Advanced Search (OLGA)

Gene: Dolpp1 (dolichyldiphosphatase 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Dolpp1

Name:

dolichyldiphosphatase 1

RGD ID:

1307447

Description:

Predicted to enable dolichyldiphosphatase activity. Predicted to be involved in protein N-linked glycosylation. Predicted to be active in endoplasmic reticulum membrane. Orthologous to human DOLPP1 (dolichyldiphosphatase 1); PARTICIPATES IN N-linked glycan biosynthetic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

dolichyl pyrophosphate phosphatase 1; LOC296624

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DOLPP1 (dolichyldiphosphatase 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Dolpp1 (dolichyl pyrophosphate phosphatase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dolpp1 (dolichyldiphosphatase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DOLPP1 (dolichyldiphosphatase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DOLPP1 (dolichyldiphosphatase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dolpp1 (dolichyldiphosphatase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DOLPP1 (dolichyldiphosphatase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DOLPP1 (dolichyldiphosphatase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dolpp1 (dolichyldiphosphatase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DOLPP1 (dolichyldiphosphatase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dolpp1 (dolichyl pyrophosphate phosphatase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dolpp1 (dolichyldiphosphatase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CAX4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dolpp1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	34,063,825 - 34,072,133 (+)	NCBI		GRCr8
mRatBN7.2	3	13,666,000 - 13,674,312 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	13,665,823 - 13,674,311 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	16,737,534 - 16,745,846 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	25,322,496 - 25,330,808 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	23,568,489 - 23,576,787 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	8,957,103 - 8,966,618 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	8,958,090 - 8,966,617 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	14,309,876 - 14,319,392 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	9,437,729 - 9,446,213 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	9,438,028 - 9,445,751 (+)	NCBI
Celera	3	8,432,373 - 8,440,857 (+)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dolpp1	Rat	developmental and epileptic encephalopathy		ISO	RGD:1316643	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy	ClinVar	PMID:28492532
Dolpp1	Rat	dystonia		ISO	RGD:1316643	8554872	ClinVar Annotator: match by term: Dystonic disorder	ClinVar	PMID:28492532
Dolpp1	Rat	early infantile epileptic encephalopathy		ISO	RGD:1316643	8554872	ClinVar Annotator: match by term: Early infantile epileptic encephalopathy	ClinVar	PMID:28492532
Dolpp1	Rat	primary coenzyme Q10 deficiency 7		ISO	RGD:1316643	8554872	ClinVar Annotator: match by term: Neonatal encephalomyopathy-cardiomyopathy-respiratory distress syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dolpp1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1316644	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DOLPP1 mRNA	CTD	PMID:22206623
Dolpp1	Rat	17alpha-ethynylestradiol	affects expression	ISO	RGD:1316644	6480464	Ethinyl Estradiol affects the expression of DOLPP1 mRNA	CTD	PMID:17555576
Dolpp1	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1316644	6480464	Ethinyl Estradiol results in increased expression of DOLPP1 mRNA	CTD	PMID:17942748
Dolpp1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of DOLPP1 mRNA	CTD	PMID:22298810
Dolpp1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of DOLPP1 mRNA	CTD	PMID:33387578
Dolpp1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1316644	6480464	Tetrachlorodibenzodioxin affects the expression of DOLPP1 mRNA	CTD	PMID:21570461
Dolpp1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1316643	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Dolpp1	Rat	arsane	affects methylation	ISO	RGD:1316643	6480464	Arsenic affects the methylation of DOLPP1 gene	CTD	PMID:25304211
Dolpp1	Rat	arsane	multiple interactions	ISO	RGD:1316643	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Dolpp1	Rat	arsenic atom	affects methylation	ISO	RGD:1316643	6480464	Arsenic affects the methylation of DOLPP1 gene	CTD	PMID:25304211
Dolpp1	Rat	arsenic atom	multiple interactions	ISO	RGD:1316643	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Dolpp1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1316644	6480464	Benzo(a)pyrene results in decreased expression of DOLPP1 mRNA	CTD	PMID:22228805
Dolpp1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1316643	6480464	Benzo(a)pyrene results in increased methylation of DOLPP1 promoter	CTD	PMID:27901495
Dolpp1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1316643	6480464	Benzo(a)pyrene affects the methylation of DOLPP1 3' UTR	CTD	PMID:27901495
Dolpp1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1316644	6480464	Diethylhexyl Phthalate results in increased expression of DOLPP1 mRNA	CTD	PMID:34319233
