Symbol:
Kifc3
Name:
kinesin family member C3
RGD ID:
1307693
Description:
Predicted to enable identical protein binding activity and microtubule binding activity. Predicted to be involved in epithelial cell-cell adhesion; microtubule-based process; and zonula adherens maintenance. Predicted to act upstream of or within Golgi organization. Predicted to be located in several cellular components, including Golgi apparatus; centrosome; and zonula adherens. Predicted to be part of kinesin complex. Predicted to be active in microtubule cytoskeleton. Orthologous to human KIFC3 (kinesin family member C3); PARTICIPATES IN E-cadherin signaling pathway; INTERACTS WITH 17beta-estradiol; 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
kinesin-like protein KIFC3; KRP4; LOC307644; MGC156699
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 9,831,159 - 9,926,405 (+) NCBI GRCr8 mRatBN7.2 19 9,825,114 - 9,920,371 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 9,886,693 - 9,920,451 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 9,788,799 - 9,884,111 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 10,555,624 - 10,650,952 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 9,842,003 - 9,937,790 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 10,305,405 - 10,339,186 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 10,320,604 - 10,339,178 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 10,226,739 - 10,319,289 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 10,335,789 - 10,354,364 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 10,325,554 - 10,359,187 (+) NCBI Celera 19 9,789,874 - 9,808,283 (+) NCBI Celera Cytogenetic Map 19 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kifc3 Rat 1,2-dimethylhydrazine affects expression ISO Kifc3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of KIFC3 mRNA CTD PMID:22206623 Kifc3 Rat 17alpha-ethynylestradiol multiple interactions ISO Kifc3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KIFC3 mRNA CTD PMID:17942748 Kifc3 Rat 17alpha-ethynylestradiol increases expression ISO Kifc3 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of KIFC3 mRNA CTD PMID:17942748 Kifc3 Rat 17beta-estradiol multiple interactions ISO KIFC3 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of KIFC3 mRNA CTD PMID:30165855 Kifc3 Rat 17beta-estradiol decreases expression ISO KIFC3 (Homo sapiens) 6480464 Estradiol results in decreased expression of KIFC3 mRNA CTD PMID:31614463 Kifc3 Rat 17beta-estradiol increases expression ISO Kifc3 (Mus musculus) 6480464 Estradiol results in increased expression of KIFC3 mRNA CTD PMID:39298647 Kifc3 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of KIFC3 mRNA CTD PMID:32145629 Kifc3 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Kifc3 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Kifc3 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Kifc3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Kifc3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KIFC3 mRNA CTD PMID:17942748 Kifc3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KIFC3 mRNA CTD PMID:33387578 Kifc3 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Kifc3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Kifc3 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Kifc3 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of KIFC3 mRNA CTD PMID:21346803 Kifc3 Rat 2-hydroxypropanoic acid decreases expression ISO KIFC3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of KIFC3 mRNA CTD PMID:30851411 Kifc3 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Kifc3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of KIFC3 mRNA CTD PMID:20188158 Kifc3 Rat 4,4'-sulfonyldiphenol affects expression ISO Kifc3 (Mus musculus) 6480464 bisphenol S affects the expression of KIFC3 mRNA CTD PMID:39298647 Kifc3 Rat 4,4'-sulfonyldiphenol affects methylation ISO Kifc3 (Mus musculus) 6480464 bisphenol S affects the methylation of KIFC3 gene CTD PMID:31683443 Kifc3 Rat 4,4'-sulfonyldiphenol increases methylation ISO Kifc3 (Mus musculus) 6480464 bisphenol S results in increased methylation of KIFC3 exon CTD PMID:33297965 Kifc3 Rat 4-hydroxyphenyl retinamide increases expression ISO Kifc3 (Mus musculus) 6480464 Fenretinide results in increased expression of KIFC3 mRNA CTD PMID:28973697 Kifc3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of KIFC3 mRNA CTD PMID:30047161 Kifc3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of KIFC3 mRNA CTD PMID:31881176 Kifc3 Rat acrylamide decreases expression ISO KIFC3 (Homo sapiens) 6480464 Acrylamide results in decreased expression of KIFC3 mRNA CTD PMID:32763439 Kifc3 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of KIFC3 mRNA CTD PMID:25378103 Kifc3 Rat aflatoxin B1 increases methylation ISO KIFC3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of KIFC3 intron and Aflatoxin B1 results in increased methylation of KIFC3 promoter CTD PMID:30157460 Kifc3 Rat Aflatoxin B2 alpha decreases methylation ISO KIFC3 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of KIFC3 intron CTD PMID:30157460 Kifc3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KIFC3 mRNA CTD PMID:16483693 Kifc3 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of KIFC3 mRNA CTD PMID:30779732 Kifc3 Rat antirheumatic drug decreases expression ISO KIFC3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of KIFC3 mRNA CTD PMID:24449571 Kifc3 Rat arsane affects methylation ISO KIFC3 (Homo sapiens) 6480464 Arsenic affects the methylation of KIFC3 gene CTD PMID:25304211 Kifc3 Rat arsenic atom affects methylation ISO KIFC3 (Homo sapiens) 6480464 Arsenic affects the methylation of KIFC3 gene CTD PMID:25304211 Kifc3 Rat benzo[a]pyrene decreases expression ISO Kifc3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of KIFC3 mRNA CTD PMID:19770486 Kifc3 Rat benzo[a]pyrene increases methylation ISO KIFC3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KIFC3 5' UTR CTD PMID:27901495 Kifc3 Rat benzo[a]pyrene affects methylation ISO KIFC3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of KIFC3 intron and Benzo(a)pyrene affects the methylation of KIFC3 promoter CTD PMID:27901495 and PMID:30157460 Kifc3 Rat benzo[a]pyrene diol epoxide I decreases expression ISO KIFC3 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Kifc3 Rat Benzo[k]fluoranthene decreases expression ISO Kifc3 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of KIFC3 mRNA CTD PMID:26377693 Kifc3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KIFC3 mRNA CTD PMID:25181051 Kifc3 Rat bisphenol A increases expression ISO Kifc3 (Mus musculus) 6480464 bisphenol A results in increased expression of KIFC3 mRNA CTD PMID:32156529 and PMID:34585602 Kifc3 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of KIFC3 mRNA CTD PMID:19167457 Kifc3 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of KIFC3 mRNA CTD PMID:19167457 Kifc3 Rat cadmium atom decreases expression ISO KIFC3 (Homo sapiens) 6480464 Cadmium results in decreased expression of KIFC3 mRNA CTD PMID:21297354 Kifc3 Rat caffeine decreases phosphorylation ISO KIFC3 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of KIFC3 protein CTD PMID:35688186 Kifc3 Rat CGP 52608 multiple interactions ISO KIFC3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KIFC3 gene] CTD PMID:28238834 Kifc3 Rat chlorpyrifos increases expression ISO Kifc3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of KIFC3 mRNA CTD PMID:37019170 Kifc3 Rat cisplatin decreases expression ISO KIFC3 (Homo sapiens) 6480464 Cisplatin results in decreased expression of KIFC3 mRNA CTD PMID:27392435 Kifc3 Rat clothianidin increases expression ISO KIFC3 (Homo sapiens) 6480464 clothianidin results in increased expression of KIFC3 mRNA CTD PMID:31626844 Kifc3 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of KIFC3 mRNA CTD PMID:24386269 Kifc3 Rat cyclosporin A increases expression ISO KIFC3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of KIFC3 mRNA CTD PMID:25562108 Kifc3 Rat Dibutyl phosphate affects expression ISO KIFC3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of KIFC3 mRNA CTD PMID:37042841 Kifc3 Rat diquat decreases expression ISO Kifc3 (Mus musculus) 6480464 Diquat results in decreased expression of KIFC3 protein CTD PMID:36851058 Kifc3 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of KIFC3 mRNA CTD PMID:21551480 Kifc3 Rat dorsomorphin multiple interactions ISO KIFC3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KIFC3 mRNA CTD PMID:27188386 Kifc3 Rat ethanol multiple interactions EXP 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of KIFC3 mRNA CTD PMID:17347304 Kifc3 Rat ethylparaben increases expression ISO KIFC3 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of KIFC3 mRNA CTD PMID:37690743 Kifc3 Rat furan increases expression EXP 6480464 furan results in increased expression of KIFC3 mRNA CTD PMID:25539665 and PMID:26194646 Kifc3 Rat