Ffar3 (free fatty acid receptor 3)

Advanced Search (OLGA)

Gene: Ffar3 (free fatty acid receptor 3) Rattus norvegicus

Analyze

Symbol:

Ffar3

Name:

free fatty acid receptor 3

RGD ID:

1311035

Description:

Enables G protein-coupled receptor activity. Involved in G protein-coupled receptor signaling pathway and cellular response to fatty acid. Predicted to be active in plasma membrane. Orthologous to several human genes including FFAR3 (free fatty acid receptor 3); INTERACTS WITH 1,2-dimethylhydrazine; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G protein-coupled receptor 41; G-protein coupled receptor 41; Gpr41; LOC365228

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FFAR3 (free fatty acid receptor 3)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ffar3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ffar3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FFAR3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FFAR3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ffar3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FFAR3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FFAR3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ffar3 (free fatty acid receptor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GPR42 (G protein-coupled receptor 42)	HGNC	EggNOG, Ensembl, Inparanoid, OrthoDB, Panther, PhylomeDB, Treefam
Homo sapiens (human):	FFAR2 (free fatty acid receptor 2)	HGNC	OrthoDB
Homo sapiens (human):	CASKIN1 (CASK interacting protein 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FFAR3 (free fatty acid receptor 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GPR42 (G protein-coupled receptor 42)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ffar3 (free fatty acid receptor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-90p23.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	si:dkey-211g8.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	95,232,804 - 95,234,144 (-)	NCBI		GRCr8
mRatBN7.2	1	86,105,388 - 86,106,728 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	86,104,920 - 86,106,849 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	91,520,010 - 91,521,350 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,986,179 - 99,987,519 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	93,278,309 - 93,279,649 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	89,302,035 - 89,304,064 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	89,302,039 - 89,303,968 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	90,457,561 - 90,459,558 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	85,911,239 - 85,912,579 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	85,961,180 - 85,991,480 (-)	NCBI
Celera	1	80,473,836 - 80,475,176 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brugada syndrome 5 (ISO)

dystonia (ISO)

essential hypertension (ISO)

hereditary spastic paraplegia 75 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4-D (ISO)

2-palmitoylglycerol (ISO)

3-hydroxybutyric acid (ISO)

6-propyl-2-thiouracil (EXP)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

D-glucose (ISO)

fructose (ISO)

glucose (ISO)

hydralazine (ISO)

linoleic acid (ISO)

propamocarb (ISO)

protein kinase inhibitor (ISO)

resveratrol (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (ISO,ISS)

cellular response to fatty acid (IBA,IDA,ISO)

G protein-coupled receptor signaling pathway (IBA,IDA,ISO)

glucose homeostasis (ISO)

inflammatory response (IEA)

mucosal immune response (ISO,ISS)

negative regulation of blood pressure (ISO,ISS)

negative regulation of insulin secretion (ISO)

neuronal action potential (ISO)

positive regulation of acute inflammatory response to non-antigenic stimulus (ISO,ISS)

positive regulation of chemokine production (ISO,ISS)

positive regulation of cytokine production involved in immune response (ISO,ISS)

positive regulation of neuronal action potential (ISO)

regulation of heart rate by chemical signal (ISO)

regulation of hormone biosynthetic process (ISO,ISS)

regulation of insulin receptor signaling pathway (ISO,ISS)

regulation of norepinephrine secretion (ISO,ISS)

regulation of peptide hormone secretion (ISO,ISS)

Cellular Component

membrane (ISO)

plasma membrane (IBA,ISO,ISS)

Molecular Function

G protein-coupled receptor activity (IBA,IDA,ISO)

lipid binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The Orphan G protein-coupled receptors GPR41 and GPR43 are activated by propionate and other short chain carboxylic acids.	Brown AJ, etal., J Biol Chem. 2003 Mar 28;278(13):11312-9. Epub 2002 Dec 19.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:14722361	PMID:18801738	PMID:19047060	PMID:21518883	PMID:22190648	PMID:22673524	PMID:23401498	PMID:23665276	PMID:24748202	PMID:26854275	PMID:28714277
PMID:34216575