Dolpp1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of DOLPP1 mRNA	CTD	PMID:25181051
Dolpp1	Rat	bisphenol F	multiple interactions	ISO	RGD:1316643	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Dolpp1	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of DOLPP1 promoter	CTD	PMID:22457795
Dolpp1	Rat	choline	multiple interactions	ISO	RGD:1316644	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Dolpp1	Rat	chrysene	increases expression	ISO	RGD:1316644	6480464	chrysene results in increased expression of DOLPP1 mRNA	CTD	PMID:26377693
Dolpp1	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of DOLPP1 mRNA	CTD	PMID:27523638
Dolpp1	Rat	cyclosporin A	increases expression	ISO	RGD:1316643	6480464	Cyclosporine results in increased expression of DOLPP1 mRNA	CTD	PMID:25562108
Dolpp1	Rat	dexamethasone	multiple interactions	ISO	RGD:1316643	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Dolpp1	Rat	diazinon	increases methylation	ISO	RGD:1316643	6480464	Diazinon results in increased methylation of DOLPP1 gene	CTD	PMID:22964155
Dolpp1	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1316643	6480464	di-n-butylphosphoric acid affects the expression of DOLPP1 mRNA	CTD	PMID:37042841
Dolpp1	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of DOLPP1 mRNA	CTD	PMID:21266533
Dolpp1	Rat	doxorubicin	decreases expression	ISO	RGD:1316643	6480464	Doxorubicin results in decreased expression of DOLPP1 mRNA	CTD	PMID:29803840
Dolpp1	Rat	elemental selenium	increases expression	ISO	RGD:1316643	6480464	Selenium results in increased expression of DOLPP1 mRNA	CTD	PMID:19244175
Dolpp1	Rat	fenthion	decreases expression	ISO	RGD:1316644	6480464	Fenthion results in decreased expression of DOLPP1 mRNA	CTD	PMID:34813904
Dolpp1	Rat	folic acid	multiple interactions	ISO	RGD:1316644	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DOLPP1 mRNA; [Methionine deficiency co-treated more ...	CTD	PMID:20938992\|PMID:22206623
Dolpp1	Rat	indometacin	multiple interactions	ISO	RGD:1316643	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Dolpp1	Rat	L-methionine	multiple interactions	ISO	RGD:1316644	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Dolpp1	Rat	manganese atom	multiple interactions	ISO	RGD:1316643	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Dolpp1	Rat	manganese(0)	multiple interactions	ISO	RGD:1316643	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Dolpp1	Rat	manganese(II) chloride	multiple interactions	ISO	RGD:1316643	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Dolpp1	Rat	methidathion	decreases expression	ISO	RGD:1316644	6480464	methidathion results in decreased expression of DOLPP1 mRNA	CTD	PMID:34813904
Dolpp1	Rat	monosodium L-glutamate	decreases expression	ISO	RGD:1316644	6480464	Sodium Glutamate results in decreased expression of DOLPP1 mRNA	CTD	PMID:22078008
Dolpp1	Rat	paracetamol	affects expression	ISO	RGD:1316644	6480464	Acetaminophen affects the expression of DOLPP1 mRNA	CTD	PMID:17562736
Dolpp1	Rat	paracetamol	decreases expression	ISO	RGD:1316643	6480464	Acetaminophen results in decreased expression of DOLPP1 mRNA	CTD	PMID:29067470
Dolpp1	Rat	pirinixic acid	multiple interactions	ISO	RGD:1316643	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
Dolpp1	Rat	selenium atom	increases expression	ISO	RGD:1316643	6480464	Selenium results in increased expression of DOLPP1 mRNA	CTD	PMID:19244175
Dolpp1	Rat	sodium arsenite	multiple interactions	ISO	RGD:1316643	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Dolpp1	Rat	sodium dichromate	decreases expression	EXP		6480464	sodium bichromate results in decreased expression of DOLPP1 mRNA	CTD	PMID:22561333
Dolpp1	Rat	Soman	decreases expression	EXP		6480464	Soman results in decreased expression of DOLPP1 mRNA	CTD	PMID:19281266
Dolpp1	Rat	tamoxifen	affects expression	ISO	RGD:1316644	6480464	Tamoxifen affects the expression of DOLPP1 mRNA	CTD	PMID:17555576
Dolpp1	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of DOLPP1 mRNA	CTD	PMID:34492290
Dolpp1	Rat	titanium dioxide	decreases methylation	ISO	RGD:1316644	6480464	titanium dioxide results in decreased methylation of DOLPP1 promoter	CTD	PMID:35295148
Dolpp1	Rat	titanium dioxide	increases methylation	ISO	RGD:1316644	6480464	titanium dioxide results in increased methylation of DOLPP1 gene	CTD	PMID:35295148
Dolpp1	Rat	trichloroethene	increases methylation	EXP		6480464	Trichloroethylene results in increased methylation of DOLPP1 gene	CTD	PMID:27618143
Dolpp1	Rat	triptonide	decreases expression	ISO	RGD:1316644	6480464	triptonide results in decreased expression of DOLPP1 mRNA	CTD	PMID:33045310
Dolpp1	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of DOLPP1 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dolpp1	Rat	protein glycosylation	involved_in	IEA	UniPathway:UPA00378	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Dolpp1	Rat	protein N-linked glycosylation	involved_in	IBA	MGI:1914093\|PANTHER:PTN000882290	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dolpp1	Rat	protein N-linked glycosylation	involved_in	IEA	UniRule:UR001419784	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Dolpp1	Rat	protein N-linked glycosylation	involved_in	ISO	RGD:1316644	1624291	PMID:12198133	RGD	PMID:12198133