genistein increases methylation EXP 6480464 Genistein results in increased methylation of KIFC3 gene CTD PMID:28505145 Kifc3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KIFC3 mRNA CTD PMID:33387578 Kifc3 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of KIFC3 mRNA CTD PMID:21396975 Kifc3 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of KIFC3 mRNA CTD PMID:22129741 Kifc3 Rat inulin multiple interactions ISO Kifc3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of KIFC3 mRNA CTD PMID:36331819 Kifc3 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of KIFC3 mRNA CTD PMID:30047161 Kifc3 Rat methylparaben increases expression ISO KIFC3 (Homo sapiens) 6480464 methylparaben results in increased expression of KIFC3 mRNA CTD PMID:38568856 Kifc3 Rat methylphenidate decreases expression ISO Kifc3 (Mus musculus) 6480464 Methylphenidate results in decreased expression of KIFC3 mRNA CTD PMID:22470460 Kifc3 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of KIFC3 mRNA CTD PMID:22129741 Kifc3 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of KIFC3 mRNA CTD PMID:27638505 Kifc3 Rat paracetamol affects expression ISO Kifc3 (Mus musculus) 6480464 Acetaminophen affects the expression of KIFC3 mRNA CTD PMID:17562736 Kifc3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KIFC3 mRNA CTD PMID:33387578 Kifc3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Kifc3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of KIFC3 mRNA CTD PMID:36331819 Kifc3 Rat phenylmercury acetate increases expression ISO KIFC3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of KIFC3 mRNA CTD PMID:26272509 Kifc3 Rat phenylmercury acetate multiple interactions ISO KIFC3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KIFC3 mRNA CTD PMID:27188386 Kifc3 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of KIFC3 mRNA CTD PMID:30047161 Kifc3 Rat rac-lactic acid decreases expression ISO KIFC3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of KIFC3 mRNA CTD PMID:30851411 Kifc3 Rat SB 431542 multiple interactions ISO KIFC3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KIFC3 mRNA CTD PMID:27188386 Kifc3 Rat sodium arsenite increases expression ISO KIFC3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of KIFC3 mRNA CTD PMID:29301061 and PMID:38568856 Kifc3 Rat succimer multiple interactions ISO Kifc3 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of KIFC3 mRNA CTD PMID:21641980 Kifc3 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of KIFC3 mRNA CTD PMID:30047161 Kifc3 Rat sunitinib decreases expression ISO KIFC3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of KIFC3 mRNA CTD PMID:31533062 Kifc3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KIFC3 mRNA CTD PMID:23411599 Kifc3 Rat thiram increases expression ISO KIFC3 (Homo sapiens) 6480464 Thiram results in increased expression of KIFC3 mRNA CTD PMID:38568856 Kifc3 Rat titanium dioxide decreases methylation ISO KIFC3 (Homo sapiens) 6480464 titanium dioxide results in decreased methylation of KIFC3 promoter CTD PMID:34973136 Kifc3 Rat triclosan increases expression ISO KIFC3 (Homo sapiens) 6480464 Triclosan results in increased expression of KIFC3 mRNA CTD PMID:30510588 Kifc3 Rat triphenyl phosphate affects expression ISO KIFC3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of KIFC3 mRNA CTD PMID:37042841 Kifc3 Rat Triptolide increases expression ISO Kifc3 (Mus musculus) 6480464 triptolide results in increased expression of KIFC3 mRNA CTD PMID:32835833 Kifc3 Rat triptonide decreases expression ISO Kifc3 (Mus musculus) 6480464 triptonide results in decreased expression of KIFC3 mRNA CTD PMID:33045310 Kifc3 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of KIFC3 mRNA CTD PMID:23034163
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[k]fluoranthene (ISO) bisphenol A (EXP,ISO) C60 fullerene (EXP) cadmium atom (ISO) caffeine (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (ISO) clothianidin (ISO) cobalt dichloride (EXP) cyclosporin A (ISO) Dibutyl phosphate (ISO) diquat (ISO) diuron (EXP) dorsomorphin (ISO) ethanol (EXP) ethylparaben (ISO) furan (EXP) genistein (EXP) gentamycin (EXP) indole-3-methanol (EXP) inulin (ISO) methimazole (EXP) methylparaben (ISO) methylphenidate (ISO) N-nitrosodiethylamine (EXP) p-toluidine (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) pregnenolone 16alpha-carbonitrile (EXP) rac-lactic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) succimer (ISO) sulfadimethoxine (EXP) sunitinib (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triclosan (ISO) triphenyl phosphate (ISO) Triptolide (ISO) triptonide (ISO) vinclozolin (EXP)
Kifc3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 9,831,159 - 9,926,405 (+) NCBI GRCr8 mRatBN7.2 19 9,825,114 - 9,920,371 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 9,886,693 - 9,920,451 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 9,788,799 - 9,884,111 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 10,555,624 - 10,650,952 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 9,842,003 - 9,937,790 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 10,305,405 - 10,339,186 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 10,320,604 - 10,339,178 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 10,226,739 - 10,319,289 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 10,335,789 - 10,354,364 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 10,325,554 - 10,359,187 (+) NCBI Celera 19 9,789,874 - 9,808,283 (+) NCBI Celera Cytogenetic Map 19 p13 NCBI
KIFC3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 57,758,217 - 57,862,858 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 57,758,217 - 57,863,053 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 57,792,129 - 57,837,165 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 56,349,630 - 56,393,940 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 56,349,631 - 56,393,909 NCBI Celera 16 42,289,388 - 42,333,720 (-) NCBI Celera Cytogenetic Map 16 q21 NCBI HuRef 16 43,659,003 - 43,703,719 (-) NCBI HuRef CHM1_1 16 59,198,854 - 59,243,165 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 63,553,374 - 63,658,232 (-) NCBI T2T-CHM13v2.0
Kifc3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 95,826,456 - 95,929,454 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 95,826,456 - 95,929,440 (-) Ensembl GRCm39 Ensembl GRCm38 8 95,099,828 - 95,202,826 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 95,099,828 - 95,202,812 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 97,623,728 - 97,666,440 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 97,988,957 - 98,031,669 (-) NCBI MGSCv36 mm8 Celera 8 99,425,882 - 99,457,735 (-) NCBI Celera Cytogenetic Map 8 C5 NCBI cM Map 8 47.12 NCBI
Kifc3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 15,366,106 - 15,428,660 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 15,365,944 - 15,428,502 (-) NCBI ChiLan1.0 ChiLan1.0
KIFC3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 67,229,222 - 67,274,283 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 73,150,139 - 73,194,887 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 38,034,983 - 38,080,022 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 57,166,395 - 57,254,899 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 57,166,395 - 57,254,899 (-) Ensembl panpan1.1 panPan2
KIFC3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 58,700,195 - 58,734,012 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 58,663,797 - 58,733,697 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 55,325,755 - 55,363,783 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 59,234,583 - 59,272,364 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 59,204,242 - 59,272,359 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 56,066,227 - 56,104,092 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 57,073,706 - 57,111,574 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 57,966,764 - 58,004,895 (+) NCBI UU_Cfam_GSD_1.0
Kifc3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 49,795,650 - 49,830,571 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 9,757,147 - 9,831,563 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 9,758,503 - 9,821,629 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KIFC3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 19,659,616 - 19,696,073 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 19,659,987 - 19,696,104 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 17,719,961 - 17,750,864 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KIFC3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 43,689,079 - 43,735,014 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 43,687,613 - 43,730,268 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 32,384,822 - 32,490,502 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kifc3
.
