Symbol:
Enah
Name:
ENAH, actin regulator
RGD ID:
1307666
Description:
Predicted to enable SH3 domain binding activity; WW domain binding activity; and profilin binding activity. Involved in postsynaptic cytoskeleton organization. Is active in GABA-ergic synapse and postsynapse. Human ortholog(s) of this gene implicated in stomach cancer. Orthologous to human ENAH (ENAH actin regulator); PARTICIPATES IN E-cadherin signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 3,3',4,4',5-pentachlorobiphenyl; cadmium dichloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
enabled homolog; enabled homolog (Drosophila); LOC360891
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ENAH (ENAH actin regulator) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Enah (ENAH actin regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Enah (ENAH actin regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ENAH (ENAH actin regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ENAH (ENAH actin regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Enah (ENAH actin regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ENAH (ENAH actin regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ENAH (ENAH actin regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Enah (ENAH actin regulator) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
FCAMR (Fc alpha and mu receptor) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ENAH (ENAH actin regulator)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Enah (ENAH actin regulator)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
enah (ENAH actin regulator)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
ena
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
unc-34
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
enah
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 96,149,437 - 96,269,841 (-) NCBI GRCr8 mRatBN7.2 13 93,617,747 - 93,738,119 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 93,626,944 - 93,740,955 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 96,123,053 - 96,243,421 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 97,522,946 - 97,643,298 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 94,705,126 - 94,825,478 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 100,297,421 - 100,415,335 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 100,300,054 - 100,414,226 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 105,277,627 - 105,392,796 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 97,919,690 - 98,025,153 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 98,108,627 - 98,214,089 (-) NCBI Celera 13 93,161,661 - 93,266,823 (-) NCBI Celera Cytogenetic Map 13 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Enah Rat 1,2-dimethylhydrazine increases expression ISO Enah (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ENAH mRNA CTD PMID:22206623 Enah Rat 17alpha-ethynylestradiol multiple interactions ISO Enah (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ENAH mRNA CTD PMID:17942748 Enah Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ENAH mRNA CTD PMID:29097150 Enah Rat 17beta-estradiol affects expression ISO ENAH (Homo sapiens) 6480464 Estradiol affects the expression of ENAH mRNA CTD PMID:22574217 Enah Rat 17beta-estradiol multiple interactions ISO ENAH (Homo sapiens) 6480464 Estradiol promotes the reaction [ENAH protein binds to ESR1 protein] CTD PMID:27156127 Enah Rat 17beta-estradiol increases expression ISO Enah (Mus musculus) 6480464 Estradiol results in increased expression of ENAH mRNA CTD PMID:19484750 Enah Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Enah (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Enah Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Enah (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ENAH mRNA CTD PMID:17942748 Enah Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Enah (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ENAH mRNA CTD PMID:19770486 Enah Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Enah (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Enah Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Enah Rat 4,4'-diaminodiphenylmethane decreases expression ISO