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dolpp1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dolpp1	Rat	endoplasmic reticulum membrane	located_in	ISO	RGD:1316644	1624291	PMID:12198133	RGD	PMID:12198133
Dolpp1	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Dolpp1	Rat	endoplasmic reticulum membrane	located_in	IEA	UniRule:UR001419784	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Dolpp1	Rat	endoplasmic reticulum membrane	is_active_in	IBA	MGI:1914093\|PANTHER:PTN000882290	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dolpp1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dolpp1	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dolpp1	Rat	dolichyldiphosphatase activity	enables	ISO	RGD:1316644	1624291	PMID:12198133	RGD	PMID:12198133
Dolpp1	Rat	dolichyldiphosphatase activity	enables	IEA	UniRule:UR001419784	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Dolpp1	Rat	dolichyldiphosphatase activity	enables	IEA	EC:3.6.1.43	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Dolpp1	Rat	dolichyldiphosphatase activity	enables	IBA	MGI:1914093\|PANTHER:PTN000882290	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dolpp1	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dolpp1	Rat	N-linked glycan biosynthetic pathway		IEA		6907045		KEGG	rno:00510

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12198133

Dolpp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	34,063,825 - 34,072,133 (+)	NCBI		GRCr8
mRatBN7.2	3	13,666,000 - 13,674,312 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	13,665,823 - 13,674,311 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	16,737,534 - 16,745,846 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	25,322,496 - 25,330,808 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	23,568,489 - 23,576,787 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	8,957,103 - 8,966,618 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	8,958,090 - 8,966,617 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	14,309,876 - 14,319,392 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	9,437,729 - 9,446,213 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	9,438,028 - 9,445,751 (+)	NCBI
Celera	3	8,432,373 - 8,440,857 (+)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

DOLPP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	129,081,111 - 129,090,438 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	129,081,111 - 129,090,438 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	131,843,390 - 131,852,717 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	130,883,227 - 130,892,538 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	128,922,959 - 128,932,270	NCBI
Celera	9	102,495,681 - 102,505,015 (+)	NCBI		Celera
Cytogenetic Map	9	q34.11	NCBI
HuRef	9	101,450,395 - 101,459,689 (+)	NCBI		HuRef
CHM1_1	9	131,994,218 - 132,003,542 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	141,284,575 - 141,293,902 (+)	NCBI		T2T-CHM13v2.0

Dolpp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	30,282,261 - 30,290,539 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	30,282,266 - 30,290,541 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	30,392,254 - 30,400,529 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	30,392,254 - 30,400,529 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	30,247,936 - 30,256,047 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	30,214,425 - 30,222,536 (+)	NCBI		MGSCv36	mm8
Celera	2	30,097,323 - 30,105,432 (+)	NCBI		Celera
Cytogenetic Map	2	B	NCBI
cM Map	2	21.68	NCBI