Predicted Target Of
Count of predictions: 93 Count of miRNA genes: 66 Interacting mature miRNAs: 84 Transcripts: ENSRNOT00000066032 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat
AI325457
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 9,920,191 - 9,920,287 (+) MAPPER mRatBN7.2 Rnor_6.0 19 10,339,004 - 10,339,099 NCBI Rnor6.0 Rnor_5.0 19 10,319,107 - 10,319,202 UniSTS Rnor5.0 RGSC_v3.4 19 10,354,185 - 10,354,280 UniSTS RGSC3.4 Celera 19 9,808,104 - 9,808,199 UniSTS Cytogenetic Map 19 p13 UniSTS
RH130442
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 9,920,087 - 9,920,290 (+) MAPPER mRatBN7.2 Rnor_6.0 19 10,338,900 - 10,339,102 NCBI Rnor6.0 Rnor_5.0 19 10,319,003 - 10,319,205 UniSTS Rnor5.0 RGSC_v3.4 19 10,354,081 - 10,354,283 UniSTS RGSC3.4 Celera 19 9,808,000 - 9,808,202 UniSTS RH 3.4 Map 19 72.41 UniSTS Cytogenetic Map 19 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066032 ⟹ ENSRNOP00000058969
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 9,886,693 - 9,920,361 (+) Ensembl Rnor_6.0 Ensembl 19 10,320,604 - 10,339,178 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093890 ⟹ ENSRNOP00000085654
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 9,906,144 - 9,920,370 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095742 ⟹ ENSRNOP00000092397
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 9,886,693 - 9,920,361 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104498 ⟹ ENSRNOP00000080196
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 9,886,705 - 9,920,451 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107028 ⟹ ENSRNOP00000094247
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 9,908,334 - 9,920,451 (+) Ensembl
RefSeq Acc Id:
NM_001103352 ⟹ NP_001096822
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,907,826 - 9,926,405 (+) NCBI mRatBN7.2 19 9,901,787 - 9,920,371 (+) NCBI Rnor_6.0 19 10,320,604 - 10,339,183 (+) NCBI Rnor_5.0 19 10,226,739 - 10,319,289 (+) NCBI RGSC_v3.4 19 10,335,789 - 10,354,364 (+) RGD Celera 19 9,789,874 - 9,808,283 (+) RGD
Sequence:
CGAGAATGAGCATGGAGAGCCACTTCTGAGTAAGCCTCTATTCTTTCCCAGGAAATCGCCTGAGTGCAGGCCAAATTTCCTACTTTGAGGGGACTCAGGAAAAATTATTTTCTTAAGTCTTGGTTTAG
hide sequence
RefSeq Acc Id:
NM_001401191 ⟹ NP_001388120
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,831,159 - 9,926,405 (+) NCBI mRatBN7.2 19 9,825,114 - 9,920,371 (+) NCBI
RefSeq Acc Id:
XM_008772292 ⟹ XP_008770514
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,907,654 - 9,926,405 (+) NCBI mRatBN7.2 19 9,901,658 - 9,920,371 (+) NCBI Rnor_6.0 19 10,320,541 - 10,338,325 (+) NCBI
Sequence:
AGCAGTCGGGTGCTCTTAACCACTGAGCCATCTCTCCAGCCCTCTGCTGTGCTTTTGAGAGATC
hide sequence
RefSeq Acc Id:
XM_008772293 ⟹ XP_008770515
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,914,619 - 9,926,405 (+) NCBI mRatBN7.2 19 9,908,496 - 9,920,371 (+) NCBI Rnor_6.0 19 10,327,255 - 10,338,325 (+) NCBI
Sequence:
ACTAGATCTTATTTTTAGGGTGGTTGAAATGCAAGAGAAACCAATACACTGAAAGCCTGACTGGGAATCCTGTAGAACCACCAAGCTGTGCTTCTTCAGCCGGGAGGCCTGCTCCTTCTCGTCCGTTA
hide sequence
