Symbol:
Kdelr2
Name:
KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2
RGD ID:
1312162
MGI Page
MGI
Description:
Predicted to enable KDEL sequence binding activity. Predicted to be involved in protein retention in ER lumen and retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum. Predicted to be located in Golgi membrane and endoplasmic reticulum membrane. Predicted to be active in cis-Golgi network and endoplasmic reticulum. Predicted to colocalize with COPI-coated vesicle membrane. Is expressed in limb; otic capsule; palatal shelf; and skeleton. Human ortholog(s) of this gene implicated in osteogenesis imperfecta type 21. Orthologous to human KDELR2 (KDEL endoplasmic reticulum protein retention receptor 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1110007A14Rik; ER lumen protein retaining receptor 2; ER lumen protein-retaining receptor 2; KDEL endoplasmic reticulum protein retention receptor 2; KDEL receptor 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KDELR2 (KDEL endoplasmic reticulum protein retention receptor 2)
HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Kdelr2 (KDEL endoplasmic reticulum protein retention receptor 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kdelr2 (KDEL endoplasmic reticulum protein retention receptor 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KDELR2 (KDEL endoplasmic reticulum protein retention receptor 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KDELR2 (KDEL endoplasmic reticulum protein retention receptor 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kdelr2 (KDEL endoplasmic reticulum protein retention receptor 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KDELR2 (KDEL endoplasmic reticulum protein retention receptor 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KDELR2 (KDEL endoplasmic reticulum protein retention receptor 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kdelr2 (KDEL endoplasmic reticulum protein retention receptor 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KDELR1 (KDEL endoplasmic reticulum protein retention receptor 1)
HGNC
OrthoDB
Homo sapiens (human):
KDELR3 (KDEL endoplasmic reticulum protein retention receptor 3)
HGNC
OrthoDB
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Kdelr2 (KDEL endoplasmic reticulum protein retention receptor 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
KDELR2 (KDEL endoplasmic reticulum protein retention receptor 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kdelr2a (KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
kdelr2b (KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
ERD2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
C28H8.4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
KdelR
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
erd-2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kdelr1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 143,389,575 - 143,407,659 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 143,389,593 - 143,407,656 (+) Ensembl GRCm39 Ensembl GRCm38 5 143,403,820 - 143,421,904 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 143,403,838 - 143,421,901 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 144,165,499 - 144,182,955 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 144,165,505 - 144,182,947 (+) NCBI MGSCv36 mm8 Celera 5 140,450,973 - 140,468,362 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 82.12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kdelr2 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of KDELR2 mRNA CTD PMID:22206623 Kdelr2 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KDELR2 mRNA CTD PMID:17942748 Kdelr2 Mouse 17alpha-ethynylestradiol affects expression ISO RGD:1304618 6480464 Ethinyl Estradiol affects the expression of KDELR2 mRNA CTD PMID:26865667 Kdelr2 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of KDELR2 mRNA CTD PMID:17555576|PMID:17942748 Kdelr2 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of KDELR2 mRNA CTD PMID:39298647 Kdelr2 Mouse 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:1312161 6480464 Dihydrotestosterone results in increased expression of KDELR2 mRNA CTD PMID:29581250 Kdelr2 Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:1312161 6480464 2,2',4,4'-tetrabromodiphenyl ether analog results in increased expression of KDELR2 mRNA CTD PMID:19095052 Kdelr2 Mouse 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions EXP 6480464 [Flame Retardants results in increased abundance of 2,2',4,4'-tetrabromodiphenyl ether] which results in decreased expression of more ... CTD PMID:38995820 Kdelr2 Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of KDELR2 mRNA CTD PMID:30294300 Kdelr2 Mouse 2,3',4,4',5-Pentachlorobiphenyl decreases expression EXP 6480464 2,3',4,4',5-pentachlorobiphenyl results in decreased expression of KDELR2 mRNA CTD PMID:31388691 Kdelr2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KDELR2 mRNA CTD PMID:17942748 Kdelr2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of KDELR2 mRNA CTD PMID:21570461 Kdelr2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KDELR2 mRNA CTD PMID:17942748 Kdelr2 Mouse 2-methylcholine affects expression ISO RGD:1312161 6480464 beta-methylcholine affects the expression of KDELR2 mRNA CTD PMID:21179406 Kdelr2 Mouse 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression ISO RGD:1304618 6480464 Omeprazole affects the expression of KDELR2 mRNA CTD PMID:19483382 Kdelr2 Mouse 6-propyl-2-thiouracil affects expression ISO RGD:1304618 6480464 Propylthiouracil affects the expression of KDELR2 mRNA CTD PMID:19483382 Kdelr2 Mouse amiodarone affects expression ISO RGD:1304618 6480464 Amiodarone affects the expression of KDELR2 mRNA CTD PMID:19483382 Kdelr2 Mouse amitrole decreases expression ISO RGD:1304618 6480464 Amitrole results in decreased expression of KDELR2 mRNA CTD PMID:38685447 Kdelr2 Mouse atrazine increases expression ISO RGD:1312161 6480464 Atrazine results in increased expression of KDELR2 mRNA CTD PMID:22378314 Kdelr2 Mouse benzbromarone affects expression ISO RGD:1304618 6480464 Benzbromarone affects the expression of KDELR2 mRNA CTD PMID:19483382 Kdelr2 Mouse benzo[a]pyrene decreases expression ISO RGD:1312161 6480464 Benzo(a)pyrene results in decreased expression of KDELR2 mRNA CTD PMID:26238291 Kdelr2 Mouse benzo[a]pyrene decreases methylation ISO RGD:1312161 6480464 Benzo(a)pyrene results in decreased methylation of KDELR2 promoter CTD PMID:27901495 Kdelr2 Mouse beta-hexachlorocyclohexane increases expression EXP 6480464 beta-hexachlorocyclohexane results in increased expression of KDELR2 mRNA CTD PMID:25270620 Kdelr2 Mouse bis(2-ethylhexyl) phthalate increases expression ISO RGD:1312161 6480464 Diethylhexyl Phthalate results in increased expression of KDELR2 mRNA CTD PMID:31163220 Kdelr2 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of KDELR2 mRNA CTD PMID:33754040 Kdelr2 Mouse bis(2-ethylhexyl) phthalate increases methylation EXP 6480464 Diethylhexyl Phthalate results in increased methylation of KDELR2 gene CTD PMID:32864567 Kdelr2 Mouse bisphenol A affects expression ISO RGD:1312161 6480464 bisphenol A affects the expression of KDELR2 mRNA CTD PMID:30903817 Kdelr2 Mouse bisphenol A decreases expression ISO RGD:1304618 6480464 bisphenol A results in decreased expression of KDELR2 mRNA CTD PMID:30816183|PMID:34947998 Kdelr2 Mouse cadmium sulfate increases expression EXP 6480464 cadmium sulfate results in increased expression of KDELR2 mRNA CTD PMID:16221973 Kdelr2 Mouse carbamazepine affects expression ISO RGD:1312161 6480464 Carbamazepine affects the expression of KDELR2 mRNA CTD PMID:25979313 Kdelr2 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes, Carbon analog results in increased expression of KDELR2 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681|PMID:25620056 Kdelr2 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of KDELR2 mRNA CTD PMID:37019170 Kdelr2 Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of KDELR2 mRNA CTD PMID:27462272 Kdelr2 Mouse clofibrate affects expression ISO RGD:1304618 6480464 Clofibrate affects the expression of KDELR2 mRNA CTD PMID:19483382 Kdelr2 Mouse copper(II) sulfate decreases expression ISO RGD:1312161 6480464 Copper Sulfate results in decreased expression of KDELR2 mRNA CTD PMID:19549813 Kdelr2 Mouse crocidolite asbestos increases expression ISO RGD:1312161 6480464 Asbestos, Crocidolite results in increased expression of KDELR2 mRNA CTD PMID:18687144 Kdelr2 Mouse cyclosporin A increases expression ISO RGD:1312161 6480464 Cyclosporine results in increased expression of KDELR2 mRNA CTD PMID:20106945|PMID:27989131 Kdelr2 Mouse cyclosporin A decreases expression ISO RGD:1312161 6480464 Cyclosporine results in decreased expression of KDELR2 mRNA CTD PMID:25562108 Kdelr2 Mouse Dibutyl phosphate affects expression ISO RGD:1312161 6480464 di-n-butylphosphoric acid affects the expression of KDELR2 mRNA CTD PMID:37042841 Kdelr2 Mouse diuron decreases expression ISO RGD:1312161 6480464 Diuron results in decreased expression of KDELR2 mRNA CTD PMID:35967413 Kdelr2 Mouse dorsomorphin multiple interactions ISO RGD:1312161 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Kdelr2 Mouse endosulfan affects expression ISO RGD:1304618 6480464 Endosulfan affects the expression of KDELR2 mRNA CTD PMID:29391264 Kdelr2 Mouse flutamide increases expression ISO RGD:1304618 6480464 Flutamide results in increased expression of KDELR2 mRNA CTD PMID:24136188 Kdelr2 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of KDELR2 mRNA CTD PMID:25629700 Kdelr2 Mouse formaldehyde decreases expression ISO RGD:1312161 6480464 Formaldehyde results in decreased expression of KDELR2 mRNA CTD PMID:23649840 Kdelr2 Mouse genistein increases expression ISO RGD:1312161 6480464 Genistein results in increased expression of KDELR2 mRNA CTD PMID:26865667 Kdelr2 Mouse gentamycin increases expression ISO RGD:1304618 6480464 Gentamicins results in increased expression of KDELR2 mRNA CTD PMID:22061828 Kdelr2 Mouse gentamycin decreases expression ISO RGD:1304618 6480464 Gentamicins results in decreased expression of KDELR2 mRNA CTD PMID:33387578 Kdelr2 Mouse glafenine increases expression ISO RGD:1304618 6480464 Glafenine results in increased expression of KDELR2 mRNA CTD PMID:24136188 Kdelr2 Mouse ivermectin decreases expression ISO RGD:1312161 6480464 Ivermectin results in decreased expression of KDELR2 protein CTD PMID:32959892 Kdelr2 Mouse L-ethionine affects expression ISO RGD:1304618 6480464 Ethionine affects the expression of KDELR2 mRNA CTD PMID:19483382 Kdelr2 Mouse mercury atom decreases expression EXP 6480464 Mercury analog results in decreased expression of KDELR2 mRNA CTD PMID:25056781 Kdelr2 Mouse mercury(0) decreases expression EXP 6480464 Mercury analog results in decreased expression of KDELR2 mRNA CTD PMID:25056781 Kdelr2 Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of KDELR2 mRNA CTD PMID:34813904 Kdelr2 Mouse methyl methanesulfonate decreases expression ISO RGD:1312161 6480464 Methyl Methanesulfonate results in decreased expression of KDELR2 mRNA CTD PMID:23649840 Kdelr2 Mouse methylmercury chloride increases expression ISO RGD:1312161 6480464 methylmercuric chloride results in increased expression of KDELR2 mRNA CTD PMID:28001369 Kdelr2 Mouse methylseleninic acid decreases expression ISO RGD:1312161 6480464 methylselenic acid results in decreased expression of KDELR2 mRNA CTD PMID:18548127 Kdelr2 Mouse mifepristone increases expression ISO RGD:1312161 6480464 Mifepristone results in increased expression of KDELR2 mRNA CTD PMID:17584828 Kdelr2 Mouse nickel atom increases expression ISO RGD:1312161 6480464 Nickel results in increased expression of KDELR2 mRNA CTD PMID:24768652|PMID:25583101 Kdelr2 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of KDELR2 more ... CTD PMID:35964746 Kdelr2 Mouse Nivalenol increases expression EXP 6480464 nivalenol results in increased expression of KDELR2 mRNA CTD PMID:35016910 Kdelr2 Mouse omeprazole affects expression ISO RGD:1304618 6480464 Omeprazole affects the expression of KDELR2 mRNA CTD PMID:19483382 Kdelr2 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of KDELR2 mRNA CTD PMID:17562736 Kdelr2 Mouse phenylmercury acetate increases expression ISO RGD:1312161 6480464 Phenylmercuric Acetate results in increased expression of KDELR2 mRNA CTD PMID:26272509 Kdelr2 Mouse phenylmercury acetate multiple interactions ISO RGD:1312161 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Kdelr2 Mouse picoxystrobin increases expression ISO RGD:1312161 6480464 picoxystrobin results in increased expression of KDELR2 mRNA CTD PMID:33512557 Kdelr2 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of KDELR2 mRNA CTD PMID:18445702 Kdelr2 Mouse pirinixic acid affects expression ISO RGD:1304618 6480464 pirinixic acid affects the expression of KDELR2 mRNA CTD PMID:19483382 Kdelr2 Mouse piroxicam decreases expression ISO RGD:1312161 6480464 Piroxicam results in decreased expression of KDELR2 mRNA CTD PMID:21858171 Kdelr2 Mouse propiconazole increases expression EXP 6480464 propiconazole results in increased expression of KDELR2 mRNA CTD PMID:21278054 Kdelr2 Mouse pyrimidifen increases expression ISO RGD:1312161 6480464 pyrimidifen results in increased expression of KDELR2 mRNA CTD PMID:33512557 Kdelr2 Mouse rotenone decreases expression ISO RGD:1304618 6480464 Rotenone results in decreased expression of KDELR2 mRNA CTD PMID:19013527 Kdelr2 Mouse Salinomycin decreases expression ISO RGD:1312161 6480464 salinomycin results in decreased expression of KDELR2 mRNA CTD PMID:19682730 Kdelr2 Mouse SB 431542 multiple interactions ISO RGD:1312161 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Kdelr2 Mouse sodium arsenite increases expression ISO RGD:1312161 6480464 sodium arsenite results in increased expression of KDELR2 mRNA CTD PMID:38568856 Kdelr2 Mouse T-2 toxin decreases expression ISO RGD:1312161 6480464 T-2 Toxin results in decreased expression of KDELR2 mRNA CTD PMID:31863870 Kdelr2 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of KDELR2 mRNA CTD PMID:17555576 Kdelr2 Mouse temozolomide increases expression ISO RGD:1312161 6480464 Temozolomide results in increased expression of KDELR2 mRNA CTD PMID:31758290 Kdelr2 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of KDELR2 mRNA CTD PMID:27339419|PMID:31919559 Kdelr2 Mouse thapsigargin increases expression ISO RGD:1312161 6480464 Thapsigargin results in increased expression of KDELR2 mRNA CTD PMID:22378314 Kdelr2 Mouse thifluzamide increases expression ISO RGD:1312161 6480464 thifluzamide results in increased expression of KDELR2 mRNA CTD PMID:33512557 Kdelr2 Mouse thioacetamide affects expression ISO RGD:1304618 6480464 Thioacetamide affects the expression of KDELR2 mRNA CTD PMID:19483382 Kdelr2 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of KDELR2 promoter CTD PMID:35295148 Kdelr2 Mouse trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of KDELR2 mRNA CTD PMID:19448997 Kdelr2 Mouse trichostatin A increases expression ISO RGD:1312161 6480464 trichostatin A results in increased expression of KDELR2 mRNA CTD PMID:24935251|PMID:26272509 Kdelr2 Mouse trichostatin A multiple interactions ISO RGD:1312161 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Kdelr2 Mouse tunicamycin increases expression ISO RGD:1312161 6480464 Tunicamycin results in increased expression of KDELR2 mRNA CTD PMID:22378314 Kdelr2 Mouse valproic acid increases expression ISO RGD:1312161 6480464 Valproic Acid results in increased expression of KDELR2 mRNA CTD PMID:19101580|PMID:23179753|PMID:23527032|PMID:26272509 Kdelr2 Mouse valproic acid affects splicing ISO RGD:1304618 6480464 Valproic Acid affects the splicing of KDELR2 mRNA CTD PMID:29427782 Kdelr2 Mouse valproic acid multiple interactions ISO RGD:1312161 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Kdelr2 Mouse vinclozolin decreases expression ISO RGD:1304618 6480464 vinclozolin results in decreased expression of KDELR2 mRNA CTD PMID:23034163
1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-methylcholine (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO) 6-propyl-2-thiouracil (ISO) amiodarone (ISO) amitrole (ISO) atrazine (ISO) benzbromarone (ISO) benzo[a]pyrene (ISO) beta-hexachlorocyclohexane (EXP) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (ISO) cadmium sulfate (EXP) carbamazepine (ISO) carbon nanotube (EXP) chlorpyrifos (EXP) clobetasol (EXP) clofibrate (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) diuron (ISO) dorsomorphin (ISO) endosulfan (ISO) flutamide (ISO) folic acid (EXP) formaldehyde (ISO) genistein (ISO) gentamycin (ISO) glafenine (ISO) ivermectin (ISO) L-ethionine (ISO) mercury atom (EXP) mercury(0) (EXP) methidathion (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylseleninic acid (ISO) mifepristone (ISO) nickel atom (ISO) nitrates (EXP) Nivalenol (EXP) omeprazole (ISO) paracetamol (EXP) phenylmercury acetate (ISO) picoxystrobin (ISO) pirinixic acid (EXP,ISO) piroxicam (ISO) propiconazole (EXP) pyrimidifen (ISO) rotenone (ISO) Salinomycin (ISO) SB 431542 (ISO) sodium arsenite (ISO) T-2 toxin (ISO) tamoxifen (EXP) temozolomide (ISO) tetrachloromethane (EXP) thapsigargin (ISO) thifluzamide (ISO) thioacetamide (ISO) titanium dioxide (EXP) trichloroethene (EXP) trichostatin A (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (ISO)
Kdelr2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 143,389,575 - 143,407,659 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 143,389,593 - 143,407,656 (+) Ensembl GRCm39 Ensembl GRCm38 5 143,403,820 - 143,421,904 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 143,403,838 - 143,421,901 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 144,165,499 - 144,182,955 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 144,165,505 - 144,182,947 (+) NCBI MGSCv36 mm8 Celera 5 140,450,973 - 140,468,362 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 82.12 NCBI
KDELR2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 6,461,089 - 6,484,152 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 6,445,953 - 6,484,190 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 6,500,720 - 6,523,783 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 6,467,237 - 6,490,374 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 6,275,509 - 6,296,940 NCBI Celera 7 6,211,338 - 6,234,431 (+) NCBI Celera Cytogenetic Map 7 p22.1 NCBI HuRef 7 6,373,518 - 6,395,670 (-) NCBI HuRef CHM1_1 7 6,500,302 - 6,523,431 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 6,580,398 - 6,603,413 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 6,547,172 - 6,570,287 (-) NCBI
Kdelr2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 16,252,424 - 16,270,737 (-) NCBI GRCr8 mRatBN7.2 12 11,138,820 - 11,157,117 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 11,138,820 - 11,157,153 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 11,946,125 - 11,964,325 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 12,569,412 - 12,587,613 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 11,595,547 - 11,613,739 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 13,192,452 - 13,210,758 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 13,192,453 - 13,210,758 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 15,232,465 - 15,250,771 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 11,498,420 - 11,513,595 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 11,524,186 - 11,543,482 (-) NCBI Celera 12 12,932,160 - 12,950,458 (-) NCBI Celera Cytogenetic Map 12 p11 NCBI
Kdelr2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955460 13,202,401 - 13,221,319 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955460 13,202,400 - 13,221,319 (+) NCBI ChiLan1.0 ChiLan1.0
KDELR2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 11,188,025 - 11,211,263 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 59,512,862 - 59,535,981 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 6,960,456 - 6,983,515 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 6,654,430 - 6,667,794 (-) NCBI panpan1.1 PanPan1.1 panPan2
KDELR2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 11,796,586 - 11,815,765 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 11,798,377 - 11,815,760 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 13,421,923 - 13,441,095 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 11,798,777 - 11,817,951 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 11,799,791 - 11,817,956 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 11,674,580 - 11,693,744 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 11,654,175 - 11,673,193 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 11,880,887 - 11,900,112 (-) NCBI UU_Cfam_GSD_1.0
Kdelr2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
KDELR2 (Sus scrofa - pig)
KDELR2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 15,671,314 - 15,694,192 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 15,672,442 - 15,694,148 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666102 377,263 - 401,933 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kdelr2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 287 Count of miRNA genes: 245 Interacting mature miRNAs: 262 Transcripts: ENSMUST00000110731 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1301363 Pbwg13_m postnatal body weight growth 13 (mouse) Not determined 5 125133457 151758149 Mouse 1301362 Prnr1_m prion resistance 1 (mouse) Not determined 5 89418876 146787935 Mouse 1300913 Bwefm_m body weight females and males day 10 (mouse) Not determined 5 109439348 143439459 Mouse 4141081 Nidd7k_m Nidd7 on KK-A (mouse) Not determined 119945037 149347326 Mouse 11528552 Scram1_m spinal cord resistance to astrocytoma modifier 1 (mouse) 5 121455402 151758149 Mouse 1300827 Cora1_m correlation in cytokine production 1 (mouse) Not determined 5 115156883 149157015 Mouse 1302079 Lbw3_m lupus NZB x NZW 3 (mouse) Not determined 5 124700335 151758149 Mouse 13504737 Ifvrq5_m influenza virus resistance QTL 5 (mouse) 5 139509801 151658149 Mouse 13504734 Ifvrq4_m influenza virus resistance QTL 4 (mouse) 5 139985755 151658149 Mouse 1301986 Bpq4_m blood pressure QTL 4 (mouse) Not determined 5 121555236 151758149 Mouse 13504735 Ifvrq7_m influenza virus resistance QTL 7 (mouse) 5 139509801 151658149 Mouse 1301857 Bglq14_m body growth late QTL 14 (mouse) Not determined 5 118948964 151758149 Mouse 12880406 Jcdq2_m joint cartilage degeneration QTL 2 (mouse) 5 129787831 151758149 Mouse 1301226 Bbaa2_m B.burgdorferi-associated arthritis 2 (mouse) Not determined 5 115156883 149157015 Mouse 4141218 Ath24_m atherosclerosis 24 (mouse) Not determined 129520084 151758149 Mouse 11049557 Lmr26_m leishmaniasis resistance 26 (mouse) 5 133925558 151758149 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000110731 ⟹ ENSMUSP00000106359
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 143,389,593 - 143,407,656 (+) Ensembl GRCm38.p6 Ensembl 5 143,403,838 - 143,421,901 (+) Ensembl
RefSeq Acc Id:
NM_025841 ⟹ NP_080117
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 143,389,575 - 143,407,659 (+) NCBI GRCm38 5 143,403,820 - 143,421,904 (+) ENTREZGENE MGSCv37 5 144,165,499 - 144,182,955 (+) RGD Celera 5 140,450,973 - 140,468,362 (+) RGD cM Map 5 ENTREZGENE
Sequence:
GACGGCAGTTCGGCCACGTCCCTGGCCACGTCGCGCCCGCTCCCGCCATCTTTCGCCGCTTCCTCTCTCCGGGGCTGCTGTCGCCGCGTCCCGAGTCGCTGCCTAGCTCCGGTGCCGCTGTGCCGCGC CGACCGCCGCCGCCATGAACATCTTCCGGCTGACTGGGGACCTGTCCCACCTGGCGGCCATCGTCATCCTACTGCTGAAGATCTGGAAGACGCGCTCCTGTGCTGGGATCTCTGGGAAGAGTCAGCTC CTGTTCGCACTGGTCTTCACGACTCGCTACCTGGACCTTTTCACTTCCTTCATTTCCTTATACAACACGTCTATGAAGCTTATCTACATTGCCTGCTCCTATGCCACGGTGTACCTGATCTACATGAA ATTTAAGGCCACCTATGATGGAAATCACGATACCTTCCGAGTGGAGTTCCTGGTGGTTCCTGTAGGAGGCCTCTCATTTCTAGTCAATCATGACTTCTCTCCTCTTGAGATCTTATGGACCTTCTCCA TCTACCTGGAGTCCGTGGCCATCCTTCCACAGCTCTTTATGATCAGCAAGACTGGCGAGGCTGAGACCATCACCACCCACTACCTCTTCTTCCTGGGCCTCTACCGCGCTCTGTACCTGGTCAACTGG ATCTGGCGCTTCTACTTCGAGGGCTTCTTTGATCTCATTGCTGTGGTGGCTGGTGTCGTCCAGACCATTCTCTACTGCGACTTCTTCTACTTGTACATTACAAAAGTACTCAAAGGGAAGAAGCTCAG CCTGCCAGCCTAAGTGCCAAAGACCAGCAGCAGCCTCTGCCCTTCGGGGTGCTCGGACAGGGTCTCACCATGGCGAAGGCGAAGGCGAAGGCTCGGGATGCTCAGTGGGCAGAAGCAGAGGCTTCTGC GGCAGCCACTCACTGGTGGCTCTTCGAGGATGCAGAGGAAGAGACCAGGAGGCTTCTGTCTACTGCATCCTGCCTTATCTTTTTTATTACTATGTACAAAGATTTTTTTACACAAAGAAACTTAATGC TGTGTTAATAAATTCAGTATGTAGATGAATTGGGACAGTTTCCAAAAGTGACGATTTTGTGCACAATAAGTACAAGCCTTTTTTATTTTTTGAGAATTTGTTGAGGTGGTCAATTCTTTGTGTCTACA ATGAAATTATACTCCTTGACACTTGGTAGATTATCCAAACATCTGTCAAATTTCCATGCTATTTATTTTCTTTCTTTTCTTTCTTTCTTTTTTTTTTTTTTTTTTTTTTTTGCCAAAAAGATAAGTTG TGTTTGTTTGAAATCTGAGACATTGTGTTCCATTGGTGTTTCTGTCCAAAAGAGTCCTCGTTGTCCTGGAAACCCTTCCTCAGATGTCACACTACATGTCAGGTTCGGGAGGATGACTAGAAAGTCCT AAGGTTTCATTACCAAAACTTGAAGGTTCCCAGCAGAAACTCAGCTGATGCTCACCAAACGCTCACCCTTCCCCCGCTGAGGTGTGGCAGCTTGAGGTTATCCGAGGGTGCTGAGAGCTGCCACACCC AGAGGGTCTGAGCCACCTGCCCTCTGACTATGGAGAGGGCTGGGGGTGATGGCTGTTTTGGATAGAGGACTCAGCTCCTCTGAGGAATGGAACACAAATAGCCACCTGTCACTGTCAGTCCGAAGGAT CACTACAACCATGTTAGACTCAAATGTTTTTCTCATAGCACTTTTGGTGATAAAATGATTGACAATCTTTTTAATTGGCAACACCAGTTATCATTCCTTACATTCTTTTTAGTATTTTTTTTAAACTG GGCTCTTGCATGACCTATATTGTGTTAACATCCTAAATAAACATTTTATTAAACAGAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_080117 ⟸ NM_025841
- UniProtKB:
Q4FK20 (UniProtKB/Swiss-Prot), Q9CQM2 (UniProtKB/Swiss-Prot)
- Sequence:
MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLES VAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA
hide sequence
Ensembl Acc Id:
ENSMUSP00000106359 ⟸ ENSMUST00000110731
RGD ID: 6888678
Promoter ID: EPDNEW_M7790
Type: initiation region
Name: Kdelr2_1
Description: Mus musculus KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum proteinretention receptor 2 , mRNA.
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 143,403,826 - 143,403,886 EPDNEW
RGD ID: 6837027
Promoter ID: MM_KWN:44750
Type: CpG-Island
SO ACC ID: SO:0000170
Source: MPROMDB
Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen
Transcripts: NM_025841, UC009AKG.1
Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 144,165,276 - 144,166,152 (-) MPROMDB