Dolpp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955570	1,407,700 - 1,415,813 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955570	1,407,700 - 1,415,813 (+)	NCBI	ChiLan1.0	ChiLan1.0

DOLPP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	10,261,136 - 10,271,207 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	10,263,482 - 10,273,705 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	100,205,558 - 100,215,665 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	128,866,331 - 128,875,710 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	128,866,331 - 128,875,710 (+)	Ensembl	panpan1.1		panPan2

DOLPP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	54,584,510 - 54,593,688 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	54,585,996 - 54,593,648 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	53,780,102 - 53,789,320 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	55,480,130 - 55,489,511 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	55,480,135 - 55,489,401 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	54,266,785 - 54,276,000 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	54,578,674 - 54,587,888 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	54,672,389 - 54,681,603 (-)	NCBI		UU_Cfam_GSD_1.0

Dolpp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	196,744,083 - 196,752,926 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936487	16,512,168 - 16,522,329 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936487	16,512,153 - 16,522,043 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DOLPP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	269,374,933 - 269,384,344 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	269,374,707 - 269,383,939 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	303,390,902 - 303,400,136 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DOLPP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	9,076,492 - 9,086,731 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	9,076,411 - 9,084,258 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666096	476,936 - 487,349 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dolpp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	6,015,299 - 6,023,283 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	6,015,484 - 6,023,293 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Dolpp1
45 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	229
Count of miRNA genes:	128
Interacting mature miRNAs:	171
Transcripts:	ENSRNOT00000064557
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	8658162	27494778	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
8693641	Alc30	Alcohol consumption QTL 30	2	0.739	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	3	10434306	24512004	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	10778823	30356773	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	3e-08	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	8658162	27494778	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat

RH134378

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	13,674,037 - 13,674,252 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	8,966,344 - 8,966,558	NCBI	Rnor6.0
Rnor_5.0	3	14,319,118 - 14,319,332	UniSTS	Rnor5.0
RGSC_v3.4	3	9,445,940 - 9,446,154	UniSTS	RGSC3.4
Celera	3	8,440,584 - 8,440,798	UniSTS
RH 3.4 Map	3	51.4	UniSTS
Cytogenetic Map	3	p12	UniSTS

REN36342

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	13,665,650 - 13,665,865 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	8,957,961 - 8,958,175	NCBI	Rnor6.0
Rnor_5.0	3	14,310,735 - 14,310,949	UniSTS	Rnor5.0
RGSC_v3.4	3	9,437,557 - 9,437,771	UniSTS	RGSC3.4
Celera	3	8,432,201 - 8,432,415	UniSTS
Cytogenetic Map	3	p12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001106567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399346	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098064	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC115341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064557 ⟹ ENSRNOP00000058902

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	13,665,823 - 13,674,311 (+)	Ensembl
Rnor_6.0 Ensembl	3	8,958,133 - 8,966,617 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000086789 ⟹ ENSRNOP00000069211

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	13,665,863 - 13,674,308 (+)	Ensembl
Rnor_6.0 Ensembl	3	8,958,090 - 8,965,454 (+)	Ensembl

RefSeq Acc Id:

NM_001106567 ⟹ NP_001100037

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	34,063,825 - 34,072,132 (+)	NCBI
mRatBN7.2	3	13,666,000 - 13,674,311 (+)	NCBI
Rnor_6.0	3	8,958,133 - 8,966,617 (+)	NCBI
Rnor_5.0	3	14,309,876 - 14,319,392 (+)	NCBI
RGSC_v3.4	3	9,437,729 - 9,446,213 (+)	RGD
Celera	3	8,432,373 - 8,440,857 (+)	RGD