RefSeq Acc Id:
XM_017601265 ⟹ XP_017456754
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,831,253 - 9,926,405 (+) NCBI mRatBN7.2 19 9,825,208 - 9,920,371 (+) NCBI Rnor_6.0 19 10,309,817 - 10,338,325 (+) NCBI
Sequence:
CCTGCACGGCACCCAGAAGAGGTTGCTGAGCCCCGGGCCATGGTCCCCTCTCGCAGGACGTGGA
hide sequence
RefSeq Acc Id:
XM_017601266 ⟹ XP_017456755
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,831,253 - 9,925,929 (+) NCBI mRatBN7.2 19 9,825,208 - 9,920,371 (+) NCBI Rnor_6.0 19 10,309,817 - 10,339,186 (+) NCBI
Sequence:
CCTGCACGGCACCCAGAAGAGGTTGCTGAGCCCCGGGCCATGGTCCCCTCTCGCAGGACGTGGAACTTGGGAGCCACGCCTTCACTTCGGGGCCTGTGGAGAGTGGGCCGGGTCCAGGAGCCCAAGCC
hide sequence
RefSeq Acc Id:
XM_017601269 ⟹ XP_017456758
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,831,253 - 9,925,929 (+) NCBI mRatBN7.2 19 9,825,208 - 9,920,371 (+) NCBI Rnor_6.0 19 10,309,817 - 10,339,183 (+) NCBI
Sequence:
CCTGCACGGCACCCAGAAGAGGTTGCTGAGCCCCGGGCCATGGTCCCCTCTCGCAGGACGTGGA
hide sequence
RefSeq Acc Id:
XM_017601270 ⟹ XP_017456759
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,831,253 - 9,926,405 (+) NCBI mRatBN7.2 19 9,825,208 - 9,920,371 (+) NCBI Rnor_6.0 19 10,309,817 - 10,339,186 (+) NCBI
Sequence:
CCTGCACGGCACCCAGAAGAGGTTGCTGAGCCCCGGGCCATGGTCCCCTCTCGCAGGACGTGGAACTTGGGAGCCACGCCTTCACTTCGGGGCCTGTGGAGAGTGGGCCGGGTCCAGGAGCCCAAGCC
hide sequence
RefSeq Acc Id:
XM_039097698 ⟹ XP_038953626
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,831,253 - 9,926,405 (+) NCBI mRatBN7.2 19 9,825,208 - 9,920,371 (+) NCBI
RefSeq Acc Id:
XM_039097699 ⟹ XP_038953627
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,831,253 - 9,926,405 (+) NCBI mRatBN7.2 19 9,825,208 - 9,920,371 (+) NCBI
RefSeq Acc Id:
XM_039097700 ⟹ XP_038953628
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,897,451 - 9,926,405 (+) NCBI mRatBN7.2 19 9,891,414 - 9,920,371 (+) NCBI
RefSeq Acc Id:
XM_039097701 ⟹ XP_038953629
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,892,727 - 9,926,405 (+) NCBI mRatBN7.2 19 9,891,254 - 9,920,371 (+) NCBI
RefSeq Acc Id:
XM_063277982 ⟹ XP_063134052
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,831,253 - 9,926,405 (+) NCBI
RefSeq Acc Id:
XM_063277983 ⟹ XP_063134053
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,897,451 - 9,926,405 (+) NCBI
RefSeq Acc Id:
XM_063277984 ⟹ XP_063134054
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,914,619 - 9,926,405 (+) NCBI
RefSeq Acc Id:
XR_005496646
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,831,253 - 9,925,929 (+) NCBI mRatBN7.2 19 9,825,208 - 9,920,371 (+) NCBI
RefSeq Acc Id:
XR_005496647
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,831,253 - 9,925,929 (+) NCBI mRatBN7.2 19 9,825,208 - 9,920,371 (+) NCBI
RefSeq Acc Id:
NP_001096822 ⟸ NM_001103352
- Peptide Label:
isoform 2
- UniProtKB:
A1A5P4 (UniProtKB/TrEMBL), A0A8I6A4I8 (UniProtKB/TrEMBL)
- Sequence:
MSQLQEELVVLRERLALHDSDRQATTTQLQNQVENLKEKLISQAQEVSRLRSELGGTDVEKHRDRLMVENEQLRQELRRCEAELQELRAQPVVPCQGCEHSQESTQLRDRLSQLQLEVAENKGMLSEL
hide sequence
RefSeq Acc Id:
XP_008770514 ⟸ XM_008772292