Genomics

Comparative Map Data

Ffar3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	95,232,804 - 95,234,144 (-)	NCBI		GRCr8
mRatBN7.2	1	86,105,388 - 86,106,728 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	86,104,920 - 86,106,849 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	91,520,010 - 91,521,350 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,986,179 - 99,987,519 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	93,278,309 - 93,279,649 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	89,302,035 - 89,304,064 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	89,302,039 - 89,303,968 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	90,457,561 - 90,459,558 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	85,911,239 - 85,912,579 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	85,961,180 - 85,991,480 (-)	NCBI
Celera	1	80,473,836 - 80,475,176 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

FFAR3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	35,358,151 - 35,360,489 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	35,358,460 - 35,360,489 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	35,849,362 - 35,851,391 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	40,541,342 - 40,543,231 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	40,541,341 - 40,543,227	NCBI
Celera	19	32,562,940 - 32,564,843 (+)	NCBI		Celera
Cytogenetic Map	19	q13.12	NCBI
HuRef	19	32,357,984 - 32,370,911 (+)	NCBI		HuRef
CHM1_1	19	35,851,096 - 35,852,999 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	37,902,884 - 37,905,223 (+)	NCBI		T2T-CHM13v2.0

Ffar3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,553,755 - 30,555,603 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,553,755 - 30,555,603 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	30,854,330 - 30,856,178 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	30,854,330 - 30,856,178 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	31,639,349 - 31,641,197 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,563,090 - 30,564,938 (-)	NCBI		MGSCv36	mm8
Celera	7	25,437,774 - 25,439,622 (-)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	19.25	NCBI

Ffar3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955468	4,627,686 - 4,634,499 (+)	NCBI	ChiLan1.0	ChiLan1.0

FFAR3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	41,371,323 - 41,373,439 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	43,354,671 - 43,356,787 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	32,305,112 - 32,307,223 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	41,041,808 - 41,055,938 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

FFAR3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	117,251,604 - 117,257,048 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	116,654,563 - 116,656,672 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	117,851,342 - 117,853,431 (-)	NCBI		ROS_Cfam_1.0
UNSW_CanFamBas_1.0	1	117,040,133 - 117,042,241 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	118,095,603 - 118,097,714 (-)	NCBI		UU_Cfam_GSD_1.0

Ffar3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	10,693,229 - 10,696,348 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936570	949,575 - 951,442 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FFAR3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	44,844,149 - 44,845,172 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	40,332,798 - 40,339,457 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FFAR3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	30,296,020 - 30,306,671 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666073	8,085,695 - 8,087,971 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ffar3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624794	8,200,101 - 8,202,145 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ffar3
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	197
Count of miRNA genes:	133
Interacting mature miRNAs:	150
Transcripts:	ENSRNOT00000056714
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	24	38	11	15	8	1	8	1	46	27	35	2	37	7

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000056714 ⟹ ENSRNOP00000053557

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	86,104,920 - 86,106,849 (-)	Ensembl
Rnor_6.0 Ensembl	1	89,302,039 - 89,303,968 (-)	Ensembl

RefSeq Acc Id:

NM_001108912 ⟹ NP_001102382

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,232,804 - 95,234,144 (-)	NCBI
mRatBN7.2	1	86,105,388 - 86,106,728 (-)	NCBI
Rnor_6.0	1	89,302,507 - 89,303,847 (-)	NCBI
Rnor_5.0	1	90,457,561 - 90,459,558 (-)	NCBI
RGSC_v3.4	1	85,911,239 - 85,912,579 (-)	RGD
Celera	1	80,473,836 - 80,475,176 (-)	RGD

Sequence:

show sequence

GTAGGAGCTAGCTGGGTGCTGGGCGGCAGCGTGCCAGCTCTCCAACACTCTGCATCTGTGACCA
TGGACACAAGCTTCTTTCCCGGCAACCACTGGCTTTTCTTTTCAGTGGATCTGTTGGTGTTCCT
CGTGGGACTACCCCTCAACGTGATGGCCCTGGTGGTCTTCGTGAACAAGCTGCGTCGCCGCCCG
GTGGCCGTGGACTTACTTTTGCTTAACCTGACCATTTCGGACCTGCTTCTGCTCCTCTTCCTGC
CATTCCGTATAGTGGAGGCGGCCTGTGGCATGAAATGGATTCTGCCCTTCATCTTCTGCCCCCT
TTCTGGCTTCCTTTTCTTCACCACCATCTACCTCACCTCCCTCTTCCTGATGACGGTGAGCATA
GAACGTTTTCTGAGCGTAGCCTACCCACTGTGGTACAAAACCCGGCCCCGGCTGGCCCAGGCTG
GTCTGGTCAGTGGCATCTGTTGGTTCTTGGCATCAGCTCACTGTAGTGTGATTTATGTCACTGA
ATACTGGGGAAATGCAACCTACAGCCAGGGGACCAACGGAACCTGCTACCTGGAATTCCGGGAG
GACCAGCTGGCCATCCTCCTCCCCGTGCGACTGGAAATGGCTGTGGTCCTTTTCATGGTGCCCC
TGTGTATTACCAGTTACTGCTACAGTCGCCTGGTGTGGATTCTGAGCCAGGGAGCCAGCCGGCG
CAGGCGCAAGAGAGTGATGGGGCTTCTTGTAGCCACGTTGCTCATCTTCTTTGTCTGCTTCGGC
CCCTACAATATGTCCCACGTGGTGGGCTACGTGCGCGGTGAGAGTCCGACCTGGCGGAGCTACG
TGCTTCTCCTCAGCACCCTCAACTCTTGTATTGACCCTCTGGTTTTCTACTTTTCATCCTCCAA
GTTCCAAGCCGACTTTCATCAGCTCCTGTCTAGGCTGATCAGAGCTTGTGTGCCTTGGACTCAG
GAAGTCAGCTTGGAACTGAAGGTAAAGAACGGAGAAGAGCCATCCAAGGAATGTCCGAGCTAGA
GAAAAGAGTGGACCGGAGGAGGGGTGTGGAAAACACTGGCTCAGCGCTTTGGCCAGCAGAGAGC
TCTCCGGGGTCAGGAAGGAGTGGGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102382	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66522	(Get FASTA)	NCBI Sequence Viewer
	B2GV46	(Get FASTA)	NCBI Sequence Viewer
	EDM07705	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000053557.2
	ENSRNOP00055046152
	ENSRNOP00060045805
	ENSRNOP00065047258

RefSeq Acc Id:

NP_001102382 ⟸ NM_001108912

- UniProtKB:

B2GV46 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDTSFFPGNHWLFFSVDLLVFLVGLPLNVMALVVFVNKLRRRPVAVDLLLLNLTISDLLLLLFL
PFRIVEAACGMKWILPFIFCPLSGFLFFTTIYLTSLFLMTVSIERFLSVAYPLWYKTRPRLAQA
GLVSGICWFLASAHCSVIYVTEYWGNATYSQGTNGTCYLEFREDQLAILLPVRLEMAVVLFMVP
LCITSYCYSRLVWILSQGASRRRRKRVMGLLVATLLIFFVCFGPYNMSHVVGYVRGESPTWRSY
VLLLSTLNSCIDPLVFYFSSSKFQADFHQLLSRLIRACVPWTQEVSLELKVKNGEEPSKECPS

hide sequence

Ensembl Acc Id:

ENSRNOP00000053557 ⟸ ENSRNOT00000056714

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2GV46-F1-model_v2	AlphaFold	B2GV46	1-319	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311035	AgrOrtholog
BioCyc Gene	G2FUF-60068	BioCyc
Ensembl Genes	ENSRNOG00000037467	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055032423	UniProtKB/Swiss-Prot
	ENSRNOG00060031929	UniProtKB/Swiss-Prot
	ENSRNOG00065033400	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000056714.3	UniProtKB/Swiss-Prot
	ENSRNOT00055055996	UniProtKB/Swiss-Prot
	ENSRNOT00060055361	UniProtKB/Swiss-Prot
	ENSRNOT00065057417	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7134236	IMAGE-MGC_LOAD
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	GPR40-rel_orph	UniProtKB/Swiss-Prot
KEGG Report	rno:365228	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188106	IMAGE-MGC_LOAD
NCBI Gene	365228	ENTREZGENE
PANTHER	FREE FATTY ACID RECEPTOR 2-RELATED	UniProtKB/Swiss-Prot
	FREE FATTY ACID RECEPTOR 3-RELATED	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Ffar3	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	GPR40FAMILY	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000037467	RatGTEx
	ENSRNOG00055032423	RatGTEx
	ENSRNOG00060031929	RatGTEx
	ENSRNOG00065033400	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	B2GV46	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Ffar3	free fatty acid receptor 3	Gpr41_predicted	G protein-coupled receptor 41 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Gpr41_predicted	G protein-coupled receptor 41 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD