Advanced Search (OLGA)

Gene: Ddx49 (DEAD-box helicase 49) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ddx49

Name:

DEAD-box helicase 49

RGD ID:

1311124

Description:

Predicted to enable RNA helicase activity. Predicted to be involved in positive regulation of cell growth; rRNA processing; and regulation of rRNA stability. Predicted to be located in nucleoplasm. Predicted to be active in nucleus. Orthologous to human DDX49 (DEAD-box helicase 49); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DEAD (Asp-Glu-Ala-Asp) box polypeptide 49; LOC290660; probable ATP-dependent RNA helicase DDX49

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DDX49 (DEAD-box helicase 49)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ddx49 (DEAD box helicase 49)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ddx49 (DEAD-box helicase 49)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DDX49 (DEAD-box helicase 49)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DDX49 (DEAD-box helicase 49)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ddx49 (DEAD-box helicase 49)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DDX49 (DEAD-box helicase 49)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DDX49 (DEAD-box helicase 49)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ddx49 (DEAD-box helicase 49)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DDX49 (DEAD-box helicase 49)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ddx49 (DEAD box helicase 49)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DBP8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dbp45A	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	H20J04.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ddx49	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	19,159,353 - 19,167,003 (+)	NCBI		GRCr8
mRatBN7.2	16	19,125,388 - 19,133,042 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	19,125,384 - 19,133,616 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	19,165,188 - 19,172,843 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	20,297,707 - 20,305,359 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	19,218,149 - 19,225,804 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	20,873,585 - 20,881,312 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,873,642 - 20,881,439 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	20,725,435 - 20,733,085 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	19,609,670 - 19,617,320 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	19,609,685 - 19,617,247 (+)	NCBI
Celera	16	19,315,664 - 19,323,314 (+)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddx49	Rat	Megalencephaly-Polymicrogyria-Polydactyly-Hydrocephalus Syndrome 1		ISO	DDX49 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 1	ClinVar	PMID:28492532
Ddx49	Rat	progressive myoclonus epilepsy 8		ISO	DDX49 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Progressive myoclonic epilepsy type 8	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddx49	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DDX49 mRNA]	CTD	PMID:31150632
Ddx49	Rat	1,2-dimethylhydrazine	increases expression	ISO	Ddx49 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of DDX49 mRNA	CTD	PMID:22206623
Ddx49	Rat	17beta-estradiol	increases expression	ISO	Ddx49 (Mus musculus)	6480464	Estradiol results in increased expression of DDX49 mRNA	CTD	PMID:39298647
Ddx49	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ddx49 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of DDX49 mRNA	CTD	PMID:21570461
Ddx49	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of DDX49 mRNA	CTD	PMID:33387578
Ddx49	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Ddx49 (Mus musculus)	6480464	bisphenol S results in increased expression of DDX49 mRNA	CTD	PMID:39298647
Ddx49	Rat	amiodarone	increases expression	ISO	DDX49 (Homo sapiens)	6480464	Amiodarone results in increased expression of DDX49 mRNA	CTD	PMID:19774075
Ddx49	Rat	aristolochic acid A	increases expression	ISO	DDX49 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of DDX49 mRNA	CTD	PMID:33212167
Ddx49	Rat	atrazine	decreases expression	ISO	DDX49 (Homo sapiens)	6480464	Atrazine results in decreased expression of DDX49 mRNA	CTD	PMID:22378314
Ddx49	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of DDX49 mRNA	CTD	PMID:25181051
Ddx49	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of DDX49 mRNA	CTD	PMID:34947998