Sequence:

show sequence

ATTGGCAAAGCTGAAGAGGGTCCTCGCTCTCTGATTCGCCGCACGGGCCAGCCTCACGGCCTGCACACTGAATGGCTGCGCCACTACCTGCAATCGGCCTCGGATTGGGTGCGTGGCGTCTACCCGGC
GTGATAGGTCAGGACCACCGCCCCCCTTGTTCCCCATTGGCTGCTGGGCGAAGCCCGGTCTCCGGGTAAGATGGCAGCGGACGGACAGTGCTCGCTCCCCGCTTCATGGCGGCCAGTGACCCTCACCC
ACGTCGAATACCCTGCAGGTGATCTGTCTGGCCACCTCCTGGCCTACCTGAGCCTCAGCCCTATTTTTGTCATTGTTGGTTTTGTGACCCTCATCATATTCAAGCGGGAGCTACACACGATTTCATTC
CTCGGGGGACTGGCACTGAATGAGGGTGTCAACTGGCTGATCAAACACGTCATCCAGGAGCCTCGGCCCTGTGGAGGCCCACACACAGCAGTGGGCACTAAATACGGGATGCCCTCCAGCCATTCCCA
GTTCATGTGGTTCTTCTCTGTCTATTCCTTCCTTTTCTTGTATTTAAGAATGCACCAAACAAATAACGCCAGGTTCCTGGACTTGCTGTGGAGGCATGTGCTGTCTCTAGGGCTCCTCACCGCGGCCT
TTCTAGTCTCCTATAGCAGGCCCATCTCCGAGTTTTTCCTCATCCGGGACACAAGCCTCATTCCCAATGTGCTCTGGTTTGAGTACACAGTAACCAGGGCAGAAGCCAGGAACAGACAACGCAAACTG
GGGACAAAACTGCAGTGACTGGTGGATGTGACTGGGTAAAGCCTCCGAATCTGGCCTGCACCATGCCTTGCAGGATGGACAGAAAGATGAATGAGGGGTGAAGCAGAGACCTCTGCAGACCCGAGTCA
CCAAGTGGAGCCTTTTTTTTTCCTTATTTTAATTTTAATGGACACGGTGGACCAAAGTGCTGAGTCAGGTCCTCAGCCAGGACCCTGGGAGGACCTGCTGTGTGTGGGTCACATGGCCGGAGCCCCTC
TCTGCTGCTGCCAGCTCCTGACTGGGTGGAAAGTGCTCTTGGCATGGGCCTCAGCGTGTGGGCAGAGCACGGTAGAGTGCTTGCACCTCTGGTCCTGAGATCAGGACTCCAGGTAGTGGAGTGCGCAC
TATTTATTCTCTTGGGATTGTAGAGTTCATGCTGGAGAGGCTGCTCTGCAGGGGCTGCCCTGTGTACAAAGGGCCCAGGTTAGCTCCCAGACCCTGTGCTCTGAGCCTGCGGCAGGACAGCCTGCCTC
CTGCTGGGCCTGAGCCGGGCCTGGGGCCCAGGAGTGAGGCAACCCCTGCTGTCCCTGCCACCATTGCCATTCCAGAACCCTGTCAGTGTTTCCTTGTCTGGGTAAGGCCCAGAGCCAGCACCCGTCCG
TCCGTCCGTCCGTCCGTCCGTCGGCTGGGCTGCTGGCTTATGTTCTTCCCTGTATCAACCCGACATCATAAGGGCTTTCTCTGGTCCTCTCTCCCTTCCTGACAAAGGAGCCTGCACATTCGGGTGAG
CACACCCAAGCGTTTACAGCTCCTTTTGTCTGGCCATCTGGTAGCAGTCTGTCTTCATCCCCACTTGAACAAAAGAGAAGAACCAGGAGCTGGGATGGATGCTGGCGGTGTGGCAGTGCAGACGCCCT
CCCCCCATCGCCTGCCCCATGTGCTCTGGATTTGTCCCTGTATTGGCCTGCCCTGGAGGCTGGAAACCAGTGCAGGTTCACCCTGGAGTCTGCCTTGGTGTGGGTTCTCAGATTCCCAGCTTCGGGGA
GTCCCTTTTAAGGGCCTCTCTCCAAGTTGTCCTGCCACAGCTGTGGAGATGCTTCCAGAACTGAAGCAGCCCTGGGGAGCTGTTTGAACCCTCCCTGTTTCTCTGTGGAGGGCCCTAACCTGCTGCTG
AAGCACACATTTTTGGTGCTTTCCTTTGTGTTTGTTAAAGGCCGTGTCCAAGCCCCTCAGATGCCAGGGCCAGGGCTGGTTTCTAGGGAGGTAGGTCAGTCACATCCCCTCCCCTTCCCCTAGGATTA
TTTTTTACTTTCTGCCTGAGACAAGCCAAGTGTGAGGTGGTTTAAGAAAACAAATGAAATTGTTTACTATTGTTTTAAAATAAAATCTGAAACTCCGG

hide sequence

RefSeq Acc Id:

NM_001399346 ⟹ NP_001386275

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	34,063,825 - 34,072,133 (+)	NCBI
mRatBN7.2	3	13,666,000 - 13,674,312 (+)	NCBI


Protein RefSeqs	NP_001100037	(Get FASTA)	NCBI Sequence Viewer
	NP_001386275	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL93310	(Get FASTA)	NCBI Sequence Viewer
	EDL93311	(Get FASTA)	NCBI Sequence Viewer
	EDL93312	(Get FASTA)	NCBI Sequence Viewer
	EDL93313	(Get FASTA)	NCBI Sequence Viewer
	EDL93314	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000058902
	ENSRNOP00000058902.1
	ENSRNOP00000069211
	ENSRNOP00000069211.2

RefSeq Acc Id:	NP_001100037 ⟸ NM_001106567
- Peptide Label:	isoform 2
- UniProtKB:	D3Z917 (UniProtKB/TrEMBL), A6JTY4 (UniProtKB/TrEMBL), A6JTY5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPIFVIVGFVTLIIFKRELHTISFLGGLALNEGVNWLIKHVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNA RFLDLLWRHVLSLGLLTAAFLVSYSRPISEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ hide sequence

Ensembl Acc Id:

ENSRNOP00000069211 ⟸ ENSRNOT00000086789

Ensembl Acc Id:

ENSRNOP00000058902 ⟸ ENSRNOT00000064557

RefSeq Acc Id:	NP_001386275 ⟸ NM_001399346
- Peptide Label:	isoform 1
- UniProtKB:	A0A0G2JUS5 (UniProtKB/TrEMBL), A6JTY3 (UniProtKB/TrEMBL)

Protein Domains

Phosphatidic acid phosphatase type 2/haloperoxidase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2JUS5-F1-model_v2	AlphaFold	A0A0G2JUS5	1-238	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691958

Promoter ID:

EPDNEW_R2483

Type:

multiple initiation site

Name:

Dolpp1_1

Description:

dolichyldiphosphatase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	8,958,320 - 8,958,380	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-50215	BioCyc
Ensembl Genes	ENSRNOG00000017663	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000064557	ENTREZGENE
	ENSRNOT00000064557.2	UniProtKB/TrEMBL
	ENSRNOT00000086789	ENTREZGENE
	ENSRNOT00000086789.2	UniProtKB/TrEMBL
Gene3D-CATH	Phosphatidic acid phosphatase type 2/haloperoxidase	UniProtKB/TrEMBL
InterPro	Dolichyldiphosphatase_PAP2	UniProtKB/TrEMBL
	P_Acid_Pase_2/haloperoxi_sf	UniProtKB/TrEMBL
	P_Acid_Pase_2/haloperoxidase	UniProtKB/TrEMBL
KEGG Report	rno:296624	UniProtKB/TrEMBL
NCBI Gene	296624	ENTREZGENE
PANTHER	PALMITOYL-PROTEIN THIOESTERASE/DOLICHYLDIPHOSPHATASE 1	UniProtKB/TrEMBL
	PTHR11247:SF1	UniProtKB/TrEMBL
Pfam	PAP2	UniProtKB/TrEMBL
PhenoGen	Dolpp1	PhenoGen
RatGTEx	ENSRNOG00000017663	RatGTEx
SMART	acidPPc	UniProtKB/TrEMBL
Superfamily-SCOP	AcPase_VanPerase	UniProtKB/TrEMBL
UniProt	A0A0G2JUS5	ENTREZGENE, UniProtKB/TrEMBL
	A6JTY3	ENTREZGENE, UniProtKB/TrEMBL
	A6JTY4	ENTREZGENE, UniProtKB/TrEMBL
	A6JTY5	ENTREZGENE, UniProtKB/TrEMBL
	A6JTY6_RAT	UniProtKB/TrEMBL
	D3Z917	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-06-05	Dolpp1	dolichyldiphosphatase 1	Dolpp1	dolichyl pyrophosphate phosphatase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Dolpp1	dolichyl pyrophosphate phosphatase 1	Dolpp1_predicted	dolichyl pyrophosphate phosphatase 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Dolpp1_predicted	dolichyl pyrophosphate phosphatase 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)