Enah (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of ENAH mRNA CTD PMID:18648102 Enah Rat 4-hydroxyphenyl retinamide increases expression ISO Enah (Mus musculus) 6480464 Fenretinide results in increased expression of ENAH mRNA CTD PMID:28973697 Enah Rat 5-fluorouracil affects response to substance ISO ENAH (Homo sapiens) 6480464 ENAH protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Enah Rat aflatoxin B1 decreases expression ISO Enah (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of ENAH mRNA CTD PMID:19770486 Enah Rat aflatoxin B1 increases methylation ISO ENAH (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ENAH intron CTD PMID:30157460 Enah Rat all-trans-retinoic acid decreases expression ISO ENAH (Homo sapiens) 6480464 Tretinoin results in decreased expression of ENAH mRNA CTD PMID:21934132 and PMID:33167477 Enah Rat aristolochic acid A decreases expression ISO ENAH (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ENAH mRNA CTD PMID:33212167 Enah Rat arsenite(3-) multiple interactions ISO ENAH (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ENAH mRNA] CTD PMID:32406909 Enah Rat arsenous acid increases expression ISO ENAH (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ENAH mRNA CTD PMID:22521957 Enah Rat benzo[a]pyrene decreases expression ISO ENAH (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ENAH mRNA CTD PMID:20064835 Enah Rat benzo[a]pyrene decreases methylation ISO Enah (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of ENAH intron CTD PMID:27901495 Enah Rat benzo[a]pyrene decreases expression ISO Enah (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ENAH mRNA CTD PMID:19770486 Enah Rat benzo[a]pyrene diol epoxide I decreases expression ISO ENAH (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Enah Rat bisphenol A increases expression ISO ENAH (Homo sapiens) 6480464 bisphenol A analog results in increased expression of ENAH mRNA CTD PMID:32387340 Enah Rat bisphenol AF increases expression ISO ENAH (Homo sapiens) 6480464 bisphenol AF results in increased expression of ENAH protein CTD PMID:34186270 Enah Rat bisphenol F increases expression ISO ENAH (Homo sapiens) 6480464 bisphenol F results in increased expression of ENAH protein CTD PMID:34186270 Enah Rat butanal decreases expression ISO ENAH (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ENAH mRNA CTD PMID:26079696 Enah Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ENAH mRNA CTD PMID:33453195 Enah Rat cadmium dichloride increases expression ISO ENAH (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ENAH mRNA CTD PMID:38382870 Enah Rat calciol increases expression ISO Enah (Mus musculus) 6480464 Cholecalciferol results in increased expression of ENAH mRNA CTD PMID:17170073 Enah Rat carbon nanotube multiple interactions ISO ENAH (Homo sapiens) 6480464 [Nanotubes and Carbon co-treated with calfactant] results in increased expression of ENAH protein CTD PMID:23026733 Enah Rat CGP 52608 multiple interactions ISO ENAH (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ENAH gene] CTD PMID:28238834 Enah Rat chlorpyrifos increases expression ISO Enah (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ENAH mRNA CTD PMID:37019170 Enah Rat choline multiple interactions ISO Enah (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ENAH mRNA CTD PMID:20938992 Enah Rat cisplatin multiple interactions ISO ENAH (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of ENAH mRNA CTD PMID:27392435 Enah Rat cisplatin decreases expression ISO ENAH (Homo sapiens) 6480464 Cisplatin results in decreased expression of ENAH mRNA CTD PMID:27392435 Enah Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of ENAH mRNA CTD PMID:17898221 Enah Rat copper atom multiple interactions ISO Enah (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of ENAH mRNA CTD PMID:15467011 Enah Rat copper(0) multiple interactions ISO Enah (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of ENAH mRNA CTD PMID:15467011 Enah Rat copper(II) sulfate increases expression ISO ENAH (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ENAH mRNA CTD PMID:19549813 Enah Rat cyclosporin A decreases expression ISO ENAH (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ENAH mRNA CTD PMID:27989131 Enah Rat diarsenic trioxide increases expression ISO ENAH (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ENAH mRNA CTD PMID:22521957 Enah Rat dibutyl phthalate increases expression ISO Enah (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ENAH mRNA CTD PMID:21266533 Enah Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ENAH mRNA CTD PMID:21266533 Enah Rat dorsomorphin multiple interactions ISO ENAH (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Enah Rat ethanol affects splicing ISO Enah (Mus musculus) 6480464 Ethanol affects the splicing of ENAH mRNA CTD PMID:30319688 Enah Rat ethanol increases expression ISO Enah (Mus musculus) 6480464 Ethanol results in increased expression of ENAH mRNA CTD PMID:30319688 Enah Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of ENAH mRNA CTD PMID:30307764 Enah Rat folic acid multiple interactions ISO Enah (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ENAH mRNA CTD PMID:20938992 Enah Rat FR900359 increases phosphorylation ISO ENAH (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ENAH protein CTD PMID:37730182 Enah Rat furan increases expression EXP 6480464 furan results in increased expression of ENAH mRNA CTD PMID:27387713 Enah Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ENAH mRNA CTD PMID:33387578 Enah Rat inulin multiple interactions ISO Enah (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ENAH mRNA CTD PMID:36331819 Enah Rat ivermectin decreases expression ISO ENAH (Homo sapiens) 6480464 Ivermectin results in decreased expression of ENAH protein CTD PMID:32959892 Enah Rat L-methionine multiple interactions ISO Enah (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ENAH mRNA CTD PMID:20938992 Enah Rat leflunomide increases expression ISO ENAH (Homo sapiens) 6480464 leflunomide results in increased expression of ENAH mRNA CTD PMID:28988120 Enah Rat lipopolysaccharide multiple interactions ISO ENAH (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of ENAH mRNA CTD PMID:35811015 Enah Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ENAH gene CTD PMID:35440735 Enah Rat microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of ENAH mRNA CTD PMID:36657700 Enah Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of ENAH mRNA CTD PMID:25729387 Enah Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of ENAH mRNA CTD PMID:25729387 Enah Rat oxybenzone decreases expression ISO ENAH (Homo sapiens) 6480464 oxybenzone results in decreased expression of ENAH mRNA CTD PMID:39343157 Enah Rat paracetamol decreases expression ISO ENAH (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ENAH mRNA CTD PMID:21420995 Enah Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ENAH mRNA CTD PMID:33387578 Enah Rat pentanal decreases expression ISO ENAH (Homo sapiens) 6480464 pentanal results in decreased expression of ENAH mRNA CTD PMID:26079696 Enah Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Enah (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ENAH mRNA CTD PMID:36331819 Enah Rat phenobarbital affects expression ISO Enah (Mus musculus) 6480464 Phenobarbital affects the expression of ENAH mRNA CTD PMID:23091169 Enah Rat phenylmercury acetate decreases expression ISO ENAH (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of ENAH mRNA CTD PMID:26272509 Enah Rat phenylmercury acetate multiple interactions ISO ENAH (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ENAH mRNA CTD PMID:27188386 Enah Rat potassium chromate decreases expression ISO ENAH (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ENAH mRNA CTD PMID:22714537 Enah Rat quercetin decreases expression ISO ENAH (Homo sapiens) 6480464 Quercetin results in decreased expression of ENAH mRNA CTD PMID:21632981 Enah Rat resveratrol multiple interactions ISO ENAH (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of ENAH mRNA CTD PMID:23557933 Enah Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO ENAH (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of ENAH mRNA CTD PMID:35811015 Enah Rat SB 431542 multiple interactions ISO ENAH (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Enah Rat silver atom decreases expression ISO Enah (Mus musculus) 6480464 Silver results in decreased expression of ENAH mRNA CTD PMID:27131904 Enah Rat silver(0) decreases expression ISO Enah (Mus musculus) 6480464 Silver results in decreased expression of ENAH mRNA CTD PMID:27131904 Enah Rat sodium arsenate increases expression ISO Enah (Mus musculus) 6480464 sodium arsenate results in increased expression of ENAH mRNA CTD PMID:21795629 Enah Rat Soman increases expression EXP 6480464 Soman results in increased expression of ENAH mRNA CTD PMID:19281266 Enah Rat tetrachloromethane increases expression ISO Enah (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of ENAH mRNA CTD PMID:17484886 Enah Rat thiram increases expression ISO ENAH (Homo sapiens) 6480464 Thiram results in increased expression of ENAH mRNA CTD PMID:38568856 Enah Rat titanium dioxide decreases expression ISO Enah (Mus musculus) 6480464 titanium dioxide results in decreased expression of ENAH mRNA CTD PMID:23557971 Enah Rat titanium dioxide decreases methylation ISO Enah (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ENAH promoter CTD PMID:35295148 Enah Rat titanium dioxide increases methylation ISO Enah (Mus musculus) 6480464 titanium dioxide results in increased methylation of ENAH gene CTD PMID:35295148 Enah Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of ENAH mRNA CTD PMID:25729387 Enah Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of ENAH mRNA CTD PMID:25729387 Enah Rat trichostatin A decreases expression ISO ENAH (Homo sapiens) 6480464 trichostatin A results in decreased expression of ENAH mRNA CTD PMID:22723015 and PMID:26272509 Enah Rat trichostatin A multiple interactions ISO ENAH (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ENAH mRNA CTD PMID:27188386 Enah Rat triptonide decreases expression ISO Enah (Mus musculus) 6480464 triptonide results in decreased expression of ENAH mRNA CTD PMID:33045310 Enah Rat valproic acid affects expression ISO Enah (Mus musculus) 6480464 Valproic Acid affects the expression of ENAH mRNA CTD PMID:17963808 Enah Rat valproic acid decreases expression ISO Enah (Mus musculus) 6480464 Valproic Acid results in decreased expression of ENAH mRNA CTD PMID:19136453 and PMID:21427059 Enah Rat valproic acid affects expression ISO ENAH (Homo sapiens) 6480464 Valproic Acid affects the expression of ENAH mRNA CTD PMID:25979313 Enah Rat valproic acid decreases expression ISO ENAH (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ENAH mRNA CTD PMID:23179753 more ... Enah Rat valproic acid multiple interactions ISO ENAH (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ENAH mRNA CTD PMID:27188386
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (ISO) bisphenol AF (ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (EXP,ISO) calciol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) dorsomorphin (ISO) ethanol (ISO) fenvalerate (EXP) folic acid (ISO) FR900359 (ISO) furan (EXP) gentamycin (EXP) inulin (ISO) ivermectin (ISO) L-methionine (ISO) leflunomide (ISO) lipopolysaccharide (ISO) methoxychlor (EXP) microcystin-LR (EXP) oxaliplatin (EXP) oxybenzone (ISO) paracetamol (EXP,ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) potassium chromate (ISO) quercetin (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) Soman (EXP) tetrachloromethane (ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO)
1.
The state of the actin cytoskeleton determines its association with gephyrin: role of ena/VASP family members.
Bausen M, etal., Mol Cell Neurosci. 2006 Feb;31(2):376-86. doi: 10.1016/j.mcn.2005.11.004. Epub 2006 Jan 11.
2.
Molecular recognition of the Tes LIM2-3 domains by the actin-related protein Arp7A.
Boeda B, etal., J Biol Chem. 2011 Apr 1;286(13):11543-54. doi: 10.1074/jbc.M110.171264. Epub 2011 Jan 29.
3.
Enabled homolog (ENAH) regulated by RNA binding protein splicing factor 3b subunit 4 (SF3B4) exacerbates the proliferation, invasion and migration of hepatocellular carcinoma cells via Notch signaling pathway.
Deng G, etal., Bioengineered. 2022 Feb;13(2):2194-2206. doi: 10.1080/21655979.2021.2023983.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
TES functions as a Mena-dependent tumor suppressor in gastric cancer carcinogenesis and metastasis.
Wang DD, etal., Cancer Commun (Lond). 2019 Feb 6;39(1):3. doi: 10.1186/s40880-019-0347-y.
Enah Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 96,149,437 - 96,269,841 (-) NCBI GRCr8 mRatBN7.2 13 93,617,747 - 93,738,119 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 93,626,944 - 93,740,955 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 96,123,053 - 96,243,421 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 97,522,946 - 97,643,298 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 94,705,126 - 94,825,478 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 100,297,421 - 100,415,335 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 100,300,054 - 100,414,226 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 105,277,627 - 105,392,796 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 97,919,690 - 98,025,153 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 98,108,627 - 98,214,089 (-) NCBI Celera 13 93,161,661 - 93,266,823 (-) NCBI Celera Cytogenetic Map 13 q26 NCBI
ENAH Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 225,486,829 - 225,653,878 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 225,486,765 - 225,653,142 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 225,674,531 - 225,840,825 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 223,741,157 - 223,907,468 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 221,981,268 - 222,147,580 NCBI Celera 1 198,865,129 - 199,031,134 (-) NCBI Celera Cytogenetic Map 1 q42.12 NCBI HuRef 1 196,193,432 - 196,359,068 (-) NCBI HuRef CHM1_1 1 226,946,878 - 227,113,178 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 224,675,098 - 224,841,848 (-) NCBI T2T-CHM13v2.0
Enah Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 181,723,949 - 181,848,132 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 181,723,949 - 181,847,555 (-) Ensembl GRCm39 Ensembl GRCm38 1 181,896,384 - 182,027,556 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 181,896,384 - 182,019,990 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 183,834,576 - 183,950,111 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 183,742,188 - 183,856,336 (-) NCBI MGSCv36 mm8 Celera 1 188,957,160 - 189,017,504 (-) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 84.93 NCBI
Enah Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955520 308,070 - 371,922 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955520 310,482 - 374,800 (+) NCBI ChiLan1.0 ChiLan1.0
ENAH Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 23,885,156 - 24,045,244 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 23,834,054 - 23,996,296 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 200,956,988 - 201,113,242 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 205,963,067 - 206,115,672 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 205,963,247 - 206,115,672 (-) Ensembl panpan1.1 panPan2
ENAH Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 39,105,024 - 39,250,126 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 39,105,039 - 39,247,595 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 38,587,078 - 38,732,144 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 38,938,972 - 39,084,406 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 38,938,017 - 39,084,402 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 38,778,555 - 38,923,489 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 38,786,801 - 38,932,026 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 39,056,619 - 39,201,943 (+) NCBI UU_Cfam_GSD_1.0
Enah Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 52,269,764 - 52,414,557 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936526 2,332,664 - 2,477,833 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936526 2,332,344 - 2,477,827 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ENAH Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 13,446,426 - 13,609,303 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 13,439,772 - 13,609,347 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 16,217,878 - 16,292,117 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ENAH Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 4,134,853 - 4,264,392 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 4,134,852 - 4,260,928 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 4,119,116 - 4,284,897 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Enah