Ddx49	Rat	bisphenol A	decreases expression	ISO	DDX49 (Homo sapiens)	6480464	bisphenol A results in decreased expression of DDX49 protein	CTD	PMID:33376534
Ddx49	Rat	bisphenol A	multiple interactions	ISO	DDX49 (Homo sapiens)	6480464	[ginger extract results in increased abundance of Oils and Volatile] inhibits the reaction [bisphenol A results in decreased expression of DDX49 protein]	CTD	PMID:33376534
Ddx49	Rat	bisphenol F	decreases expression	ISO	Ddx49 (Mus musculus)	6480464	bisphenol F results in decreased expression of DDX49 mRNA	CTD	PMID:38685157
Ddx49	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of DDX49 mRNA	CTD	PMID:33453195
Ddx49	Rat	choline	multiple interactions	ISO	Ddx49 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of DDX49 gene	CTD	PMID:20938992
Ddx49	Rat	copper atom	multiple interactions	ISO	Ddx49 (Mus musculus)	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of DDX49 mRNA	CTD	PMID:15467011
Ddx49	Rat	copper(0)	multiple interactions	ISO	Ddx49 (Mus musculus)	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of DDX49 mRNA	CTD	PMID:15467011
Ddx49	Rat	cyclosporin A	increases expression	ISO	DDX49 (Homo sapiens)	6480464	Cyclosporine results in increased expression of DDX49 mRNA	CTD	PMID:20106945 and PMID:25562108
Ddx49	Rat	dibutyl phthalate	decreases expression	ISO	Ddx49 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of DDX49 mRNA	CTD	PMID:21266533
Ddx49	Rat	diquat	decreases expression	ISO	Ddx49 (Mus musculus)	6480464	Diquat results in decreased expression of DDX49 protein	CTD	PMID:36851058
Ddx49	Rat	doxorubicin	decreases expression	ISO	DDX49 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of DDX49 mRNA	CTD	PMID:29803840
Ddx49	Rat	elemental selenium	increases expression	ISO	DDX49 (Homo sapiens)	6480464	Selenium results in increased expression of DDX49 mRNA	CTD	PMID:19244175
Ddx49	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of DDX49 mRNA	CTD	PMID:29391264
Ddx49	Rat	folic acid	multiple interactions	ISO	Ddx49 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of DDX49 gene	CTD	PMID:20938992
Ddx49	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of DDX49 mRNA	CTD	PMID:33387578
Ddx49	Rat	glafenine	increases expression	EXP		6480464	Glafenine results in increased expression of DDX49 mRNA	CTD	PMID:24136188
Ddx49	Rat	ivermectin	decreases expression	ISO	DDX49 (Homo sapiens)	6480464	Ivermectin results in decreased expression of DDX49 protein	CTD	PMID:32959892
Ddx49	Rat	L-methionine	multiple interactions	ISO	Ddx49 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of DDX49 gene	CTD	PMID:20938992
Ddx49	Rat	selenium atom	increases expression	ISO	DDX49 (Homo sapiens)	6480464	Selenium results in increased expression of DDX49 mRNA	CTD	PMID:19244175
Ddx49	Rat	silver atom	decreases expression	ISO	Ddx49 (Mus musculus)	6480464	Silver results in decreased expression of DDX49 mRNA	CTD	PMID:27131904
Ddx49	Rat	silver(0)	decreases expression	ISO	Ddx49 (Mus musculus)	6480464	Silver results in decreased expression of DDX49 mRNA	CTD	PMID:27131904
Ddx49	Rat	sunitinib	increases expression	ISO	DDX49 (Homo sapiens)	6480464	Sunitinib results in increased expression of DDX49 mRNA	CTD	PMID:31533062
Ddx49	Rat	tetrachloroethene	decreases expression	ISO	Ddx49 (Mus musculus)	6480464	Tetrachloroethylene results in decreased expression of DDX49 mRNA	CTD	PMID:28973375
Ddx49	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of DDX49 mRNA	CTD	PMID:31150632
Ddx49	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DDX49 mRNA]	CTD	PMID:31150632
Ddx49	Rat	titanium dioxide	decreases methylation	ISO	Ddx49 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of DDX49 promoter alternative form	CTD	PMID:35295148
Ddx49	Rat	triphenyl phosphate	affects expression	ISO	DDX49 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of DDX49 mRNA	CTD	PMID:37042841
Ddx49	Rat	troglitazone	decreases expression	ISO	Ddx49 (Mus musculus)	6480464	troglitazone results in decreased expression of DDX49 mRNA	CTD	PMID:28973697
Ddx49	Rat	tunicamycin	increases expression	ISO	DDX49 (Homo sapiens)	6480464	Tunicamycin results in increased expression of DDX49 mRNA	CTD	PMID:22378314
Ddx49	Rat	valproic acid	increases methylation	ISO	DDX49 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of DDX49 gene	CTD	PMID:29154799
Ddx49	Rat	valproic acid	increases expression	ISO	DDX49 (Homo sapiens)	6480464	Valproic Acid results in increased expression of DDX49 mRNA	CTD	PMID:23179753
Ddx49	Rat	valproic acid	affects expression	ISO	DDX49 (Homo sapiens)	6480464	Valproic Acid affects the expression of DDX49 mRNA	CTD	PMID:25979313

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddx49	Rat	positive regulation of cell growth	involved_in	ISO	DDX49 (Homo sapiens)	1624291	PMID:29618122	RGD	PMID:29618122
Ddx49	Rat	positive regulation of cell growth	involved_in	IEA	UniProtKB:Q9Y6V7 and ensembl:ENSP00000247003	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddx49	Rat	regulation of rRNA stability	involved_in	ISO	DDX49 (Homo sapiens)	1624291	PMID:29618122	RGD	PMID:29618122
Ddx49	Rat	regulation of rRNA stability	involved_in	IEA	UniProtKB:Q9Y6V7 and ensembl:ENSP00000247003	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddx49	Rat	rRNA processing	involved_in	IBA	PANTHER:PTN008601880 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddx49	Rat	nucleoplasm	located_in	ISO	DDX49 (Homo sapiens)	1624291	PMID:29618122	RGD	PMID:29618122
Ddx49	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9Y6V7 and ensembl:ENSP00000247003	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddx49	Rat	nucleus	is_active_in	IBA	PANTHER:PTN008601880 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddx49	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ddx49	Rat	ATP binding	enables	IEA	InterPro:IPR011545	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ddx49	Rat	helicase activity	enables	IEA	UniProtKB-KW:KW-0347	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ddx49	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ddx49	Rat	nucleic acid binding	enables	IEA	InterPro:IPR011545	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ddx49	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ddx49	Rat	protein binding	enables	ISO	DDX49 (Homo sapiens)	1624291	UniProtKB:O75459 more ...	RGD	PMID:32296183 and PMID:33961781
Ddx49	Rat	RNA helicase activity	enables	ISO	DDX49 (Homo sapiens)	1624291	PMID:29618122	RGD	PMID:29618122
Ddx49	Rat	RNA helicase activity	enables	IEA	UniProtKB:Q9Y6V7 and ensembl:ENSP00000247003	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddx49	Rat	RNA helicase activity	enables	IEA	EC:3.6.4.13	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Ddx49	Rat	RNA helicase activity	enables	IEA	InterPro:IPR014014	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:22658674	PMID:29618122

Ddx49
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	19,159,353 - 19,167,003 (+)	NCBI		GRCr8
mRatBN7.2	16	19,125,388 - 19,133,042 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	19,125,384 - 19,133,616 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	19,165,188 - 19,172,843 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	20,297,707 - 20,305,359 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	19,218,149 - 19,225,804 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	20,873,585 - 20,881,312 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,873,642 - 20,881,439 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	20,725,435 - 20,733,085 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	19,609,670 - 19,617,320 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	19,609,685 - 19,617,247 (+)	NCBI
Celera	16	19,315,664 - 19,323,314 (+)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

DDX49
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	18,919,715 - 18,928,630 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	18,919,705 - 18,929,189 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	19,030,524 - 19,039,439 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	18,891,494 - 18,900,436 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	18,891,493 - 18,900,436	NCBI
Celera	19	18,935,308 - 18,944,265 (+)	NCBI		Celera
Cytogenetic Map	19	p13.11	NCBI
HuRef	19	18,594,898 - 18,603,856 (+)	NCBI		HuRef
CHM1_1	19	19,030,151 - 19,039,109 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	19,055,473 - 19,064,418 (+)	NCBI		T2T-CHM13v2.0

Ddx49
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	70,745,516 - 70,755,121 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	70,745,516 - 70,755,139 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	70,292,866 - 70,302,471 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	70,292,866 - 70,302,489 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	72,816,765 - 72,826,351 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	73,221,855 - 73,231,441 (-)	NCBI		MGSCv36	mm8
Celera	8	72,849,364 - 72,858,949 (-)	NCBI		Celera
Cytogenetic Map	8	B3.3	NCBI
cM Map	8	34.15	NCBI

Ddx49
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955524	2,760,860 - 2,767,665 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955524	2,760,692 - 2,767,709 (-)	NCBI	ChiLan1.0	ChiLan1.0

DDX49
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	23,781,013 - 23,789,938 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	22,787,215 - 22,796,150 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	18,357,682 - 18,366,614 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	19,364,949 - 19,373,869 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	19,364,949 - 19,373,869 (+)	Ensembl	panpan1.1		panPan2

DDX49
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	44,187,407 - 44,195,131 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	44,187,264 - 44,195,467 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	44,102,815 - 44,110,485 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	44,674,342 - 44,682,008 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	44,674,199 - 44,681,866 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	43,911,619 - 43,919,297 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	44,321,827 - 44,329,506 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	44,597,295 - 44,604,966 (-)	NCBI		UU_Cfam_GSD_1.0

Ddx49
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	202,865,241 - 202,873,586 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936596	2,413,505 - 2,422,759 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936596	2,414,380 - 2,422,730 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DDX49
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	58,922,988 - 58,930,716 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	58,922,985 - 58,930,710 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	58,721,788 - 58,729,508 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DDX49
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	17,376,050 - 17,384,625 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	17,376,273 - 17,384,663 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	1,938,428 - 1,948,153 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ddx49
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624908	1,963,738 - 1,970,634 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624908	1,963,701 - 1,970,634 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ddx49
28 total Variants

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
16	20729712	20729713	C	T	snv	KFRS3B/Kyo (KyushuU), SDLEF7/Barth (UDEL)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	45
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000004891
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
631517	Scl9	Serum cholesterol level QTL 9	3.3		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	16	15726433	21034895	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat

RH141832

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	19,132,222 - 19,132,424 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,880,493 - 20,880,694	NCBI	Rnor6.0
Rnor_5.0	16	20,732,266 - 20,732,467	UniSTS	Rnor5.0
RGSC_v3.4	16	19,616,501 - 19,616,702	UniSTS	RGSC3.4
Celera	16	19,322,495 - 19,322,696	UniSTS
RH 3.4 Map	16	224.4	UniSTS
Cytogenetic Map	16	p14	UniSTS

RH141855

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	19,133,307 - 19,133,498 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,881,578 - 20,881,768	NCBI	Rnor6.0
Rnor_5.0	16	20,733,351 - 20,733,541	UniSTS	Rnor5.0
RGSC_v3.4	16	19,617,586 - 19,617,776	UniSTS	RGSC3.4
Celera	16	19,323,580 - 19,323,770	UniSTS
RH 3.4 Map	16	219.93	UniSTS
Cytogenetic Map	16	p14	UniSTS

AI179879

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	16	19,163,729 - 19,164,382 (+)	Marker Load Pipeline
mRatBN7.2	16	19,129,768 - 19,130,421 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,878,039 - 20,878,691	NCBI	Rnor6.0
Rnor_5.0	16	20,729,812 - 20,730,464	UniSTS	Rnor5.0
RGSC_v3.4	16	19,614,047 - 19,614,699	UniSTS	RGSC3.4
Celera	16	19,320,041 - 19,320,693	UniSTS
RH 3.4 Map	16	221.3	UniSTS
Cytogenetic Map	16	p14	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001115023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008771088	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275188	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216881	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004891 ⟹ ENSRNOP00000004891

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	19,125,384 - 19,133,616 (+)	Ensembl
Rnor_6.0 Ensembl	16	20,873,642 - 20,881,439 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112546 ⟹ ENSRNOP00000086499

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	19,125,384 - 19,133,616 (+)	Ensembl

RefSeq Acc Id:

NM_001115023 ⟹ NP_001108495

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	19,159,353 - 19,167,003 (+)	NCBI
mRatBN7.2	16	19,125,392 - 19,133,042 (+)	NCBI
Rnor_6.0	16	20,873,662 - 20,881,312 (+)	NCBI
Rnor_5.0	16	20,725,435 - 20,733,085 (+)	NCBI
RGSC_v3.4	16	19,609,670 - 19,617,320 (+)	RGD
Celera	16	19,315,664 - 19,323,314 (+)	RGD

