATATTTTGCTACTTTAAGGAATAGACCAAAAAGCACAATAAATATCCACTATTTCTCCATCGACGAGGAGCTGGTC
hide sequence
RefSeq Acc Id:
XM_017319562 ⟹ XP_017175051
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,087,177 - 116,151,442 (-) NCBI GRCm38 3 116,293,523 - 116,357,794 (-) NCBI
Sequence:
CTCTCAAGATTAACCCAGGCTTTGATAATCGCTCAATGGCGGCTGTGTTGCTCGGGTGACTGTT
hide sequence
RefSeq Acc Id:
XM_030252597 ⟹ XP_030108457
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,087,177 - 116,217,714 (-) NCBI GRCm38 3 116,293,523 - 116,424,068 (-) NCBI
Sequence:
GAGGCAGGTCTGGGGGCGGACCTAAGAGGAGGAGGAGGAGGAGAGGGAGGAAGAGTTGCTGCTG
hide sequence
RefSeq Acc Id:
XM_036163079 ⟹ XP_036018972
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,087,172 - 116,217,719 (-) NCBI
Sequence:
GCGGGGAGGCAGGTCTGGGGGCGGACCTAAGAGGAGGAGGAGGAGGAGAGGGAGGAAGAGTTGCTGCTGAAAGGAGGTGGCGAAGGAGGAGTCTGAGCAGCTGCTACTAGCCCCGCGGACACCTCCGG
hide sequence
RefSeq Acc Id:
XM_036163080 ⟹ XP_036018973
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,066,202 - 116,217,719 (-) NCBI
Sequence:
GCGGGGAGGCAGGTCTGGGGGCGGACCTAAGAGGAGGAGGAGGAGGAGAGGGAGGAAGAGTTGC
hide sequence
RefSeq Acc Id:
XM_036163081 ⟹ XP_036018974
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,087,177 - 116,217,714 (-) NCBI
Sequence:
GAGGCAGGTCTGGGGGCGGACCTAAGAGGAGGAGGAGGAGGAGAGGGAGGAAGAGTTGCTGCTG
hide sequence
RefSeq Acc Id:
XM_036163082 ⟹ XP_036018975
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,067,253 - 116,217,605 (-) NCBI
Sequence:
GCGGACACCTCCGGAGTCCTGCCCGCTGCCGCACGAGTGGCCACGGGCGCGATCCGGGCCAAAC
hide sequence
RefSeq Acc Id:
XR_004941316
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,066,202 - 116,217,724 (-) NCBI
Sequence:
GGAGGGCGGGGAGGCAGGTCTGGGGGCGGACCTAAGAGGAGGAGGAGGAGGAGAGGGAGGAAGA
hide sequence
RefSeq Acc Id:
XR_004941317
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 116,066,202 - 116,217,723 (-) NCBI
Sequence:
GAGGGCGGGGAGGCAGGTCTGGGGGCGGACCTAAGAGGAGGAGGAGGAGGAGAGGGAGGAAGAGTTGCTGCTGAAAGGAGGTGGCGAAGGAGGAGTCTGAGCAGCTGCTACTAGCCCCGCGGACACCT
hide sequence
RefSeq Acc Id:
NP_001074287 ⟸ NM_001080818
- Peptide Label:
isoform 1
- UniProtKB:
Q8BZ66 (UniProtKB/Swiss-Prot), Q6GQT0 (UniProtKB/Swiss-Prot)
- Sequence:
MAAESGELIGACEFMKDRLYFATLRNRPKSTINIHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTSFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLP
hide sequence
RefSeq Acc Id:
NP_001167024 ⟸ NM_001173553
- Peptide Label:
isoform 2
- UniProtKB:
Q6GQT0 (UniProtKB/Swiss-Prot)
- Sequence:
MAAESGELIGACEFMKDRLYFATLRNRPKSTINIHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTSFDQRKRANAAFLIGAYAGLQHGFFDFETFDAEEYEHYERVEN
hide sequence
RefSeq Acc Id:
XP_017175051 ⟸ XM_017319562
- Peptide Label:
isoform X3
- Sequence:
MKHYRFTHAEIIAWIRICRPGSIIGPQQHFLKEKQASLWVQGDIFRSKLKNRPSSEGSITKIIS
hide sequence
RefSeq Acc Id:
NP_001342575 ⟸ NM_001355646
- Peptide Label:
isoform 3
RefSeq Acc Id:
XP_030108457 ⟸ XM_030252597
- Peptide Label:
isoform X3
RefSeq Acc Id:
NP_001365923 ⟸ NM_001378994
- Peptide Label:
isoform 5
- UniProtKB:
A0A5F8MPZ4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001365922 ⟸ NM_001378993
- Peptide Label:
isoform 4
Ensembl Acc Id:
ENSMUSP00000087950 ⟸ ENSMUST00000090464
Ensembl Acc Id:
ENSMUSP00000142479 ⟸ ENSMUST00000197830
Ensembl Acc Id:
ENSMUSP00000159189 ⟸ ENSMUST00000239145
Ensembl Acc Id:
ENSMUSP00000102100 ⟸ ENSMUST00000106491
RefSeq Acc Id:
XP_036018973 ⟸ XM_036163080
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_036018975 ⟸ XM_036163082
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_036018972 ⟸ XM_036163079
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_036018974 ⟸ XM_036163081
- Peptide Label:
isoform X3
RGD ID: 6833559 Promoter ID: MM_KWN:35887 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000090464, ENSMUST00000106491, OTTMUST00000072811, OTTMUST00000072812, OTTMUST00000072813 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 116,126,741 - 116,127,947 (-) MPROMDB
RGD ID: 6882200 Promoter ID: EPDNEW_M4536 Type: initiation region Name: Cdc14a_1 Description: Mus musculus CDC14 cell division cycle 14A , transcript variant1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 116,423,974 - 116,424,034 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-07-10
Cdc14a
CDC14 cell division cycle 14A
Cdc14a
CDC14 cell division cycle 14 homolog A (S. cerevisiae)
Symbol and/or name change
5135510 APPROVED