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I6AKJ1 (UniProtKB/TrEMBL)
- Sequence:
MSQLQEELVVLRERLALHDSDRQATTTQLQNQVENLKEKLISQAQEVSRLRSELGGTDVEKHRDRLMVENEQLRQELRRCEAELQELRAQPVVPCQGCEHSQESTQLRDRLSQLQLEVAENKGMLSEL
hide sequence
RefSeq Acc Id:
XP_008770515 ⟸ XM_008772293
- Peptide Label:
isoform X10
- UniProtKB:
A0A8I6AKJ1 (UniProtKB/TrEMBL)
- Sequence:
MLHTKSDRFEVALQTSDFAPRTPVENLKEKLISQAQEVSRLRSELGGTDVEKHRDRLMVENEQL
hide sequence
RefSeq Acc Id:
XP_017456755 ⟸ XM_017601266
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6ADV7 (UniProtKB/TrEMBL)
- Sequence:
MVPSRRTWNLGATPSLRGLWRVGRVQEPKPGMARPAPASPAARPFPHTGQGRLRTGRGKDTLPGGEEDSTSRSAARPSLAQCRALSVDWPGPRSPHRLYLTVQQALQDKGCESKSQGTKEDRLPKRQA
hide sequence
RefSeq Acc Id:
XP_017456759 ⟸ XM_017601270
- Peptide Label:
isoform X7
- UniProtKB:
F7EXA8 (UniProtKB/TrEMBL)
- Sequence:
MVPSRRTWNLGATPSLRGLWRVGRVQEPKPGMARPAPASPAARPFPHTGQGRLRTGRGKDTLPGGEEDSTSRSAARPSLAQCRALSVDWPGPRSPHRLYLTVQVENLKEKLISQAQEVSRLRSELGGT
hide sequence
RefSeq Acc Id:
XP_017456758 ⟸ XM_017601269
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6ADV7 (UniProtKB/TrEMBL)
- Sequence:
MVPSRRTWNLGATPSLRGLWRVGRVQEPKPGMARPAPASPAARPFPHTGQGRLRTGRGKDTLPG
hide sequence
RefSeq Acc Id:
XP_017456754 ⟸ XM_017601265
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6ADV7 (UniProtKB/TrEMBL)
- Sequence:
MVPSRRTWNLGATPSLRGLWRVGRVQEPKPGMARPAPASPAARPFPHTGQGRLRTGRGKDTLPGGEEDSTSRSAARPSLAQCRALSVDWPGPRSPHRLYLTVQALQDKGCESKSQGTKEDRLPKRQAP
hide sequence
Ensembl Acc Id:
ENSRNOP00000058969 ⟸ ENSRNOT00000066032
RefSeq Acc Id:
XP_038953626 ⟸ XM_039097698
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6ADV7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953627 ⟸ XM_039097699
- Peptide Label:
isoform X6
- UniProtKB:
F7EXA8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953629 ⟸ XM_039097701
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6AKJ1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953628 ⟸ XM_039097700
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6AKJ1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000094247 ⟸ ENSRNOT00000107028
Ensembl Acc Id:
ENSRNOP00000085654 ⟸ ENSRNOT00000093890
Ensembl Acc Id:
ENSRNOP00000092397 ⟸ ENSRNOT00000095742
Ensembl Acc Id:
ENSRNOP00000080196 ⟸ ENSRNOT00000104498
RefSeq Acc Id:
NP_001388120 ⟸ NM_001401191
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I6ADV7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134052 ⟸ XM_063277982
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6ADV7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134053 ⟸ XM_063277983
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I6AKJ1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134054 ⟸ XM_063277984
- Peptide Label:
isoform X11
- UniProtKB:
A0A8I6A4I8 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Kifc3
kinesin family member C3
Kifc3_predicted
kinesin family member C3 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Kifc3_predicted
kinesin family member C3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
