Advanced Search (OLGA)

Gene: Pigc (phosphatidylinositol glycan anchor biosynthesis, class C) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Pigc

Name:

phosphatidylinositol glycan anchor biosynthesis, class C

RGD ID:

1311337

Description:

Predicted to be involved in GPI anchor biosynthetic process. Predicted to be located in endoplasmic reticulum membrane. Predicted to be part of glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex. Human ortholog(s) of this gene implicated in glycosylphosphatidylinositol biosynthesis defect 16. Orthologous to human PIGC (phosphatidylinositol glycan anchor biosynthesis class C); PARTICIPATES IN glycosylphosphatidylinositol anchor biosynthetic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC364032; phosphatidylinositol glycan, class C; phosphatidylinositol N-acetylglucosaminyltransferase subunit C; phosphatidylinositol-glycan biosynthesis class C protein; PIG-C

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	76,876,894 - 76,879,420 (+)	NCBI		GRCr8
mRatBN7.2	13	74,343,619 - 74,346,148 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	74,296,854 - 74,346,211 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	76,913,282 - 76,915,637 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	78,220,480 - 78,222,835 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	75,480,339 - 75,482,694 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	79,886,832 - 79,889,305 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	79,886,832 - 79,889,304 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	84,780,555 - 84,783,014 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	77,664,442 - 77,666,797 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	77,678,629 - 77,680,984 (+)	NCBI
Celera	13	74,096,747 - 74,099,102 (+)	NCBI		Celera
Cytogenetic Map	13	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigc	Rat	1q24 Deletion Syndrome		ISO	PIGC (Homo sapiens)	8554872	ClinVar Annotator: match by term: 1q24q25 microdeletion syndrome	ClinVar	PMID:25741868
Pigc	Rat	autoimmune lymphoproliferative syndrome		ISO	PIGC (Homo sapiens)	8554872	ClinVar Annotator: match by term: AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME more ...	ClinVar	PMID:22857792 more ...
Pigc	Rat	Developmental Disabilities		ISO	PIGC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Global developmental delay	ClinVar	PMID:25741868 and PMID:25741900
Pigc	Rat	gastrointestinal stromal tumor		ISO	PIGC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Pigc	Rat	glycosylphosphatidylinositol biosynthesis defect 16		ISO	PIGC (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:25741868 more ...
Pigc	Rat	Hydrops Fetalis		ISO	PIGC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Non-immune hydrops fetalis	ClinVar	PMID:25741868 and PMID:26036949
Pigc	Rat	parathyroid carcinoma		ISO	PIGC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigc	Rat	glycosylphosphatidylinositol biosynthesis defect 16		ISO	PIGC (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigc	Rat	(S)-nicotine	multiple interactions	ISO	Pigc (Mus musculus)	6480464	[Nicotine co-treated with 1-Methyl-4-phenyl-1 more ...	CTD	PMID:20230807
Pigc	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Pigc (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of PIGC mRNA	CTD	PMID:22206623
Pigc	Rat	1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	increases expression	ISO	Pigc (Mus musculus)	6480464	1-Methyl-4-phenyl-1 more ...	CTD	PMID:20230807
Pigc	Rat	1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	multiple interactions	ISO	Pigc (Mus musculus)	6480464	[Caffeine co-treated with 1-Methyl-4-phenyl-1 more ...	CTD	PMID:20230807
Pigc	Rat	17alpha-ethynylestradiol	affects expression	ISO	Pigc (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of PIGC mRNA	CTD	PMID:17555576
Pigc	Rat	17beta-estradiol	decreases expression	ISO	PIGC (Homo sapiens)	6480464	Estradiol results in decreased expression of PIGC mRNA	CTD	PMID:23019147
Pigc	Rat	17beta-estradiol	decreases expression	ISO	Pigc (Mus musculus)	6480464	Estradiol results in decreased expression of PIGC mRNA	CTD	PMID:39298647
Pigc	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	PIGC (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in decreased expression of PIGC mRNA	CTD	PMID:11007951
Pigc	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Pigc (Mus musculus)	6480464	[TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of PIGC mRNA	CTD	PMID:25975270
Pigc	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of PIGC mRNA	CTD	PMID:21215274 and PMID:33387578
Pigc	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of PIGC mRNA	CTD	PMID:21346803
Pigc	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Pigc (Mus musculus)	6480464	bisphenol S results in decreased expression of PIGC mRNA	CTD	PMID:39298647
Pigc	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Pigc (Mus musculus)	6480464	bisphenol S affects the methylation of PIGC gene	CTD	PMID:31683443
Pigc	Rat	acrolein	multiple interactions	ISO	PIGC (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PIGC mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PIGC mRNA	CTD	PMID:32699268
Pigc	Rat	alpha-pinene	multiple interactions	ISO	PIGC (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PIGC mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PIGC mRNA	CTD	PMID:32699268
Pigc	Rat	antirheumatic drug	increases expression	ISO	PIGC (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of PIGC mRNA	CTD	PMID:24449571
Pigc	Rat	arsane	multiple interactions	ISO	PIGC (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PIGC mRNA	CTD	PMID:39836092
Pigc	Rat	arsenic atom	multiple interactions	ISO	PIGC (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PIGC mRNA	CTD	PMID:39836092
Pigc	Rat	atrazine	decreases expression	ISO	PIGC (Homo sapiens)	6480464	Atrazine results in decreased expression of PIGC mRNA	CTD	PMID:22378314
Pigc	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PIGC mRNA	CTD	PMID:25181051 more ...
Pigc	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PIGC mRNA	CTD	PMID:34947998
Pigc	Rat	cadmium atom	increases expression	ISO	PIGC (Homo sapiens)	6480464	Cadmium results in increased expression of PIGC mRNA	CTD	PMID:24376830
Pigc	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of PIGC promoter	CTD	PMID:22457795
Pigc	Rat	cadmium dichloride	decreases expression	ISO	PIGC (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of PIGC mRNA	CTD	PMID:38568856
Pigc	Rat	caffeine	multiple interactions	ISO	Pigc (Mus musculus)	6480464	[Caffeine co-treated with 1-Methyl-4-phenyl-1 more ...	CTD	PMID:20230807
Pigc	Rat	carbon nanotube	decreases expression	ISO	Pigc (Mus musculus)	6480464	Nanotubes and Carbon analog results in decreased expression of PIGC mRNA	CTD	PMID:25554681
Pigc	Rat	CGP 52608	multiple interactions	ISO	PIGC (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to PIGC gene]	CTD	PMID:28238834
Pigc	Rat	chlordecone	increases expression	ISO	Pigc (Mus musculus)	6480464	Chlordecone results in increased expression of PIGC mRNA	CTD	PMID:33711761
Pigc	Rat	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of PIGC mRNA	CTD	PMID:18668222
Pigc	Rat	chlorpyrifos	increases expression	ISO	Pigc (Mus musculus)	6480464	Chlorpyrifos results in increased expression of PIGC mRNA	CTD	PMID:37019170
Pigc	Rat	cobalt dichloride	decreases expression	ISO	PIGC (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of PIGC mRNA	CTD	PMID:19376846
Pigc	Rat	copper(II) sulfate	decreases expression	ISO	PIGC (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of PIGC mRNA	CTD	PMID:19549813
Pigc	Rat	cyclosporin A	increases expression	ISO	PIGC (Homo sapiens)	6480464	Cyclosporine results in increased expression of PIGC mRNA	CTD	PMID:25562108
Pigc	Rat	cylindrospermopsin	increases expression	ISO	PIGC (Homo sapiens)	6480464	cylindrospermopsin results in increased expression of PIGC mRNA	CTD	PMID:24921660
Pigc	Rat	dicrotophos	decreases expression	ISO	PIGC (Homo sapiens)	6480464	dicrotophos results in decreased expression of PIGC mRNA	CTD	PMID:28302478
Pigc	Rat	doxorubicin	decreases expression	ISO	PIGC (Homo sapiens)	6480464	Doxorubicin results in decreased expression of PIGC mRNA	CTD	PMID:29803840
Pigc	Rat	epoxiconazole	decreases expression	ISO	Pigc (Mus musculus)	6480464	epoxiconazole results in decreased expression of PIGC mRNA	CTD	PMID:35436446
Pigc	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of PIGC mRNA	CTD	PMID:24136188
Pigc	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of PIGC mRNA	CTD	PMID:24136188
Pigc	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of PIGC mRNA	CTD	PMID:33387578
Pigc	Rat	hydrogen peroxide	multiple interactions	ISO	PIGC (Homo sapiens)	6480464	[Hydrogen Peroxide co-treated with Theophylline] results in increased expression of PIGC protein	CTD	PMID:18951874
Pigc	Rat	maneb	multiple interactions	ISO	Pigc (Mus musculus)	6480464	[Paraquat co-treated with Maneb] results in increased expression of PIGC mRNA	CTD	PMID:18386188
Pigc	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of PIGC mRNA	CTD	PMID:24136188
Pigc	Rat	nicotine	multiple interactions	ISO	Pigc (Mus musculus)	6480464	[Nicotine co-treated with 1-Methyl-4-phenyl-1 more ...	CTD	PMID:20230807
Pigc	Rat	ozone	multiple interactions	ISO	PIGC (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PIGC mRNA more ...	CTD	PMID:32699268
Pigc	Rat	paracetamol	decreases expression	ISO	PIGC (Homo sapiens)	6480464	Acetaminophen results in decreased expression of PIGC mRNA	CTD	PMID:21420995
Pigc	Rat	paraquat	multiple interactions	ISO	Pigc (Mus musculus)	6480464	[Paraquat co-treated with Maneb] results in increased expression of PIGC mRNA	CTD	PMID:18386188
Pigc	Rat	potassium chromate	decreases expression	ISO	PIGC (Homo sapiens)	6480464	potassium chromate(VI) results in decreased expression of PIGC mRNA	CTD	PMID:22714537
Pigc	Rat	silicon dioxide	decreases expression	ISO	PIGC (Homo sapiens)	6480464	Silicon Dioxide results in decreased expression of PIGC mRNA	CTD	PMID:25351596
Pigc	Rat	simvastatin	decreases expression	ISO	Pigc (Mus musculus)	6480464	Simvastatin results in decreased expression of PIGC mRNA	CTD	PMID:19262002
Pigc	Rat	sodium arsenite	decreases expression	ISO	PIGC (Homo sapiens)	6480464	sodium arsenite results in decreased expression of PIGC mRNA	CTD	PMID:38568856
Pigc	Rat	sodium arsenite	multiple interactions	ISO	PIGC (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PIGC mRNA	CTD	PMID:39836092
Pigc	Rat	sulindac	increases expression	EXP		6480464	Sulindac results in increased expression of PIGC mRNA	CTD	PMID:24136188
Pigc	Rat	tamoxifen	affects expression	ISO	Pigc (Mus musculus)	6480464	Tamoxifen affects the expression of PIGC mRNA	CTD	PMID:17555576
Pigc	Rat	testosterone	decreases expression	ISO	PIGC (Homo sapiens)	6480464	Testosterone results in decreased expression of PIGC mRNA	CTD	PMID:33359661
Pigc	Rat	theophylline	multiple interactions	ISO	PIGC (Homo sapiens)	6480464	[Hydrogen Peroxide co-treated with Theophylline] results in increased expression of PIGC protein	CTD	PMID:18951874
Pigc	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of PIGC mRNA	CTD	PMID:34492290
Pigc	Rat	titanium dioxide	decreases methylation	ISO	Pigc (Mus musculus)	6480464	titanium dioxide results in decreased methylation of PIGC gene	CTD	PMID:35295148
Pigc	Rat	urethane	decreases expression	ISO	PIGC (Homo sapiens)	6480464	Urethane results in decreased expression of PIGC mRNA	CTD	PMID:28818685
Pigc	Rat	valproic acid	decreases methylation	ISO	PIGC (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of PIGC gene	CTD	PMID:29154799
Pigc	Rat	valproic acid	decreases expression	ISO	PIGC (Homo sapiens)	6480464	Valproic Acid results in decreased expression of PIGC mRNA	CTD	PMID:23179753
Pigc	Rat	valproic acid	affects expression	ISO	PIGC (Homo sapiens)	6480464	Valproic Acid affects the expression of PIGC mRNA	CTD	PMID:25979313
Pigc	Rat	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of PIGC mRNA	CTD	PMID:35594946

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigc	Rat	GPI anchor biosynthetic process	involved_in	ISS	UniProtKB:Q92535	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Pigc	Rat	GPI anchor biosynthetic process	involved_in	IEA	InterPro:IPR009450	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pigc	Rat	GPI anchor biosynthetic process	involved_in	IEA	UniProtKB:Q92535 and ensembl:ENSP00000356701	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pigc	Rat	GPI anchor biosynthetic process	involved_in	IEA	UniProtKB-KW:KW-0337	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pigc	Rat	GPI anchor biosynthetic process	involved_in	IEA	UniPathway:UPA00196	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Pigc	Rat	GPI anchor biosynthetic process	involved_in	ISO	PIGC (Homo sapiens)	1624291	PMID:16162815 and PMID:27694521	RGD	PMID:16162815 and PMID:27694521

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigc	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pigc	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pigc	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB:Q92535 and ensembl:ENSP00000356701	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pigc	Rat	endoplasmic reticulum membrane	located_in	ISO	PIGC (Homo sapiens)	1624291	PMID:16162815	RGD	PMID:16162815
Pigc	Rat	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex	part_of	ISO	PIGC (Homo sapiens)	1624291	PMID:10944123 and PMID:16162815	RGD	PMID:10944123 and PMID:16162815
Pigc	Rat	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex	part_of	IEA	UniProtKB:Q92535 and ensembl:ENSP00000356701	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pigc	Rat	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex	part_of	IBA	PANTHER:PTN000312400 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pigc	Rat	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex	part_of	ISS	UniProtKB:Q92535	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Pigc	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pigc	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pigc	Rat	membrane	located_in	IEA	InterPro:IPR009450	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigc	Rat	protein binding	enables	ISO	PIGC (Homo sapiens)	1624291	UniProtKB:O94777 more ...	RGD	PMID:10944123 and PMID:9463366

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pigc	Rat	glycosylphosphatidylinositol anchor biosynthetic pathway		IEA		6907045		KEGG	rno:00563

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10944123	PMID:12477932	PMID:15489334	PMID:27694521

Pigc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	76,876,894 - 76,879,420 (+)	NCBI		GRCr8
mRatBN7.2	13	74,343,619 - 74,346,148 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	74,296,854 - 74,346,211 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	76,913,282 - 76,915,637 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	78,220,480 - 78,222,835 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	75,480,339 - 75,482,694 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	79,886,832 - 79,889,305 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	79,886,832 - 79,889,304 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	84,780,555 - 84,783,014 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	77,664,442 - 77,666,797 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	77,678,629 - 77,680,984 (+)	NCBI
Celera	13	74,096,747 - 74,099,102 (+)	NCBI		Celera
Cytogenetic Map	13	q22	NCBI

PIGC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	172,441,457 - 172,444,069 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	172,370,189 - 172,444,086 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	172,410,597 - 172,413,209 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	170,677,220 - 170,679,853 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	169,142,254 - 169,144,887	NCBI
Celera	1	145,520,042 - 145,522,675 (-)	NCBI		Celera
Cytogenetic Map	1	q24.3	NCBI
HuRef	1	143,634,549 - 143,637,182 (-)	NCBI		HuRef
CHM1_1	1	173,832,716 - 173,835,349 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	171,798,151 - 171,800,763 (-)	NCBI		T2T-CHM13v2.0

Pigc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	161,796,757 - 161,801,029 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	161,796,755 - 161,801,004 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	161,969,188 - 161,973,460 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	161,969,186 - 161,973,435 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	163,899,319 - 163,903,566 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	163,805,865 - 163,810,112 (+)	NCBI		MGSCv36	mm8
Celera	1	164,424,173 - 164,428,420 (+)	NCBI		Celera
Cytogenetic Map	1	H2.1	NCBI
cM Map	1	69.95	NCBI

Pigc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	12,891,187 - 12,893,935 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955406	12,891,187 - 12,893,935 (-)	NCBI	ChiLan1.0	ChiLan1.0

PIGC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	77,301,941 - 77,304,688 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	76,982,114 - 76,984,790 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	147,891,867 - 147,942,057 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	151,601,116 - 151,652,039 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	151,649,468 - 151,650,361 (-)	Ensembl	panpan1.1		panPan2

PIGC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	26,548,894 - 26,551,702 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	26,550,524 - 26,551,417 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	26,079,654 - 26,082,476 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	26,299,949 - 26,302,764 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	26,300,015 - 26,302,740 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	26,210,541 - 26,213,364 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	26,281,110 - 26,283,930 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	26,431,378 - 26,434,197 (+)	NCBI		UU_Cfam_GSD_1.0

Pigc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	97,115,826 - 97,118,184 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	14,962,613 - 14,964,861 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	14,962,572 - 14,964,929 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PIGC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	114,824,802 - 114,827,413 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	114,824,795 - 114,827,731 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	126,420,136 - 126,423,071 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PIGC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	56,711,459 - 56,714,109 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	56,712,941 - 56,713,834 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	58,317,307 - 58,320,157 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pigc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624771	9,234,242 - 9,236,987 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624771	9,234,218 - 9,236,991 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Pigc
12 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003242)x3	copy number gain	See cases [RCV000133911]	ChrX:10701..156003242 [GRCh38] ChrX:60701..155232907 [GRCh37] ChrX:701..154886101 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|likely pathogenic\|conflicting data from submitters
GRCh38/hg38 Xp22.33-q28(chrX:3092486-155699618)x2	copy number gain	See cases [RCV000050889]	ChrX:3092486..155699618 [GRCh38] ChrX:3010527..154929279 [GRCh37] ChrX:3020527..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20140-155699618)x3	copy number gain	See cases [RCV000050810]	ChrX:20140..155699618 [GRCh38] ChrX:70140..154929279 [GRCh37] ChrX:10140..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20140-155699618)x1	copy number loss	See cases [RCV000050811]	ChrX:20140..155699618 [GRCh38] ChrX:70140..154929279 [GRCh37] ChrX:10140..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000050385]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000050385]\|See cases [RCV000050385]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x1	copy number loss	Global developmental delay [RCV000050386]\|See cases [RCV000050386]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x3	copy number gain	See cases [RCV000050697]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x1	copy number loss	See cases [RCV000050699]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 Xp11.21-q28(chrX:57372584-155996431)x1	copy number loss	See cases [RCV000051665]	ChrX:57372584..155996431 [GRCh38] ChrX:57399017..155226096 [GRCh37] ChrX:57415742..154879290 [NCBI36] ChrX:Xp11.21-q28	pathogenic
GRCh38/hg38 Xq11.1-28(chrX:63279794-155939524)x1	copy number loss	See cases [RCV000051666]	ChrX:63279794..155939524 [GRCh38] ChrX:62499671..155169188 [GRCh37] ChrX:62416396..154822382 [NCBI36] ChrX:Xq11.1-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2790845-155699618)x3	copy number gain	See cases [RCV000052359]	ChrX:2790845..155699618 [GRCh38] ChrX:2708886..154929279 [GRCh37] ChrX:2718886..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:237659-156022362)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052327]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052327]\|See cases [RCV000052327]	ChrX:237659..156022362 [GRCh38] ChrX:154326..155252027 [GRCh37] ChrX:94326..154905221 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq12-21.1(chrX:67621041-76868590)x2	copy number gain	See cases [RCV000052416]	ChrX:67621041..76868590 [GRCh38] ChrX:66840883..76009501 [GRCh37] ChrX:66757608..76005403 [NCBI36] ChrX:Xq12-21.1	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:27245-155996431)x3	copy number gain	See cases [RCV000052324]	ChrX:27245..155996431 [GRCh38] ChrX:77245..155226096 [GRCh37] ChrX:17245..154879290 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq12-13.3(chrX:68382004-75243150)x2	copy number gain	See cases [RCV000052417]	ChrX:68382004..75243150 [GRCh38] ChrX:67601846..74462985 [GRCh37] ChrX:67518571..74379710 [NCBI36] ChrX:Xq12-13.3	pathogenic
GRCh38/hg38 Xq13.2-27.1(chrX:73008114-140201321)x4	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052418]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052418]\|See cases [RCV000052418]	ChrX:73008114..140201321 [GRCh38] ChrX:72227953..139283477 [GRCh37] ChrX:72144678..139111143 [NCBI36] ChrX:Xq13.2-27.1	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:40704-156022362)x3	copy number gain	See cases [RCV000052325]	ChrX:40704..156022362 [GRCh38] ChrX:90704..155252027 [GRCh37] ChrX:30704..154905221 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26101-155999293)x3	copy number gain	See cases [RCV000052322]	ChrX:26101..155999293 [GRCh38] ChrX:76101..155228958 [GRCh37] ChrX:16101..154882152 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x1	copy number loss	Global developmental delay [RCV000052986]\|Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052987]\|Intellectual functioning disability [RCV000052988]\|Global developmental delay [RCV000052989]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052987]\|See cases [RCV000052986]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q22.1(chrX:675360-100368517)x1	copy number loss	See cases [RCV000053005]	ChrX:675360..100368517 [GRCh38] ChrX:636095..99623515 [GRCh37] ChrX:556095..99510171 [NCBI36] ChrX:Xp22.33-q22.1	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:14245-155999293)x1	copy number loss	Hypoplastic left heart [RCV000052982]\|See cases [RCV000052982]	ChrX:14245..155999293 [GRCh38] ChrX:64245..155228958 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x3	copy number gain	Global developmental delay [RCV000052984]\|Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052985]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052985]\|See cases [RCV000052984]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:Xp22.33-q28	pathogenic
NM_001039840.2(CHIC1):c.665G>A (p.Arg222Gln)	single nucleotide variant	Malignant melanoma [RCV000073249]	ChrX:73680995 [GRCh38] ChrX:72900830 [GRCh37] ChrX:72817555 [NCBI36] ChrX:Xq13.2	not provided
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022826)x4	copy number gain	See cases [RCV000133654]	ChrX:10679..156022826 [GRCh38] ChrX:60679..155252491 [GRCh37] ChrX:679..154905685 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-155978689)x1	copy number loss	See cases [RCV000133792]	ChrX:10701..155978689 [GRCh38] ChrX:60701..155208354 [GRCh37] ChrX:701..154861548 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x3	copy number gain	See cases [RCV000050385]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:679..154896026 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x1	copy number loss	See cases [RCV000050386]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:679..154896026 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x1	copy number loss	See cases [RCV000052986]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:16102..154879290 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x3	copy number gain	See cases [RCV000052984]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:16102..154879290 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:14245-155999293)x1	copy number loss	See cases [RCV000052982]	ChrX:14245..155999293 [GRCh38] ChrX:64245..155228958 [GRCh37] ChrX:4245..154882152 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20297-155999253)x3	copy number gain	See cases [RCV000134564]	ChrX:20297..155999253 [GRCh38] ChrX:70297..155228918 [GRCh37] ChrX:10297..154882112 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq11.1-21.1(chrX:62712219-78605009)x3	copy number gain	See cases [RCV000134569]	ChrX:62712219..78605009 [GRCh38] ChrX:61931689..77860506 [GRCh37] ChrX:61848414..77747162 [NCBI36] ChrX:Xq11.1-21.1	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003242)x1	copy number loss	See cases [RCV000133947]	ChrX:10701..156003242 [GRCh38] ChrX:60701..155232907 [GRCh37] ChrX:701..154886101 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 Xq11.1-28(chrX:62712230-155978888)x3	copy number gain	See cases [RCV000134025]	ChrX:62712230..155978888 [GRCh38] ChrX:61931700..155208553 [GRCh37] ChrX:61848425..154861747 [NCBI36] ChrX:Xq11.1-28	pathogenic
GRCh38/hg38 Xp21.1-q28(chrX:37076284-156016920)x1	copy number loss	See cases [RCV000135300]	ChrX:37076284..156016920 [GRCh38] ChrX:37094357..155246585 [GRCh37] ChrX:37004278..154899779 [NCBI36] ChrX:Xp21.1-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20297-156026127)x1	copy number loss	See cases [RCV000135321]	ChrX:20297..156026127 [GRCh38] ChrX:70297..155255792 [GRCh37] ChrX:10297..154908986 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp11.22-q21.31(chrX:53985575-92203108)x1	copy number loss	See cases [RCV000135306]	ChrX:53985575..92203108 [GRCh38] ChrX:54012008..91458107 [GRCh37] ChrX:54028733..91344763 [NCBI36] ChrX:Xp11.22-q21.31	pathogenic
GRCh38/hg38 Xp21.1-q28(chrX:36237706-156022206)x1	copy number loss	See cases [RCV000135552]	ChrX:36237706..156022206 [GRCh38] ChrX:36255823..155251871 [GRCh37] ChrX:36165744..154905065 [NCBI36] ChrX:Xp21.1-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003229)x1	copy number loss	See cases [RCV000136097]	ChrX:10701..156003229 [GRCh38] ChrX:60701..155232894 [GRCh37] ChrX:701..154886088 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:40904-155998166)x1	copy number loss	See cases [RCV000136478]	ChrX:40904..155998166 [GRCh38] ChrX:90904..155227831 [GRCh37] ChrX:30904..154881025 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q25(chrX:10701-128393708)	copy number loss	See cases [RCV000136094]	ChrX:10701..128393708 [GRCh38] ChrX:60701..127527686 [GRCh37] ChrX:701..127355367 [NCBI36] ChrX:Xp22.33-q25	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10001-156030895)x1	copy number loss	See cases [RCV000136005]	ChrX:10001..156030895 [GRCh38] ChrX:60001..155260560 [GRCh37] ChrX:1..154913754 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2765636-155522304)x3	copy number gain	See cases [RCV000136791]	ChrX:2765636..155522304 [GRCh38] ChrX:2683677..154751965 [GRCh37] ChrX:2693677..154405159 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2782275-155611794)x2	copy number gain	See cases [RCV000136841]	ChrX:2782275..155611794 [GRCh38] ChrX:2700316..154785891 [GRCh37] ChrX:2710316..154494649 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq11.1-28(chrX:62561604-156003242)x3	copy number gain	See cases [RCV000137553]	ChrX:62561604..156003242 [GRCh38] ChrX:61781074..155232907 [GRCh37] ChrX:61697799..154886101 [NCBI36] ChrX:Xq11.1-28	pathogenic
GRCh38/hg38 Xp11.23-q22.1(chrX:49100536-102174742)x1	copy number loss	See cases [RCV000137414]	ChrX:49100536..102174742 [GRCh38] ChrX:48957474..101429714 [GRCh37] ChrX:48844418..101316370 [NCBI36] ChrX:Xp11.23-q22.1	pathogenic\|likely benign
GRCh38/hg38 Xp22.33-q13.3(chrX:10679-76420505)x3	copy number gain	See cases [RCV000137137]	ChrX:10679..76420505 [GRCh38] ChrX:60679..75640898 [GRCh37] ChrX:679..75557302 [NCBI36] ChrX:Xp22.33-q13.3	pathogenic\|likely benign
GRCh38/hg38 Xp22.33-q22.3(chrX:10701-106113403)x1	copy number loss	See cases [RCV000137886]	ChrX:10701..106113403 [GRCh38] ChrX:60701..105357395 [GRCh37] ChrX:701..105244051 [NCBI36] ChrX:Xp22.33-q22.3	pathogenic
GRCh38/hg38 Xp22.2-q27.3(chrX:13020141-143473520)x1	copy number loss	See cases [RCV000138678]	ChrX:13020141..143473520 [GRCh38] ChrX:13038260..142561303 [GRCh37] ChrX:12948181..142388969 [NCBI36] ChrX:Xp22.2-q27.3	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:1085618-155699644)x1	copy number loss	See cases [RCV000139278]	ChrX:1085618..155699644 [GRCh38] ChrX:1118268..154929305 [GRCh37] ChrX:1038268..154582499 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q21.31(chrX:10701-88318651)x1	copy number loss	See cases [RCV000139352]	ChrX:10701..88318651 [GRCh38] ChrX:60701..87573652 [GRCh37] ChrX:701..87460308 [NCBI36] ChrX:Xp22.33-q21.31	pathogenic
GRCh38/hg38 Xq11.1-28(chrX:62712219-156003242)x3	copy number gain	See cases [RCV000139416]	ChrX:62712219..156003242 [GRCh38] ChrX:61931689..155232907 [GRCh37] ChrX:61848414..154886101 [NCBI36] ChrX:Xq11.1-28	pathogenic\|likely benign
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004181)x3	copy number gain	See cases [RCV000139888]	ChrX:251880..156004181 [GRCh38] ChrX:168547..155233846 [GRCh37] ChrX:108547..154887040 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2299223-155992188)x3	copy number gain	See cases [RCV000141400]	ChrX:2299223..155992188 [GRCh38] ChrX:2217264..155221853 [GRCh37] ChrX:2227264..154875047 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20297-156016920)x3	copy number gain	See cases [RCV000141401]	ChrX:20297..156016920 [GRCh38] ChrX:70297..155246585 [GRCh37] ChrX:10297..154899779 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004066)x4	copy number gain	See cases [RCV000140786]	ChrX:251880..156004066 [GRCh38] ChrX:168547..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004066)x1	copy number loss	See cases [RCV000140787]	ChrX:251880..156004066 [GRCh38] ChrX:168547..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic\|conflicting data from submitters
GRCh38/hg38 Xp11.22-q24(chrX:50289384-119297604)	copy number loss	See cases [RCV000141742]	ChrX:50289384..119297604 [GRCh38] ChrX:50032384..118431567 [GRCh37] ChrX:50049124..118315595 [NCBI36] ChrX:Xp11.22-q24	pathogenic
GRCh38/hg38 Xq12-21.1(chrX:66445907-78172208)x3	copy number gain	See cases [RCV000142336]	ChrX:66445907..78172208 [GRCh38] ChrX:65665749..77427705 [GRCh37] ChrX:65582474..77314361 [NCBI36] ChrX:Xq12-21.1	pathogenic
GRCh38/hg38 Xp22.33-q24(chrX:251879-118847157)x3	copy number gain	See cases [RCV000142134]	ChrX:251879..118847157 [GRCh38] ChrX:168546..117981120 [GRCh37] ChrX:108546..117865148 [NCBI36] ChrX:Xp22.33-q24	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003229)x3	copy number gain	See cases [RCV000142625]	ChrX:10701..156003229 [GRCh38] ChrX:60701..155232894 [GRCh37] ChrX:701..154886088 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp11.22-q28(chrX:53144751-156003242)x1	copy number loss	See cases [RCV000143349]	ChrX:53144751..156003242 [GRCh38] ChrX:53321095..155232907 [GRCh37] ChrX:53190658..154886101 [NCBI36] ChrX:Xp11.22-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251879-156004066)x1	copy number loss	See cases [RCV000143441]	ChrX:251879..156004066 [GRCh38] ChrX:168546..155233731 [GRCh37] ChrX:108546..154886925 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251879-156004066)x3	copy number gain	See cases [RCV000143433]	ChrX:251879..156004066 [GRCh38] ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004066)x3	copy number gain	See cases [RCV000143219]	ChrX:251880..156004066 [GRCh38] ChrX:168547..155233731 [GRCh37] ChrX:108547..154886925 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp11.21-q13.3(chrX:56431359-76557419)x1	copy number loss	See cases [RCV000143131]	ChrX:56431359..76557419 [GRCh38] ChrX:56457792..75777827 [GRCh37] ChrX:56474517..75694231 [NCBI36] ChrX:Xp11.21-q13.3	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x3	copy number gain	See cases [RCV000148141]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x1	copy number loss	See cases [RCV000148135]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155246643)x3	copy number gain	See cases [RCV000240122]	ChrX:71267..155246643 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq11.1-28(chrX:62063537-155246643)x3	copy number gain	See cases [RCV000240143]	ChrX:62063537..155246643 [GRCh37] ChrX:Xq11.1-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:176426-155250222)x3	copy number gain	See cases [RCV000239843]	ChrX:176426..155250222 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155255839)x1	copy number loss	See cases [RCV000239832]	ChrX:71267..155255839 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.2-q28(chrX:13147668-155250222)x3	copy number gain	See cases [RCV000239798]	ChrX:13147668..155250222 [GRCh37] ChrX:Xp22.2-q28	pathogenic
NM_001039840.4(CHIC1):c.331C>T (p.Pro111Ser)	single nucleotide variant	Malignant tumor of prostate [RCV000206759]	ChrX:73577441 [GRCh38] ChrX:72797277 [GRCh37] ChrX:Xq13.2	uncertain significance
Single allele	duplication	Syndromic X-linked intellectual disability Lubs type [RCV000768455]	ChrX:15323210..153542100 [GRCh37] ChrX:Xp22.2-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:150002-155234036)x2	copy number gain	See cases [RCV000240106]	ChrX:150002..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60701-155246271)x3	copy number gain	See cases [RCV000239989]	ChrX:60701..155246271 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155224766)x1	copy number loss	See cases [RCV000239902]	ChrX:71267..155224766 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155234036)x2	copy number gain	See cases [RCV000239874]	ChrX:71267..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp11.21-q21.1(chrX:55240087-78225374)x1	copy number loss	See cases [RCV000511311]	ChrX:55240087..78225374 [GRCh37] ChrX:Xp11.21-q21.1	pathogenic
GRCh37/hg19 Xp11.3-q21.1(chrX:44734936-79676121)x3	copy number gain	See cases [RCV000240019]	ChrX:44734936..79676121 [GRCh37] ChrX:Xp11.3-q21.1	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:70297-155255839)x3	copy number gain	See cases [RCV000239934]	ChrX:70297..155255839 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:176426-155236656)x3	copy number gain	See cases [RCV000240552]	ChrX:176426..155236656 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:225816-155234036)x2	copy number gain	See cases [RCV000240464]	ChrX:225816..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:150002-155234036)x3	copy number gain	See cases [RCV000240314]	ChrX:150002..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq11.1-28(chrX:62063537-155250222)x3	copy number gain	See cases [RCV000240148]	ChrX:62063537..155250222 [GRCh37] ChrX:Xq11.1-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:2707626-155250222)x2	copy number gain	See cases [RCV000240541]	ChrX:2707626..155250222 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.2-q25(chrX:11692290-121187337)x2	copy number gain	not provided [RCV000488046]	ChrX:11692290..121187337 [GRCh37] ChrX:Xp22.2-q25	uncertain significance
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x3	copy number gain	See cases [RCV000449330]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:70297-155255792)	copy number loss	See cases [RCV000449461]	ChrX:70297..155255792 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-154930047)x3	copy number gain	See cases [RCV000449437]	ChrX:168546..154930047 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60701-155246225)x3	copy number gain	See cases [RCV000446270]	ChrX:60701..155246225 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq13.1-28(chrX:68701338-155233731)x3	copy number gain	See cases [RCV000446471]	ChrX:68701338..155233731 [GRCh37] ChrX:Xq13.1-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155255792)x1	copy number loss	See cases [RCV000446197]	ChrX:71267..155255792 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:2703632-155233731)x1	copy number loss	See cases [RCV000446712]	ChrX:2703632..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:318707-155224707)x1	copy number loss	See cases [RCV000446667]	ChrX:318707..155224707 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq13.1-21.1(chrX:71316395-84337550)x3	copy number gain	See cases [RCV000447565]	ChrX:71316395..84337550 [GRCh37] ChrX:Xq13.1-21.1	uncertain significance
GRCh37/hg19 Xp11.1-q28(chrX:58140271-155046703)x3	copy number gain	See cases [RCV000446151]	ChrX:58140271..155046703 [GRCh37] ChrX:Xp11.1-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x4	copy number gain	See cases [RCV000446932]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155196888)x3	copy number gain	See cases [RCV000446310]	ChrX:168546..155196888 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155081533)x3	copy number gain	See cases [RCV000447253]	ChrX:168546..155081533 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:553069-155233731)x1	copy number loss	See cases [RCV000446026]	ChrX:553069..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168566-155233731)x1	copy number loss	See cases [RCV000445720]	ChrX:168566..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq13.2(chrX:72827998-72867117)x2	copy number gain	See cases [RCV000448106]	ChrX:72827998..72867117 [GRCh37] ChrX:Xq13.2	uncertain significance
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x1	copy number loss	See cases [RCV000448393]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:70297-155255792)x4	copy number gain	See cases [RCV000448034]	ChrX:70297..155255792 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq13.2-27.1(chrX:72224362-139262228)x4	copy number gain	See cases [RCV000448394]	ChrX:72224362..139262228 [GRCh37] ChrX:Xq13.2-27.1	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:70297-155246585)x1	copy number loss	See cases [RCV000448652]	ChrX:70297..155246585 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:55532799-150239235)x1	copy number loss	See cases [RCV000448870]	ChrX:55532799..150239235 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168547-151304063)x1	copy number loss	See cases [RCV000510382]	ChrX:168547..151304063 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q23(chrX:168547-112474026)x1	copy number loss	See cases [RCV000510419]	ChrX:168547..112474026 [GRCh37] ChrX:Xp22.33-q23	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:55000501-155230750)x3	copy number gain	See cases [RCV000511787]	ChrX:55000501..155230750 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xp21.1-q22.1(chrX:37521774-98488534)x1	copy number loss	See cases [RCV000512026]	ChrX:37521774..98488534 [GRCh37] ChrX:Xp21.1-q22.1	pathogenic
GRCh37/hg19 Xp21.2-q28(chrX:31088082-155233731)x1	copy number loss	See cases [RCV000511413]	ChrX:31088082..155233731 [GRCh37] ChrX:Xp21.2-q28	pathogenic\|uncertain significance
GRCh37/hg19 Xp22.33-q28(chrX:168547-155233731)	copy number gain	See cases [RCV000512020]	ChrX:168547..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:57511767-155233731)x3	copy number gain	See cases [RCV000510826]	ChrX:57511767..155233731 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:56457791-155233731)x3	copy number gain	See cases [RCV000511307]	ChrX:56457791..155233731 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xp22.33-q13.3(chrX:168546-74549686)	copy number loss	See cases [RCV000512142]	ChrX:168546..74549686 [GRCh37] ChrX:Xp22.33-q13.3	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:57415659-155233731)x3	copy number gain	See cases [RCV000512173]	ChrX:57415659..155233731 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xp22.31-q21.31(chrX:7841947-90815333)x1,2	copy number gain	not provided [RCV000684261]	ChrX:7841947..90815333 [GRCh37] ChrX:Xp22.31-q21.31	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x1	copy number loss	not provided [RCV000848828]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq13.2(chrX:72826452-72830518)x1	copy number loss	not provided [RCV000753594]	ChrX:72826452..72830518 [GRCh37] ChrX:Xq13.2	benign
GRCh37/hg19 Xq13.2(chrX:72826452-72884536)x0	copy number loss	not provided [RCV000753595]	ChrX:72826452..72884536 [GRCh37] ChrX:Xq13.2	benign
GRCh37/hg19 Xq13.2(chrX:72826452-73177423)x0	copy number loss	not provided [RCV000753596]	ChrX:72826452..73177423 [GRCh37] ChrX:Xq13.2	benign
GRCh37/hg19 Xq13.2(chrX:72827505-72830012)x0	copy number loss	not provided [RCV000753597]	ChrX:72827505..72830012 [GRCh37] ChrX:Xq13.2	benign
GRCh37/hg19 Xq13.2(chrX:72828034-72830012)x0	copy number loss	not provided [RCV000753598]	ChrX:72828034..72830012 [GRCh37] ChrX:Xq13.2	benign
GRCh37/hg19 Xq13.2(chrX:72828034-72830518)x0	copy number loss	not provided [RCV000753599]	ChrX:72828034..72830518 [GRCh37] ChrX:Xq13.2	benign
GRCh37/hg19 Xp11.23-q13.2(chrX:48115450-73424191)x1	copy number loss	not provided [RCV000753535]	ChrX:48115450..73424191 [GRCh37] ChrX:Xp11.23-q13.2	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60814-155254881)x2	copy number gain	not provided [RCV000753277]	ChrX:60814..155254881 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60262-155245765)x1	copy number loss	not provided [RCV000753271]	ChrX:60262..155245765 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60262-155245765)x3	copy number gain	not provided [RCV000753272]	ChrX:60262..155245765 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:181779-155171702)x1	copy number loss	not provided [RCV000753278]	ChrX:181779..155171702 [GRCh37] ChrX:Xp22.33-q28	pathogenic
Single allele	duplication	Autism [RCV000754365]	ChrX:1..156040895 [GRCh38] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60814-155236712)x2	copy number gain	not provided [RCV000753276]	ChrX:60814..155236712 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq11.1-28(chrX:61694576-155254881)x1	copy number loss	not provided [RCV000753556]	ChrX:61694576..155254881 [GRCh37] ChrX:Xq11.1-28	pathogenic
NC_000023.10:g.36649710_136649711del100000002insG	indel	Heterotaxy, visceral, 1, X-linked [RCV000754886]	ChrX:36649710..136649711 [GRCh37] ChrX:Xp21.1-q26.3	pathogenic
46,Y,inv(X)(p21.1q13.3)	inversion	Elevated circulating creatine kinase concentration [RCV000856573]	ChrX:32196272..75245806 [GRCh37] ChrX:Xp21.1-q13.3	likely pathogenic
GRCh37/hg19 Xp11.4-q21.32(chrX:40572613-92796528)x1	copy number loss	not provided [RCV000845670]	ChrX:40572613..92796528 [GRCh37] ChrX:Xp11.4-q21.32	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:54941868-155233731)x1	copy number loss	not provided [RCV000848218]	ChrX:54941868..155233731 [GRCh37] ChrX:Xp11.21-q28	uncertain significance
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x4	copy number gain	not provided [RCV000846039]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp11.1-q28(chrX:58455352-155233731)x1	copy number loss	not provided [RCV000846274]	ChrX:58455352..155233731 [GRCh37] ChrX:Xp11.1-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:200855-155240074)	copy number gain	Klinefelter syndrome [RCV003236730]	ChrX:200855..155240074 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq13.2(chrX:72024935-73087982)x3	copy number gain	not provided [RCV002473834]	ChrX:72024935..73087982 [GRCh37] ChrX:Xq13.2	uncertain significance
NM_001039840.4(CHIC1):c.337G>A (p.Val113Ile)	single nucleotide variant	not provided [RCV001572754]\|not specified [RCV004039382]	ChrX:73577447 [GRCh38] ChrX:72797283 [GRCh37] ChrX:Xq13.2	likely benign\|uncertain significance
GRCh37/hg19 Xp11.21-q28(chrX:55507789-155198481)x3	copy number gain	See cases [RCV001263024]	ChrX:55507789..155198481 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:1-155270560)	copy number gain	46,XX sex reversal 1 [RCV002280665]\|Hypotonia [RCV002280667]\|Trisomy X syndrome [RCV002280666]	ChrX:1..155270560 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq11.1-28(chrX:62685885-155233731)	copy number loss	Turner syndrome [RCV002280672]	ChrX:62685885..155233731 [GRCh37] ChrX:Xq11.1-28	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:56469080-155233731)x3	copy number gain	not provided [RCV001281359]	ChrX:56469080..155233731 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60000-155234966)x1	copy number loss	not provided [RCV001537933]	ChrX:60000..155234966 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x3	copy number gain	not provided [RCV001829212]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq11.1-21.1(chrX:61974855-79123671)	copy number gain	not specified [RCV002053136]	ChrX:61974855..79123671 [GRCh37] ChrX:Xq11.1-21.1	pathogenic
GRCh37/hg19 Xq11.1-21.1(chrX:61877278-79123671)	copy number gain	not specified [RCV002053135]	ChrX:61877278..79123671 [GRCh37] ChrX:Xq11.1-21.1	pathogenic
GRCh37/hg19 Xq13.2-21.31(chrX:72095006-88455505)	copy number gain	not specified [RCV002053147]	ChrX:72095006..88455505 [GRCh37] ChrX:Xq13.2-21.31	uncertain significance
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x1	copy number loss	not provided [RCV001834509]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
NM_001039840.4(CHIC1):c.231C>G (p.Ser77Arg)	single nucleotide variant	not specified [RCV004298732]	ChrX:73563515 [GRCh38] ChrX:72783351 [GRCh37] ChrX:Xq13.2	uncertain significance
GRCh37/hg19 Xp22.33-q28(chrX:1-155270560)	copy number loss	Turner syndrome [RCV002280668]	ChrX:1..155270560 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.2-q28(chrX:11522765-155233731)x1	copy number loss	See cases [RCV002286357]	ChrX:11522765..155233731 [GRCh37] ChrX:Xp22.2-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:61545-155226048)x2	copy number gain	Klinefelter syndrome [RCV002282732]	ChrX:61545..155226048 [GRCh37] ChrX:Xp22.33-q28	pathogenic
NM_001039840.4(CHIC1):c.155A>C (p.Glu52Ala)	single nucleotide variant	not specified [RCV004248352]	ChrX:73563439 [GRCh38] ChrX:72783275 [GRCh37] ChrX:Xq13.2	uncertain significance
NM_001039840.4(CHIC1):c.164A>G (p.Glu55Gly)	single nucleotide variant	not specified [RCV004263337]	ChrX:73563448 [GRCh38] ChrX:72783284 [GRCh37] ChrX:Xq13.2	uncertain significance
NM_001039840.4(CHIC1):c.256C>T (p.Pro86Ser)	single nucleotide variant	not specified [RCV004300034]	ChrX:73563540 [GRCh38] ChrX:72783376 [GRCh37] ChrX:Xq13.2	uncertain significance
NM_001039840.4(CHIC1):c.397T>A (p.Cys133Ser)	single nucleotide variant	not specified [RCV004352360]	ChrX:73584462 [GRCh38] ChrX:72804298 [GRCh37] ChrX:Xq13.2	uncertain significance
NM_001039840.4(CHIC1):c.133G>A (p.Glu45Lys)	single nucleotide variant	not specified [RCV004334786]	ChrX:73563417 [GRCh38] ChrX:72783253 [GRCh37] ChrX:Xq13.2	uncertain significance
GRCh37/hg19 Xq13.2(chrX:72890072-73123210)x3	copy number gain	not provided [RCV003485301]	ChrX:72890072..73123210 [GRCh37] ChrX:Xq13.2	uncertain significance
NM_001039840.4(CHIC1):c.162_176del (p.Glu64_Glu68del)	deletion	not provided [RCV003439652]	ChrX:73563435..73563449 [GRCh38] ChrX:72783271..72783285 [GRCh37] ChrX:Xq13.2	uncertain significance
GRCh37/hg19 Xq11.1-21.1(chrX:61877278-79122848)	copy number gain	not specified [RCV003986211]	ChrX:61877278..79122848 [GRCh37] ChrX:Xq11.1-21.1	pathogenic
GRCh37/hg19 Xq13.2(chrX:72750667-72858194)	copy number loss	not specified [RCV003986294]	ChrX:72750667..72858194 [GRCh37] ChrX:Xq13.2	uncertain significance
GRCh37/hg19 Xq13.1-22.1(chrX:68040342-100863081)	copy number gain	not specified [RCV003986197]	ChrX:68040342..100863081 [GRCh37] ChrX:Xq13.1-22.1	pathogenic
NM_001039840.4(CHIC1):c.149A>G (p.Glu50Gly)	single nucleotide variant	not specified [RCV004439227]	ChrX:73563433 [GRCh38] ChrX:72783269 [GRCh37] ChrX:Xq13.2	uncertain significance
NM_001039840.4(CHIC1):c.256C>G (p.Pro86Ala)	single nucleotide variant	not specified [RCV004439228]	ChrX:73563540 [GRCh38] ChrX:72783376 [GRCh37] ChrX:Xq13.2	uncertain significance
GRCh37/hg19 Xq12-28(chrX:67292994-155240074)x3	copy number gain	not provided [RCV003885530]	ChrX:67292994..155240074 [GRCh37] ChrX:Xq12-28	pathogenic
NC_000023.11:g.(?_66445907)_(78172208_?)dup	duplication	Xq13q21 duplication [RCV003885331]	ChrX:66445907..78172208 [GRCh38] ChrX:Xq12-21.1	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2757837-156030895)x2	copy number gain	Klinefelter syndrome [RCV004579655]	ChrX:2757837..156030895 [GRCh38] ChrX:Xp22.33-q28	pathogenic
NC_000023.10:g.(?_54610638)_(154689386_?)dup	duplication	Hereditary factor VIII deficiency disease [RCV004768478]	ChrX:54610638..154689386 [GRCh37] ChrX:Xp11.22-q28	uncertain significance
NM_001039840.4(CHIC1):c.71A>C (p.Glu24Ala)	single nucleotide variant	not specified [RCV004896710]	ChrX:73563355 [GRCh38] ChrX:72783191 [GRCh37] ChrX:Xq13.2	uncertain significance
NM_001039840.4(CHIC1):c.237G>C (p.Glu79Asp)	single nucleotide variant	not specified [RCV004896711]	ChrX:73563521 [GRCh38] ChrX:72783357 [GRCh37] ChrX:Xq13.2	uncertain significance
NM_001039840.4(CHIC1):c.509C>G (p.Thr170Ser)	single nucleotide variant	not specified [RCV004896712]	ChrX:73679327 [GRCh38] ChrX:72899162 [GRCh37] ChrX:Xq13.2	uncertain significance
NM_001039840.4(CHIC1):c.416C>T (p.Pro139Leu)	single nucleotide variant	not specified [RCV004896714]	ChrX:73584481 [GRCh38] ChrX:72804317 [GRCh37] ChrX:Xq13.2	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	65
Count of miRNA genes:	59
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000035558
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34663461	87525369	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	69060519	77046890	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	37415584	80753406	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34535218	79535218	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	38433408	83433408	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	59492522	77046890	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	66451204	106807694	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	32284471	77284471	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	37262092	82262092	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	37415584	82415584	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	74023918	80753406	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat

RH128185

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	74,345,930 - 74,346,126 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	79,889,088 - 79,889,283	NCBI	Rnor6.0
Rnor_5.0	13	84,782,797 - 84,782,992	UniSTS	Rnor5.0
RGSC_v3.4	13	77,666,581 - 77,666,776	UniSTS	RGSC3.4
Celera	13	74,098,886 - 74,099,081	UniSTS
RH 3.4 Map	13	452.9	UniSTS
Cytogenetic Map	13	q22	UniSTS

RH138688

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	74,345,930 - 74,346,051 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	79,889,088 - 79,889,208	NCBI	Rnor6.0
Rnor_5.0	13	84,782,797 - 84,782,917	UniSTS	Rnor5.0
RGSC_v3.4	13	77,666,581 - 77,666,701	UniSTS	RGSC3.4
Celera	13	74,098,886 - 74,099,006	UniSTS
RH 3.4 Map	13	452.7	UniSTS
Cytogenetic Map	13	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001012207	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429830	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006250182	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006250183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC144674	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000035558 ⟹ ENSRNOP00000035922

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	74,343,900 - 74,346,211 (+)	Ensembl
Rnor_6.0 Ensembl	13	79,886,949 - 79,889,304 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076417 ⟹ ENSRNOP00000068091

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	74,296,854 - 74,346,211 (+)	Ensembl
Rnor_6.0 Ensembl	13	79,886,984 - 79,888,534 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077069 ⟹ ENSRNOP00000068000

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	74,340,725 - 74,346,211 (+)	Ensembl
Rnor_6.0 Ensembl	13	79,886,832 - 79,888,420 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105154 ⟹ ENSRNOP00000094482

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	74,343,043 - 74,346,211 (+)	Ensembl

RefSeq Acc Id:

NM_001012207 ⟹ NP_001012207

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	76,877,065 - 76,879,420 (+)	NCBI
mRatBN7.2	13	74,343,792 - 74,346,147 (+)	NCBI
Rnor_6.0	13	79,886,949 - 79,889,304 (+)	NCBI
Rnor_5.0	13	84,780,555 - 84,783,014 (+)	NCBI
RGSC_v3.4	13	77,664,442 - 77,666,797 (+)	RGD
Celera	13	74,096,747 - 74,099,102 (+)	RGD

Sequence:

show sequence

GGCCTTTCCGGCTGAGCCAAGGCTGGGAGAGGGGCGGCGGCGGGCAGGGCAGGCCGGCTTGGCTTAGCCTGGCCCGAAGACTTTGTAAACAAGGAAAGTTCTGTATGCTATCAGCGTGGCATTTCTGA
GAGGTCTTAATCTACAACTTTATCAAGAACTAGAATCCTGTGGGCATCTTTGAGGGAGATTGAGCCCGCCTGGATTTCAGGAAAGGATGAGATAATGTGTGCTCAACATGTAGCGGACACCTCCGAAG
TCAAGTGGCAGAAGGTTTTATATGAGCGGCAGCCATTCCCTGATAACTATGTTGACCAAAGGTTCCTGGAGGAGCTCCGGAAAAACATCTATGCCCGGAAATACCAATACTGGGCTGTGGTATTTGAG
TCCAGTGTGGTGATACAACAGCTGTGCAGTGTCTGTGTCTTTGTAGTCATTTGGTGGTACATGGACGAGGGTCTTCTGGCTCCCCAGTGGCTTTTTGGGACTGGACTGGCATCGTCCTTGGTTGGGTA
TGTGTTATTTGATCTTATTGATGGAGGTGATGGACGGAAGAAGAGTGGGCGGACCCGGTGGGCCGACCTGAAGAGTACTCTGGTCTTCATTACTTTCACGTACGGTTTCTCACCAGTGCTAAAGACCC
TGACAGAGTCCGTCAGTACGGACACCATCTACGCCATGTCCGTTTTTATGCTGTTAGGCCATCTCATCTTCTTTGATTACGGTGCCAATGCTGCTATTGTATCTAGCACACTGTCCTTGAATATGGCC
ATCTTTGCTTCTGTTTGCCTGGCCTCACGCCTCCCCCGGTCACTACATGCCTTCATCATGGTGACATTTGCCATCCAGATCTTTGCACTGTGGCCCATGTTACAGAAGAAACTGAAGGCGTATACCCC
AAGAAGCTATGTCGGGGTCACCCTGCTTTTTGCCTTTTCAGCTTTTGGAGGTCTTTTGTCCATTAGTGGTGTGGGAGCCATACTCTTTGCTCTTCTGCTGTTTTCCATTTCCTGTCTCTGCCCTTACT
ATCTCATTCACCTGCAGCTTTTTAAGGAAAATATTCATGGGCCTTGGGATGAGGCAGAAATCAAGGAAGACTTGTCCAGGTTCCTTAGCTAACCTAGGGACCTGCATTTCATTATTAAGAAAAGTTAA
AAGACTTAGAACCTAACCAGTGTAACATTTAAAGGCAGGGTTCCACTCTCAAAGCAGCAGGCTGATCTGGGTGGTAGAGCTGAGATCAGAAGAGTTTAACCAAGGGTTTAGGGGAAGGTGTTTGCCCT
TCAGTTTACCTTGTGACTTAAAAAGCTTTCTGGTGCTGTTATGAATTATTGTCCTTTATTCCCTCTAACAATGATGTGATGTGGGTTCTGCTTATTAAAAGAGTAACATCTAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006250182 ⟹ XP_006250244

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	76,876,894 - 76,879,420 (+)	NCBI
mRatBN7.2	13	74,343,680 - 74,346,148 (+)	NCBI
Rnor_6.0	13	79,886,832 - 79,889,305 (+)	NCBI
Rnor_5.0	13	84,780,555 - 84,783,014 (+)	NCBI

Sequence:

show sequence

CACAGTAGTCCCCTCCAACCCCGCGTCCCGGATGTAGAAGTAGCAGGGCTGCTGCTCTTCTCGG
TCGTACACCCCCTAAAGAGCTGGGGCAGGTGGGTTCCGGCGTCCTTCGCTTCGGGCCTTTCCGGCTGAGCCAAGGCTGGGAGAGGGGCGGCGGCGGGCAGGGCAGGCCGGCTTGGAATTTAGTTGCGT
TGTCCTGATTCACGGAACAAACTCATCTATTGCAGGCTTAGCCTGGCCCGAAGACTTTGTAAACAAGGAAAGTTCTGTATGCTATCAGCGTGGCATTTCTGAGAGGTCTTAATCTACAACTTTATCAA
GAACTAGAATCCTGTGGGCATCTTTGAGGGAGATTGAGCCCGCCTGGATTTCAGGAAAGGATGAGATAATGTGTGCTCAACATGTAGCGGACACCTCCGAAGTCAAGTGGCAGAAGGTTTTATATGAG
CGGCAGCCATTCCCTGATAACTATGTTGACCAAAGGTTCCTGGAGGAGCTCCGGAAAAACATCTATGCCCGGAAATACCAATACTGGGCTGTGGTATTTGAGTCCAGTGTGGTGATACAACAGCTGTG
CAGTGTCTGTGTCTTTGTAGTCATTTGGTGGTACATGGACGAGGGTCTTCTGGCTCCCCAGTGGCTTTTTGGGACTGGACTGGCATCGTCCTTGGTTGGGTATGTGTTATTTGATCTTATTGATGGAG
GTGATGGACGGAAGAAGAGTGGGCGGACCCGGTGGGCCGACCTGAAGAGTACTCTGGTCTTCATTACTTTCACGTACGGTTTCTCACCAGTGCTAAAGACCCTGACAGAGTCCGTCAGTACGGACACC
ATCTACGCCATGTCCGTTTTTATGCTGTTAGGCCATCTCATCTTCTTTGATTACGGTGCCAATGCTGCTATTGTATCTAGCACACTGTCCTTGAATATGGCCATCTTTGCTTCTGTTTGCCTGGCCTC
ACGCCTCCCCCGGTCACTACATGCCTTCATCATGGTGACATTTGCCATCCAGATCTTTGCACTGTGGCCCATGTTACAGAAGAAACTGAAGGCGTATACCCCAAGAAGCTATGTCGGGGTCACCCTGC
TTTTTGCCTTTTCAGCTTTTGGAGGTCTTTTGTCCATTAGTGGTGTGGGAGCCATACTCTTTGCTCTTCTGCTGTTTTCCATTTCCTGTCTCTGCCCTTACTATCTCATTCACCTGCAGCTTTTTAAG
GAAAATATTCATGGGCCTTGGGATGAGGCAGAAATCAAGGAAGACTTGTCCAGGTTCCTTAGCTAACCTAGGGACCTGCATTTCATTATTAAGAAAAGTTAAAAGACTTAGAACCTAACCAGTGTAAC
ATTTAAAGGCAGGGTTCCACTCTCAAAGCAGCAGGCTGATCTGGGTGGTAGAGCTGAGATCAGAAGAGTTTAACCAAGGGTTTAGGGGAAGGTGTTTGCCCTTCAGTTTACCTTGTGACTTAAAAAGC
TTTCTGGTGCTGTTATGAATTATTGTCCTTTATTCCCTCTAACAATGATGTGATGTGGGTTCTGCTTATTAAAAGAGTAACATCTAT

hide sequence

RefSeq Acc Id:

XM_006250183 ⟹ XP_006250245

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	76,876,901 - 76,879,420 (+)	NCBI
mRatBN7.2	13	74,343,619 - 74,346,148 (+)	NCBI
Rnor_6.0	13	79,886,838 - 79,889,305 (+)	NCBI
Rnor_5.0	13	84,780,555 - 84,783,014 (+)	NCBI

Sequence:

show sequence

AGTCCCCTCCAACCCCGCGTCCCGGATGTAGAAGTAGCAGGGCTGCTGCTCTTCTCGGTCGTACACCCCCTAAAGAGCTGGGGCAGGAATTTAGTTGCGTTGTCCTGATTCACGGAACAAACTCATCT
ATTGCAGGCTTAGCCTGGCCCGAAGACTTTGTAAACAAGGAAAGTTCTGTATGCTATCAGCGTGGCATTTCTGAGAGGTCTTAATCTACAACTTTATCAAGAACTAGAATCCTGTGGGCATCTTTGAG
GGAGATTGAGCCCGCCTGGATTTCAGGAAAGGATGAGATAATGTGTGCTCAACATGTAGCGGACACCTCCGAAGTCAAGTGGCAGAAGGTTTTATATGAGCGGCAGCCATTCCCTGATAACTATGTTG
ACCAAAGGTTCCTGGAGGAGCTCCGGAAAAACATCTATGCCCGGAAATACCAATACTGGGCTGTGGTATTTGAGTCCAGTGTGGTGATACAACAGCTGTGCAGTGTCTGTGTCTTTGTAGTCATTTGG
TGGTACATGGACGAGGGTCTTCTGGCTCCCCAGTGGCTTTTTGGGACTGGACTGGCATCGTCCTTGGTTGGGTATGTGTTATTTGATCTTATTGATGGAGGTGATGGACGGAAGAAGAGTGGGCGGAC
CCGGTGGGCCGACCTGAAGAGTACTCTGGTCTTCATTACTTTCACGTACGGTTTCTCACCAGTGCTAAAGACCCTGACAGAGTCCGTCAGTACGGACACCATCTACGCCATGTCCGTTTTTATGCTGT
TAGGCCATCTCATCTTCTTTGATTACGGTGCCAATGCTGCTATTGTATCTAGCACACTGTCCTTGAATATGGCCATCTTTGCTTCTGTTTGCCTGGCCTCACGCCTCCCCCGGTCACTACATGCCTTC
ATCATGGTGACATTTGCCATCCAGATCTTTGCACTGTGGCCCATGTTACAGAAGAAACTGAAGGCGTATACCCCAAGAAGCTATGTCGGGGTCACCCTGCTTTTTGCCTTTTCAGCTTTTGGAGGTCT
TTTGTCCATTAGTGGTGTGGGAGCCATACTCTTTGCTCTTCTGCTGTTTTCCATTTCCTGTCTCTGCCCTTACTATCTCATTCACCTGCAGCTTTTTAAGGAAAATATTCATGGGCCTTGGGATGAGG
CAGAAATCAAGGAAGACTTGTCCAGGTTCCTTAGCTAACCTAGGGACCTGCATTTCATTATTAAGAAAAGTTAAAAGACTTAGAACCTAACCAGTGTAACATTTAAAGGCAGGGTTCCACTCTCAAAG
CAGCAGGCTGATCTGGGTGGTAGAGCTGAGATCAGAAGAGTTTAACCAAGGGTTTAGGGGAAGGTGTTTGCCCTTCAGTTTACCTTGTGACTTAAAAAGCTTTCTGGTGCTGTTATGAATTATTGTCC
TTTATTCCCTCTAACAATGATGTGATGTGGGTTCTGCTTATTAAAAGAGTAACATCTAT

hide sequence

RefSeq Acc Id:

XM_008769665 ⟹ XP_008767887

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	76,877,055 - 76,879,420 (+)	NCBI
mRatBN7.2	13	74,343,865 - 74,346,148 (+)	NCBI
Rnor_6.0	13	79,887,037 - 79,889,305 (+)	NCBI

Sequence:

show sequence

GCTCCGTACCGCGGGTCTTTCTGATCCAGAGGTCCCAGTGCATGAAGGCCGATCCCAGGGTGTC
CGGCTTTTAAAGTAAAGGTCTATCCTGGCCTCTTATGAAATAAAGAAGGAATTTAGTTGCGTTGTCCTGATTCACGGAACAAACTCATCTATTGCAGGCTTAGCCTGGCCCGAAGACTTTGTAAACAA
GGAAAGTTCTGTATGCTATCAGCGTGGCATTTCTGAGAGGTCTTAATCTACAACTTTATCAAGAACTAGAATCCTGTGGGCATCTTTGAGGGAGATTGAGCCCGCCTGGATTTCAGGAAAGGATGAGA
TAATGTGTGCTCAACATGTAGCGGACACCTCCGAAGTCAAGTGGCAGAAGGTTTTATATGAGCGGCAGCCATTCCCTGATAACTATGTTGACCAAAGGTTCCTGGAGGAGCTCCGGAAAAACATCTAT
GCCCGGAAATACCAATACTGGGCTGTGGTATTTGAGTCCAGTGTGGTGATACAACAGCTGTGCAGTGTCTGTGTCTTTGTAGTCATTTGGTGGTACATGGACGAGGGTCTTCTGGCTCCCCAGTGGCT
TTTTGGGACTGGACTGGCATCGTCCTTGGTTGGGTATGTGTTATTTGATCTTATTGATGGAGGTGATGGACGGAAGAAGAGTGGGCGGACCCGGTGGGCCGACCTGAAGAGTACTCTGGTCTTCATTA
CTTTCACGTACGGTTTCTCACCAGTGCTAAAGACCCTGACAGAGTCCGTCAGTACGGACACCATCTACGCCATGTCCGTTTTTATGCTGTTAGGCCATCTCATCTTCTTTGATTACGGTGCCAATGCT
GCTATTGTATCTAGCACACTGTCCTTGAATATGGCCATCTTTGCTTCTGTTTGCCTGGCCTCACGCCTCCCCCGGTCACTACATGCCTTCATCATGGTGACATTTGCCATCCAGATCTTTGCACTGTG
GCCCATGTTACAGAAGAAACTGAAGGCGTATACCCCAAGAAGCTATGTCGGGGTCACCCTGCTTTTTGCCTTTTCAGCTTTTGGAGGTCTTTTGTCCATTAGTGGTGTGGGAGCCATACTCTTTGCTC
TTCTGCTGTTTTCCATTTCCTGTCTCTGCCCTTACTATCTCATTCACCTGCAGCTTTTTAAGGAAAATATTCATGGGCCTTGGGATGAGGCAGAAATCAAGGAAGACTTGTCCAGGTTCCTTAGCTAA
CCTAGGGACCTGCATTTCATTATTAAGAAAAGTTAAAAGACTTAGAACCTAACCAGTGTAACATTTAAAGGCAGGGTTCCACTCTCAAAGCAGCAGGCTGATCTGGGTGGTAGAGCTGAGATCAGAAG
AGTTTAACCAAGGGTTTAGGGGAAGGTGTTTGCCCTTCAGTTTACCTTGTGACTTAAAAAGCTTTCTGGTGCTGTTATGAATTATTGTCCTTTATTCCCTCTAACAATGATGTGATGTGGGTTCTGCT
TATTAAAAGAGTAACATCTAT

hide sequence


Protein RefSeqs	NP_001012207	(Get FASTA)	NCBI Sequence Viewer
	NP_001416759	(Get FASTA)	NCBI Sequence Viewer
	NP_001416760	(Get FASTA)	NCBI Sequence Viewer
	NP_001416761	(Get FASTA)	NCBI Sequence Viewer
	XP_006250244	(Get FASTA)	NCBI Sequence Viewer
	XP_006250245	(Get FASTA)	NCBI Sequence Viewer
	XP_008767887	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH87080	(Get FASTA)	NCBI Sequence Viewer
	EDM09410	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035922
	ENSRNOP00000035922.3
	ENSRNOP00000068000.2
	ENSRNOP00000068091.2
	ENSRNOP00000094482
	ENSRNOP00000094482.1
GenBank Protein	Q5PQQ4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001012207 ⟸ NM_001012207

- UniProtKB:

Q5PQQ4 (UniProtKB/Swiss-Prot), A6ID87 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MCAQHVADTSEVKWQKVLYERQPFPDNYVDQRFLEELRKNIYARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPQWLFGTGLASSLVGYVLFDLIDGGDGRKKSGRTRWADLKSTLVFIT
FTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKAYTPRSYVGVTLLFAFSAFGGLLSISGVGAILFAL
LLFSISCLCPYYLIHLQLFKENIHGPWDEAEIKEDLSRFLS

hide sequence

RefSeq Acc Id:

XP_006250245 ⟸ XM_006250183

- Peptide Label:

isoform X1

- Sequence:

show sequence

MCAQHVADTSEVKWQKVLYERQPFPDNYVDQRFLEELRKNIYARKYQYWAVVFESSVVIQQLCS
VCVFVVIWWYMDEGLLAPQWLFGTGLASSLVGYVLFDLIDGGDGRKKSGRTRWADLKSTLVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASR
LPRSLHAFIMVTFAIQIFALWPMLQKKLKAYTPRSYVGVTLLFAFSAFGGLLSISGVGAILFALLLFSISCLCPYYLIHLQLFKENIHGPWDEAEIKEDLSRFLS

hide sequence

RefSeq Acc Id:

XP_006250244 ⟸ XM_006250182

- Peptide Label:

isoform X1

- Sequence:

show sequence

MCAQHVADTSEVKWQKVLYERQPFPDNYVDQRFLEELRKNIYARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPQWLFGTGLASSLVGYVLFDLIDGGDGRKKSGRTRWADLKSTLVFIT
FTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKAYTPRSYVGVTLLFAFSAFGGLLSISGVGAILFAL
LLFSISCLCPYYLIHLQLFKENIHGPWDEAEIKEDLSRFLS

hide sequence

RefSeq Acc Id:

XP_008767887 ⟸ XM_008769665

- Peptide Label:

isoform X1

- Sequence:

show sequence

MCAQHVADTSEVKWQKVLYERQPFPDNYVDQRFLEELRKNIYARKYQYWAVVFESSVVIQQLCS
VCVFVVIWWYMDEGLLAPQWLFGTGLASSLVGYVLFDLIDGGDGRKKSGRTRWADLKSTLVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASR
LPRSLHAFIMVTFAIQIFALWPMLQKKLKAYTPRSYVGVTLLFAFSAFGGLLSISGVGAILFALLLFSISCLCPYYLIHLQLFKENIHGPWDEAEIKEDLSRFLS

hide sequence

Ensembl Acc Id:

ENSRNOP00000068000 ⟸ ENSRNOT00000077069

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5PQQ4-F1-model_v2	AlphaFold	Q5PQQ4	1-297	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13698936

Promoter ID:

EPDNEW_R9461

Type:

multiple initiation site

Name:

Pigc_1

Description:

phosphatidylinositol glycan anchor biosynthesis, class C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	79,886,936 - 79,886,996	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-17684	BioCyc
Ensembl Genes	ENSRNOG00000026497	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000035558	ENTREZGENE
	ENSRNOT00000035558.5	UniProtKB/Swiss-Prot
	ENSRNOT00000076417.2	UniProtKB/Swiss-Prot
	ENSRNOT00000077069.2	UniProtKB/Swiss-Prot
	ENSRNOT00000105154	ENTREZGENE
	ENSRNOT00000105154.1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7189037	IMAGE-MGC_LOAD
InterPro	Plno_GlcNAc_GPI2	UniProtKB/Swiss-Prot
KEGG Report	rno:364032	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94541	IMAGE-MGC_LOAD
NCBI Gene	364032	ENTREZGENE
PANTHER	PHOSPHATIDYLINOSITOL N-ACETYLGLUCOSAMINYLTRANSFERASE SUBUNIT C	UniProtKB/Swiss-Prot
	PTHR12982	UniProtKB/Swiss-Prot
Pfam	GPI2	UniProtKB/Swiss-Prot
PhenoGen	Pigc	PhenoGen
PIRSF	GPI2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000026497	RatGTEx
UniProt	A0A096MJ59_RAT	UniProtKB/TrEMBL
	A0A096MJD7_RAT	UniProtKB/TrEMBL
	A6ID87	ENTREZGENE, UniProtKB/TrEMBL
	PIGC_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Pigc	phosphatidylinositol glycan anchor biosynthesis, class C	Pigc	phosphatidylinositol glycan, class C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Pigc	phosphatidylinositol glycan, class C	Pigc_predicted	phosphatidylinositol glycan, class C (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Pigc_predicted	phosphatidylinositol glycan, class C (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)