.
Predicted Target Of
Count of predictions: 134 Count of miRNA genes: 102 Interacting mature miRNAs: 115 Transcripts: ENSRNOT00000039974 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
RH134481
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 93,627,001 - 93,627,184 (+) MAPPER mRatBN7.2 Rnor_6.0 13 100,300,112 - 100,300,294 NCBI Rnor6.0 Rnor_5.0 13 105,280,318 - 105,280,500 UniSTS Rnor5.0 RGSC_v3.4 13 97,919,760 - 97,919,942 UniSTS RGSC3.4 Celera 13 93,161,731 - 93,161,913 UniSTS RH 3.4 Map 13 632.2 UniSTS Cytogenetic Map 13 q26 UniSTS
BE112154
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 93,685,758 - 93,685,923 (+) MAPPER mRatBN7.2 Rnor_6.0 13 100,358,853 - 100,359,017 NCBI Rnor6.0 Rnor_5.0 13 105,339,147 - 105,339,311 UniSTS Rnor5.0 RGSC_v3.4 13 97,978,672 - 97,978,836 UniSTS RGSC3.4 Celera 13 93,220,263 - 93,220,427 UniSTS RH 3.4 Map 13 629.9 UniSTS Cytogenetic Map 13 q26 UniSTS
BF410035
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 93,645,960 - 93,646,123 (+) MAPPER mRatBN7.2 Rnor_6.0 13 100,319,074 - 100,319,236 NCBI Rnor6.0 Rnor_5.0 13 105,299,084 - 105,299,246 UniSTS Rnor5.0 RGSC_v3.4 13 97,938,932 - 97,939,094 UniSTS RGSC3.4 Celera 13 93,180,652 - 93,180,814 UniSTS RH 3.4 Map 13 631.2 UniSTS Cytogenetic Map 13 q26 UniSTS
BF405107
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 93,690,005 - 93,690,135 (+) MAPPER mRatBN7.2 Rnor_6.0 13 100,363,100 - 100,363,229 NCBI Rnor6.0 Rnor_5.0 13 105,343,394 - 105,343,523 UniSTS Rnor5.0 RGSC_v3.4 13 97,982,919 - 97,983,048 UniSTS RGSC3.4 Celera 13 93,224,510 - 93,224,639 UniSTS RH 3.4 Map 13 631.8 UniSTS Cytogenetic Map 13 q26 UniSTS
AU047203
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 93,727,868 - 93,727,996 (+) MAPPER mRatBN7.2 Rnor_6.0 13 100,400,877 - 100,401,004 NCBI Rnor6.0 Rnor_5.0 13 105,381,171 - 105,381,298 UniSTS Rnor5.0 RGSC_v3.4 13 98,020,691 - 98,020,818 UniSTS RGSC3.4 Celera 13 93,262,361 - 93,262,488 UniSTS Cytogenetic Map 13 q26 UniSTS
Enah
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 93,640,009 - 93,641,156 (+) MAPPER mRatBN7.2 Rnor_6.0 13 100,313,117 - 100,314,263 NCBI Rnor6.0 Rnor_5.0 13 105,293,000 - 105,294,146 UniSTS Rnor5.0 RGSC_v3.4 13 97,933,114 - 97,934,260 UniSTS RGSC3.4 Celera 13 93,174,705 - 93,175,851 UniSTS Cytogenetic Map 13 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039974 ⟹ ENSRNOP00000050866
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 93,626,944 - 93,732,335 (-) Ensembl Rnor_6.0 Ensembl 13 100,300,054 - 100,405,339 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085188 ⟹ ENSRNOP00000073827
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 93,626,944 - 93,732,335 (-) Ensembl Rnor_6.0 Ensembl 13 100,300,199 - 100,414,226 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097600 ⟹ ENSRNOP00000081404
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 93,626,944 - 93,740,955 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098544 ⟹ ENSRNOP00000081655
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 93,626,944 - 93,740,955 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109962 ⟹ ENSRNOP00000076584
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 93,626,944 - 93,740,955 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114419 ⟹ ENSRNOP00000079564
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 93,626,944 - 93,681,785 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114860 ⟹ ENSRNOP00000097849
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 93,626,944 - 93,740,955 (-) Ensembl
RefSeq Acc Id:
NM_001012150 ⟹ NP_001012150
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,437 - 96,264,080 (-) NCBI mRatBN7.2 13 93,617,747 - 93,732,403 (-) NCBI Rnor_6.0 13 100,300,042 - 100,405,339 (-) NCBI Rnor_5.0 13 105,277,627 - 105,392,796 (-) NCBI RGSC_v3.4 13 97,919,690 - 98,025,153 (-) RGD Celera 13 93,161,661 - 93,266,823 (-) RGD
Sequence:
GTCACTTGAACAAAAACCAGCAGCATCACTACTACAAGAATGGATGTAGAATTTGTATCTTACTCGATACCAAAGCTCAGAAGTAGCCAGAGCCTCAGAATCAGTGAACAGAGTATCTGTCAGGCAAG
hide sequence
RefSeq Acc Id:
NM_001401377 ⟹ NP_001388306
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,437 - 96,269,796 (-) NCBI mRatBN7.2 13 93,617,747 - 93,738,119 (-) NCBI
RefSeq Acc Id:
NM_001415736 ⟹ NP_001402665
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,437 - 96,269,796 (-) NCBI mRatBN7.2 13 93,617,747 - 93,738,119 (-) NCBI
RefSeq Acc Id:
XM_039090926 ⟹ XP_038946854
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,269,127 (-) NCBI mRatBN7.2 13 93,617,751 - 93,732,334 (-) NCBI
RefSeq Acc Id:
XM_039090933 ⟹ XP_038946861
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,180,340 (-) NCBI mRatBN7.2 13 93,617,751 - 93,648,652 (-) NCBI
RefSeq Acc Id:
XM_063272493 ⟹ XP_063128563
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,269,127 (-) NCBI
RefSeq Acc Id:
XM_063272494 ⟹ XP_063128564
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,269,841 (-) NCBI
RefSeq Acc Id:
XM_063272495 ⟹ XP_063128565
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,182,942 (-) NCBI
RefSeq Acc Id:
XM_063272496 ⟹ XP_063128566
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,269,127 (-) NCBI
RefSeq Acc Id:
XM_063272497 ⟹ XP_063128567
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,269,841 (-) NCBI
RefSeq Acc Id:
XM_063272498 ⟹ XP_063128568
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,269,127 (-) NCBI
RefSeq Acc Id:
XM_063272499 ⟹ XP_063128569
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,269,127 (-) NCBI
RefSeq Acc Id:
XM_063272500 ⟹ XP_063128570
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,269,841 (-) NCBI
RefSeq Acc Id:
XM_063272502 ⟹ XP_063128572
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,269,841 (-) NCBI
RefSeq Acc Id:
XM_063272503 ⟹ XP_063128573
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,269,841 (-) NCBI
RefSeq Acc Id:
XM_063272504 ⟹ XP_063128574
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,180,339 (-) NCBI
RefSeq Acc Id:
XM_063272505 ⟹ XP_063128575
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,180,352 (-) NCBI
RefSeq Acc Id:
XM_063272506 ⟹ XP_063128576
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 96,149,441 - 96,269,127 (-) NCBI
RefSeq Acc Id:
NP_001012150 ⟸ NM_001012150
- Peptide Label:
isoform 2
- UniProtKB:
Q5XHX3 (UniProtKB/TrEMBL), A6JGK5 (UniProtKB/TrEMBL)
- Sequence:
MDVEFVSYSIPKLRSSQSLRISEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000073827 ⟸ ENSRNOT00000085188
Ensembl Acc Id:
ENSRNOP00000050866 ⟸ ENSRNOT00000039974
RefSeq Acc Id:
XP_038946854 ⟸ XM_039090926
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6G5W6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946861 ⟸ XM_039090933
- Peptide Label:
isoform X12
Ensembl Acc Id:
ENSRNOP00000079564 ⟸ ENSRNOT00000114419
Ensembl Acc Id:
ENSRNOP00000081655 ⟸ ENSRNOT00000098544
Ensembl Acc Id:
ENSRNOP00000076584 ⟸ ENSRNOT00000109962
Ensembl Acc Id:
ENSRNOP00000097849 ⟸ ENSRNOT00000114860
Ensembl Acc Id:
ENSRNOP00000081404 ⟸ ENSRNOT00000097600
RefSeq Acc Id:
NP_001402665 ⟸ NM_001415736
- Peptide Label:
isoform 3
- UniProtKB:
A0A8I6G5W6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001388306 ⟸ NM_001401377
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I5ZT50 (UniProtKB/TrEMBL), A6JGK6 (UniProtKB/TrEMBL), A0A8I6G5W6 (UniProtKB/TrEMBL), A0A8I6GMP8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128573 ⟸ XM_063272503
- Peptide Label:
isoform X11
- UniProtKB:
A6JGK5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128572 ⟸ XM_063272502
- Peptide Label:
isoform X10
- UniProtKB:
A0A8I5ZND4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128570 ⟸ XM_063272500
- Peptide Label:
isoform X9
- UniProtKB:
A6JGK5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128567 ⟸ XM_063272497
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I5ZND4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128564 ⟸ XM_063272494
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5Y4S4 (UniProtKB/TrEMBL), A0A8I6G5W6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128569 ⟸ XM_063272499
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I5ZND4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128568 ⟸ XM_063272498
- Peptide Label:
isoform X7
- UniProtKB:
A0A0G2K6I4 (UniProtKB/TrEMBL), A6JGK5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128566 ⟸ XM_063272496
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I5ZND4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128563 ⟸ XM_063272493
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6G5W6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128576 ⟸ XM_063272506
- Peptide Label:
isoform X15
- UniProtKB:
A0A8I6G5W6 (UniProtKB/TrEMBL), A0A8I6GMP8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128565 ⟸ XM_063272495
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063128575 ⟸ XM_063272505
- Peptide Label:
isoform X14
RefSeq Acc Id:
XP_063128574 ⟸ XM_063272504
- Peptide Label:
isoform X13
RGD ID: 13699073 Promoter ID: EPDNEW_R9598 Type: initiation region Name: Enah_1 Description: ENAH, actin regulator SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9599 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 100,405,407 - 100,405,467 EPDNEW
RGD ID: 13699090 Promoter ID: EPDNEW_R9599 Type: single initiation site Name: Enah_2 Description: ENAH, actin regulator SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9598 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 100,414,312 - 100,414,372 EPDNEW
BioCyc Gene G2FUF-17088 BioCyc
Ensembl Genes ENSRNOG00000031934 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000039974.6 UniProtKB/TrEMBL
ENSRNOT00000085188 ENTREZGENE
ENSRNOT00000085188.2 UniProtKB/TrEMBL
ENSRNOT00000097600 ENTREZGENE
ENSRNOT00000097600.1 UniProtKB/TrEMBL
ENSRNOT00000098544 ENTREZGENE
ENSRNOT00000098544.1 UniProtKB/TrEMBL
ENSRNOT00000109962 ENTREZGENE
ENSRNOT00000109962.1 UniProtKB/TrEMBL
ENSRNOT00000114419.1 UniProtKB/TrEMBL
ENSRNOT00000114860.1 UniProtKB/TrEMBL
ENSRNOT00000153721 ENTREZGENE
ENSRNOT00000171057 ENTREZGENE
Gene3D-CATH 2.30.29.30 UniProtKB/TrEMBL
Vasodilator-stimulated phosphoprotein UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7135538 IMAGE-MGC_LOAD
InterPro EVH1 UniProtKB/TrEMBL
PH_type UniProtKB/TrEMBL
VASP_sf UniProtKB/TrEMBL
VASP_tetra UniProtKB/TrEMBL
KEGG Report rno:360891 UniProtKB/TrEMBL
MGC_CLONE MGC:95334 IMAGE-MGC_LOAD
NCBI Gene 360891 ENTREZGENE
PANTHER PROTEIN ENABLED HOMOLOG UniProtKB/TrEMBL
SPROUTY-RELATED, EVH1 DOMAIN-CONTAINING PROTEIN FAMILY MEMBER UniProtKB/TrEMBL
Pfam VASP_tetra UniProtKB/TrEMBL
WH1 UniProtKB/TrEMBL
PhenoGen Enah PhenoGen
PRINTS PRICHEXTENSN UniProtKB/TrEMBL
PROSITE WH1 UniProtKB/TrEMBL
RatGTEx ENSRNOG00000031934 RatGTEx
SMART WH1 UniProtKB/TrEMBL
Superfamily-SCOP PH domain-like UniProtKB/TrEMBL
SSF118370 UniProtKB/TrEMBL
UniProt A0A0G2K6I4 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5Y4S4 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZND4 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZT50 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6G5W6 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6GMP8 ENTREZGENE, UniProtKB/TrEMBL
A6JGK5 ENTREZGENE, UniProtKB/TrEMBL
A6JGK6 ENTREZGENE, UniProtKB/TrEMBL
Q5XHX3 ENTREZGENE, UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-06-12
Enah
ENAH, actin regulator
Enah
enabled homolog (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Enah
enabled homolog (Drosophila)
Enah_predicted
enabled homolog (Drosophila) (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Enah_predicted
enabled homolog (Drosophila) (predicted)
Symbol and Name status set to approved
70820 APPROVED