Sequence:

show sequence

CTAGGTTCTCTACACTAGTCTGAAGCATGGCGGGGTTCGCTGAGCTCCGGCTATCGTCGTGGCTGGTGGAACAGTGTCGACAGCTGGGGTTGAAGCAGCCCACGCCGGTGCAGCTCGGGTGCATCCCG
GCCATCCTGGAAGGTCGGGACTGCTTGGGTTGTGCAAAAACAGGAAGTGGCAAGACAGCAGCCTTTGTACTTCCCATCCTGCAGAAGCTGTCTGAGGACCCTTATGGCATCTTCTGCCTGGTTTTGAC
ACCCACTAGAGAGCTGGCCTACCAGATAGCTGAGCAGTTCCGAGTGCTGGGGAAGCCTCTGGGCCTAAAGGACTGCATCATCGTTGGTGGCATGGACATGGTGACGCAGGCCCTGGAGCTCTCTCGGA
AGCCACACGTGGTTATTGCCACCCCTGGGCGCCTGGCTGACCACCTGCGCAGTTCCAACACTTTCAACATGAAGAAAATCAGATTCTTGGTGTTGGACGAGGCCGATAGGCTGCTGGAGCAGGGTTGC
ACCGACTTCACTGCAGACCTGGAGACCATCCTGTCAGCTGTTCCAGCACGCAGGCAAACCCTCCTGTTCAGTGCCACACTGACGGACACACTCAAGGAGCTGCAGGGCCTGGCTACCAACCAGCCCTT
CTTTTGGGAGGCACAGGCCACGGTTCGCATGGTGGAGCAGCTTGACCAGCGCTATCTGCTGGTGCCTGAGAAGGTGAAGGACGCCTACCTGGTTCACCTGGTCCAGACCTTCCAGGACCAGCTGGAGG
ACTGCTCCATCATCATCTTCACCAATACCTGCAAGACCTGCCAGATCCTTTGTATGATGCTTCGAAAGTTCAACTTCCCCACAGTGGCACTGCACTCCATGATGAAGCAGAAAGAGCGCTTTGCAGCC
CTGGCCAGATTCAAGTCCAGCACCTATCGGATTCTTATTGCTACTGACGTGGCCTCCAGAGGCCTGGACATCCCCACTGTGCAGGTGGTCATCAACCACAACACCCCTGGGCTCCCCAAGATCTACAT
CCATAGGGTCGGTCGCACAGCCCGTGCAGGGAGGCAGGGACAGGCCATCACACTGGTGACGCAGTACGACATCCACCTGTTGCATGCCATCGAGGAGGAGATCAAACAGCAGCTGGCTGAATTGGCAG
TGGAGGAGGCCCAGGTCCTGCAGATCCTCACACAGGTCAACGTGGTGCGCAGGGAGTGTGAAATCAAACTGGAGGCTTCGCATTTTGATGAAAAGAAGGAGATCAACAAGCGGAAACAGATGATCCTG
GAGGGGAAGGACCCGGACCTGGAGGCCAAGCGCAAAGCTGAGCTGGCCAAGATTAAGCAACAGAACCGGCGCTTCAAGGAGAAAGTGGAGCAGACGCTTCGGCAGCAGAAAGCAGGGAGCACAGGCCG
GCGGTCGCGTCCTCCCAGACCTCGTCCCCAAGAGCCAGCCAGGGCTGAGGCTCAGAACTGAGCTGTAAACCTACTGCAGGTGGCCCCTGACTTCAGTAAATGCTCTTTGAACCTGTCAGTCAGACTTG
AAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063275187 ⟹ XP_063131257

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	19,159,354 - 19,166,989 (+)	NCBI

RefSeq Acc Id:

XM_063275188 ⟹ XP_063131258

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	19,159,354 - 19,166,556 (+)	NCBI


Protein RefSeqs	NP_001108495	(Get FASTA)	NCBI Sequence Viewer
	XP_063131257	(Get FASTA)	NCBI Sequence Viewer
	XP_063131258	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58856	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004891
	ENSRNOP00000004891.5
	ENSRNOP00000086499.1

RefSeq Acc Id:

NP_001108495 ⟸ NM_001115023

- UniProtKB:

B0BNK0 (UniProtKB/TrEMBL), A0A8I6A3R8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGFAELRLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVTQALELSRKPHVVIATP
GRLADHLRSSNTFNMKKIRFLVLDEADRLLEQGCTDFTADLETILSAVPARRQTLLFSATLTDTLKELQGLATNQPFFWEAQATVRMVEQLDQRYLLVPEKVKDAYLVHLVQTFQDQLEDCSIIIFTN
TCKTCQILCMMLRKFNFPTVALHSMMKQKERFAALARFKSSTYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLLHAIEEEIKQQLAELAVEEAQVLQI
LTQVNVVRRECEIKLEASHFDEKKEINKRKQMILEGKDPDLEAKRKAELAKIKQQNRRFKEKVEQTLRQQKAGSTGRRSRPPRPRPQEPARAEAQN

hide sequence

Ensembl Acc Id:

ENSRNOP00000004891 ⟸ ENSRNOT00000004891

Ensembl Acc Id:

ENSRNOP00000086499 ⟸ ENSRNOT00000112546

RefSeq Acc Id:	XP_063131257 ⟸ XM_063275187
- Peptide Label:	isoform X1
- UniProtKB:	E9PTF0 (UniProtKB/TrEMBL), A0A8I6A3R8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131258 ⟸ XM_063275188
- Peptide Label:	isoform X2

Protein Domains

DEAD-box RNA helicase Q Helicase ATP-binding Helicase C-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PTF0-F1-model_v2	AlphaFold	E9PTF0	1-480	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700037

Promoter ID:

EPDNEW_R10561

Type:

multiple initiation site

Name:

Ddx49_1

Description:

DEAD-box helicase 49

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	20,873,658 - 20,873,718	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-11769	BioCyc
Ensembl Genes	ENSRNOG00000022368	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004891	ENTREZGENE
	ENSRNOT00000004891.7	UniProtKB/TrEMBL
	ENSRNOT00000112546.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7930984	IMAGE-MGC_LOAD
InterPro	DEAD-like_helicase	UniProtKB/TrEMBL
	DEAD_box_RNA_helicase	UniProtKB/TrEMBL
	DNA/RNA_helicase_DEAD/DEAH_N	UniProtKB/TrEMBL
	Helicase_C	UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/TrEMBL
	RNA-helicase_DEAD-box_CS	UniProtKB/TrEMBL
	RNA_helicase_DEAD_Q_motif	UniProtKB/TrEMBL
KEGG Report	rno:290660	UniProtKB/TrEMBL
MGC_CLONE	MGC:188385	IMAGE-MGC_LOAD
NCBI Gene	290660	ENTREZGENE
PANTHER	ATP-DEPENDENT RNA HELICASE RHLE-RELATED	UniProtKB/TrEMBL
	RNA HELICASE	UniProtKB/TrEMBL
Pfam	DEAD	UniProtKB/TrEMBL
	Helicase_C	UniProtKB/TrEMBL
PhenoGen	Ddx49	PhenoGen
PROSITE	DEAD_ATP_HELICASE	UniProtKB/TrEMBL
	HELICASE_ATP_BIND_1	UniProtKB/TrEMBL
	HELICASE_CTER	UniProtKB/TrEMBL
	Q_MOTIF	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000022368	RatGTEx
SMART	DEXDc	UniProtKB/TrEMBL
	HELICc	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A8I6A3R8	ENTREZGENE, UniProtKB/TrEMBL
	B0BNK0	ENTREZGENE, UniProtKB/TrEMBL
	E9PTF0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-13	Ddx49	DEAD-box helicase 49	Ddx49	DEAD (Asp-Glu-Ala-Asp) box polypeptide 49	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Ddx49	DEAD (Asp-Glu-Ala-Asp) box polypeptide 49	Ddx49_predicted	DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Ddx49_predicted	DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar