Symbol:
Ddx21
Name:
DExD-box helicase 21
RGD ID:
1307306
Description:
Predicted to enable RNA binding activity; RNA helicase activity; and identical protein binding activity. Predicted to be involved in several processes, including R-loop processing; positive regulation of canonical NF-kappaB signal transduction; and positive regulation of macromolecule biosynthetic process. Predicted to act upstream of or within response to exogenous dsRNA and response to virus. Predicted to be located in chromosome; cytosol; and nucleoplasm. Predicted to be part of B-WICH complex. Predicted to be active in nucleolus. Orthologous to human DDX21 (DExD-box helicase 21); INTERACTS WITH (+)-schisandrin B; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Ddx21a; Ddx21b; DEAD (Asp-Glu-Ala-Asp) box helicase 21; DEAD (Asp-Glu-Ala-Asp) box polypeptide 21; DEAD (Asp-Glu-Ala-Asp) box polypeptide 21a; DEAD (Asp-Glu-Ala-Asp) box polypeptide 21b; DEAD box protein 21; DEAD-box helicase 21; gu-alpha; LOC317399; LOC361847; MGC112658; MGC124980; nucleolar RNA helicase 2; nucleolar RNA helicase Gu; nucleolar RNA helicase II; RH II/Gu
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Ddx21-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 31,077,044 - 31,097,238 (-) NCBI GRCr8 mRatBN7.2 20 30,534,319 - 30,554,513 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 30,534,319 - 30,554,543 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 31,545,279 - 31,565,477 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 30,936,186 - 30,956,386 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 31,673,000 - 31,693,177 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 32,213,147 - 32,232,632 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 32,213,148 - 32,232,632 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 33,997,711 - 34,017,196 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 29,838,671 - 29,860,514 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 20 31,953,138 - 31,973,565 (-) NCBI Celera Cytogenetic Map 20 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ddx21 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DDX21 mRNA] CTD PMID:31150632 Ddx21 Rat 1,2-dimethylhydrazine increases expression ISO Ddx21 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of DDX21 mRNA CTD PMID:22206623 Ddx21 Rat 17beta-estradiol affects expression ISO Ddx21 (Mus musculus) 6480464 Estradiol affects the expression of DDX21 mRNA CTD PMID:15598610 Ddx21 Rat 17beta-estradiol increases expression ISO DDX21 (Homo sapiens) 6480464 Estradiol results in increased expression of DDX21 mRNA CTD PMID:16514628 more ... Ddx21 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Ddx21 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Ddx21 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ddx21 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DDX21 mRNA CTD PMID:21570461 Ddx21 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO DDX21 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of DDX21 mRNA CTD PMID:18061397 and PMID:22903824 Ddx21 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO DDX21 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DDX21 mRNA CTD PMID:20106945 and PMID:21632981 Ddx21 Rat 2,4,6-tribromophenol decreases expression ISO DDX21 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ddx21 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of DDX21 mRNA CTD PMID:21346803 Ddx21 Rat 2,6-dimethoxyphenol multiple interactions ISO DDX21 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Ddx21 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of DDX21 mRNA CTD PMID:21346803 Ddx21 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of DDX21 mRNA CTD PMID:15890375 Ddx21 Rat 3',5'-cyclic UMP affects binding ISO DDX21 (Homo sapiens) 6480464 DDX21 protein binds to cyclic 3' and 5'-uridine monophosphate CTD PMID:30528433 Ddx21 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO DDX21 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of DDX21 protein CTD PMID:31675489 Ddx21 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of DDX21 mRNA CTD PMID:19162173 Ddx21 Rat 4,4'-sulfonyldiphenol increases expression ISO Ddx21 (Mus musculus) 6480464 bisphenol S results in increased expression of DDX21 mRNA CTD PMID:39298647 Ddx21 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of DDX21 mRNA CTD PMID:15890375 Ddx21 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of DDX21 mRNA CTD PMID:21346803 Ddx21 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DDX21 mRNA CTD PMID:30047161 Ddx21 Rat 7,12-dimethyltetraphene increases expression ISO Ddx21 (Mus musculus) 6480464 9 more ... CTD PMID:38307155 Ddx21 Rat afimoxifene multiple interactions ISO DDX21 (Homo sapiens) 6480464 afimoxifene inhibits the reaction [Estrogens results in increased expression of DDX21 mRNA] CTD PMID:21233418 Ddx21 Rat afimoxifene decreases expression ISO DDX21 (Homo sapiens) 6480464 afimoxifene results in decreased expression of DDX21 mRNA CTD PMID:16514628 Ddx21 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of DDX21 mRNA CTD PMID:15890375 Ddx21 Rat aflatoxin B1 increases expression ISO DDX21 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of DDX21 mRNA CTD PMID:22100608 and PMID:27153756 Ddx21 Rat all-trans-retinoic acid decreases expression ISO Ddx21 (Mus musculus) 6480464 Tretinoin results in decreased expression of DDX21 mRNA CTD PMID:16604517 Ddx21 Rat all-trans-retinoic acid decreases expression ISO DDX21 (Homo sapiens) 6480464 Tretinoin results in decreased expression of DDX21 mRNA CTD PMID:15498508 and PMID:16054129 Ddx21 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of DDX21 mRNA CTD PMID:30047161 Ddx21 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of DDX21 mRNA CTD PMID:30779732 Ddx21 Rat antirheumatic drug decreases expression ISO DDX21 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of DDX21 mRNA CTD PMID:24449571 Ddx21 Rat aristolochic acid A decreases expression ISO DDX21 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of DDX21 mRNA CTD PMID:33212167 Ddx21 Rat arsane multiple interactions ISO DDX21 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of DDX21 mRNA CTD PMID:39836092 Ddx21 Rat arsenic atom multiple interactions ISO DDX21 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of DDX21 mRNA CTD PMID:39836092 Ddx21 Rat arsenous acid decreases expression ISO DDX21 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of DDX21 protein CTD PMID:25419056 Ddx21 Rat belinostat decreases expression ISO DDX21 (Homo sapiens) 6480464 belinostat results in decreased expression of DDX21 mRNA CTD PMID:19606018 Ddx21 Rat benzo[a]pyrene increases expression ISO DDX21 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of DDX21 mRNA CTD PMID:18061397 Ddx21 Rat benzo[a]pyrene increases expression ISO Ddx21 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of DDX21 mRNA CTD PMID:22228805 Ddx21 Rat benzo[a]pyrene diol epoxide I decreases expression ISO DDX21 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Ddx21 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ddx21 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of DDX21 mRNA CTD PMID:33754040 Ddx21 Rat bisphenol A decreases expression ISO DDX21 (Homo sapiens) 6480464 bisphenol A results in decreased expression of DDX21 mRNA and bisphenol A results in decreased expression of DDX21 protein CTD PMID:20678512 and PMID:37567409 Ddx21 Rat bisphenol A increases expression ISO DDX21 (Homo sapiens) 6480464 bisphenol A analog results in increased expression of DDX21 mRNA CTD PMID:32387340 Ddx21 Rat bisphenol A affects expression ISO DDX21 (Homo sapiens) 6480464 bisphenol A affects the expression of DDX21 mRNA CTD PMID:30903817 Ddx21 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of DDX21 gene CTD PMID:28505145 Ddx21 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DDX21 mRNA CTD PMID:25181051 Ddx21 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DDX21 mRNA CTD PMID:25181051 and PMID:32145629 Ddx21 Rat bisphenol AF increases expression ISO DDX21 (Homo sapiens) 6480464 bisphenol AF results in increased expression of DDX21 protein CTD PMID:34186270 Ddx21 Rat cadmium atom multiple interactions ISO Ddx21 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DDX21 mRNA CTD PMID:37325564 Ddx21 Rat cadmium dichloride multiple interactions ISO Ddx21 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DDX21 mRNA CTD PMID:37325564 Ddx21 Rat caffeine decreases phosphorylation ISO DDX21 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of DDX21 protein CTD PMID:35688186 Ddx21 Rat carbon nanotube increases expression ISO Ddx21 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Ddx21 Rat chloropicrin decreases expression ISO DDX21 (Homo sapiens) 6480464 chloropicrin results in decreased expression of DDX21 mRNA CTD PMID:26352163 and PMID:28476498 Ddx21 Rat chlorpyrifos decreases expression ISO Ddx21 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of DDX21 mRNA CTD PMID:37019170 Ddx21 Rat chromium(6+) affects expression ISO Ddx21 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of DDX21 mRNA CTD PMID:28472532 Ddx21 Rat cisplatin decreases expression ISO DDX21 (Homo sapiens) 6480464 Cisplatin results in decreased expression of DDX21 mRNA CTD PMID:27594783 Ddx21 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of DDX21 mRNA CTD PMID:17602206 Ddx21 Rat cobalt dichloride multiple interactions ISO DDX21 (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in decreased expression of DDX21 mRNA] CTD PMID:22202117 Ddx21 Rat cobalt dichloride decreases expression ISO DDX21 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of DDX21 mRNA CTD PMID:19320972 and PMID:22202117 Ddx21 Rat copper atom increases expression ISO Ddx21 (Mus musculus) 6480464 Copper results in increased expression of DDX21 protein CTD PMID:21146535 Ddx21 Rat copper(0) increases expression ISO Ddx21 (Mus musculus) 6480464 Copper results in increased expression of DDX21 protein CTD PMID:21146535 Ddx21 Rat cordycepin decreases expression ISO Ddx21 (Mus musculus) 6480464 cordycepin results in decreased expression of DDX21 mRNA CTD PMID:32042022 Ddx21 Rat coumarin decreases phosphorylation ISO DDX21 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of DDX21 protein CTD PMID:35688186 Ddx21 Rat cyclosporin A increases expression ISO DDX21 (Homo sapiens) 6480464 Cyclosporine results in increased expression of DDX21 mRNA CTD PMID:20106945 and PMID:25562108 Ddx21 Rat DDE increases expression ISO DDX21 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of DDX21 mRNA CTD PMID:38568856 Ddx21 Rat decabromodiphenyl ether increases expression ISO DDX21 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of DDX21 protein CTD PMID:31675489 Ddx21 Rat deoxynivalenol decreases phosphorylation ISO Ddx21 (Mus musculus) 6480464 deoxynivalenol results in decreased phosphorylation of DDX21 protein CTD PMID:23352502 and PMID:23811945 Ddx21 Rat diarsenic trioxide decreases expression ISO DDX21 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of DDX21 protein CTD PMID:25419056 Ddx21 Rat Dibutyl phosphate affects expression ISO DDX21 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of DDX21 mRNA CTD PMID:37042841 Ddx21 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of DDX21 mRNA CTD PMID:21266533 Ddx21 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of DDX21 mRNA CTD PMID:15890375 Ddx21 Rat dioxygen multiple interactions ISO Ddx21 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of DDX21 mRNA CTD PMID:30529165 Ddx21 Rat enzyme inhibitor multiple interactions ISO DDX21 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of DDX21 protein CTD PMID:23301498 Ddx21 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of DDX21 mRNA CTD PMID:24136188 Ddx21 Rat FR900359 affects phosphorylation ISO DDX21 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of DDX21 protein CTD PMID:37730182 Ddx21 Rat fulvestrant decreases expression ISO DDX21 (Homo sapiens) 6480464 fulvestrant results in decreased expression of DDX21 mRNA CTD PMID:16514628 Ddx21 Rat furan increases expression ISO Ddx21 (Mus musculus) 6480464 furan results in increased expression of DDX21 mRNA CTD PMID:24183702 Ddx21 Rat furfural multiple interactions ISO DDX21 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Ddx21 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of DDX21 mRNA CTD PMID:22061828 Ddx21 Rat ivermectin decreases expression ISO DDX21 (Homo sapiens) 6480464 Ivermectin results in decreased expression of DDX21 protein CTD PMID:32959892 Ddx21 Rat leflunomide increases expression ISO DDX21 (Homo sapiens) 6480464 leflunomide results in increased expression of DDX21 mRNA CTD PMID:28988120 Ddx21 Rat lipopolysaccharide multiple interactions ISO DDX21 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with Resveratrol] results in decreased expression of DDX21 mRNA more ... CTD PMID:26667767 and PMID:35811015 Ddx21 Rat lipopolysaccharide increases expression ISO DDX21 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of DDX21 mRNA CTD PMID:35811015 Ddx21 Rat lithium atom multiple interactions EXP 6480464 Lithium inhibits the reaction [Methamphetamine results in decreased expression of DDX21 mRNA] CTD PMID:19149911 Ddx21 Rat lithium hydride multiple interactions EXP 6480464 Lithium inhibits the reaction [Methamphetamine results in decreased expression of DDX21 mRNA] CTD PMID:19149911 Ddx21 Rat methamphetamine multiple interactions EXP 6480464 Lithium inhibits the reaction [Methamphetamine results in decreased expression of DDX21 mRNA] CTD PMID:19149911 Ddx21 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of DDX21 mRNA CTD PMID:19149911 Ddx21 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of DDX21 mRNA CTD PMID:15890375 Ddx21 Rat methidathion decreases expression ISO Ddx21 (Mus musculus) 6480464 methidathion results in decreased expression of DDX21 mRNA CTD PMID:34813904 Ddx21 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of DDX21 mRNA CTD PMID:30047161 Ddx21 Rat methotrexate affects expression ISO Ddx21 (Mus musculus) 6480464 Methotrexate affects the expression of DDX21 mRNA CTD PMID:18502557 Ddx21 Rat methyl methanesulfonate decreases expression ISO DDX21 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of DDX21 mRNA CTD PMID:23649840 Ddx21 Rat N-methyl-4-phenylpyridinium increases expression ISO Ddx21 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of DDX21 protein CTD PMID:26558463 Ddx21 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of DDX21 mRNA CTD PMID:17602206 Ddx21 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of DDX21 mRNA CTD PMID:15890375 Ddx21 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of DDX21 mRNA CTD PMID:24136188 Ddx21 Rat nickel atom increases expression ISO DDX21 (Homo sapiens) 6480464 Nickel results in increased expression of DDX21 mRNA CTD PMID:25583101 Ddx21 Rat ochratoxin A multiple interactions ISO DDX21 (Homo sapiens) 6480464 [ochratoxin A results in decreased acetylation of DDX21 promoter] which results in decreased expression of DDX21 mRNA CTD PMID:29098329 Ddx21 Rat ochratoxin A decreases expression ISO DDX21 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of DDX21 mRNA CTD PMID:29098329 Ddx21 Rat ochratoxin A decreases acetylation ISO DDX21 (Homo sapiens) 6480464 ochratoxin A results in decreased acetylation of DDX21 promoter CTD PMID:29098329 Ddx21 Rat okadaic acid increases expression ISO DDX21 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of DDX21 mRNA and Okadaic Acid results in increased expression of DDX21 protein CTD PMID:38832940 Ddx21 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of DDX21 mRNA CTD PMID:32479839 Ddx21 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of DDX21 mRNA CTD PMID:32680482 Ddx21 Rat parathion increases expression ISO Ddx21 (Mus musculus) 6480464 Parathion results in increased expression of DDX21 mRNA CTD PMID:34813904 Ddx21 Rat pentachlorophenol increases expression ISO Ddx21 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of DDX21 mRNA CTD PMID:23892564 Ddx21 Rat perfluorononanoic acid increases expression ISO DDX21 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of DDX21 mRNA CTD PMID:32588087 Ddx21 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of DDX21 mRNA CTD PMID:19162173 Ddx21 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of DDX21 mRNA CTD PMID:19162173 Ddx21 Rat phenobarbital increases expression ISO Ddx21 (Mus musculus) 6480464 Phenobarbital results in increased expression of DDX21 protein CTD PMID:35881160 Ddx21 Rat phenobarbital decreases expression ISO DDX21 (Homo sapiens) 6480464 Phenobarbital results in decreased expression of DDX21 protein CTD PMID:35881160 Ddx21 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of DDX21 mRNA CTD PMID:15890375 Ddx21 Rat pirinixic acid multiple interactions ISO DDX21 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of DDX21 mRNA CTD PMID:19710929 Ddx21 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of DDX21 mRNA CTD PMID:15890375 and PMID:19162173 Ddx21 Rat poly(I:C) multiple interactions ISO DDX21 (Homo sapiens) 6480464 [TL8-506 co-treated with Poly I-C] results in increased expression of DDX21 mRNA CTD PMID:35688559 Ddx21 Rat potassium dichromate decreases expression ISO DDX21 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of DDX21 protein CTD PMID:23718831 Ddx21 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Ddx21 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of DDX21 mRNA CTD PMID:28903501 Ddx21 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of DDX21 mRNA CTD PMID:30047161 Ddx21 Rat progesterone affects expression ISO Ddx21 (Mus musculus) 6480464 Progesterone affects the expression of DDX21 mRNA CTD PMID:17251523 Ddx21 Rat propiconazole increases expression ISO Ddx21 (Mus musculus) 6480464 propiconazole results in increased expression of DDX21 mRNA CTD PMID:21278054 Ddx21 Rat raloxifene decreases expression ISO DDX21 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of DDX21 mRNA CTD PMID:16514628 Ddx21 Rat resveratrol multiple interactions ISO DDX21 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with Resveratrol] results in decreased expression of DDX21 mRNA and [Plant Extracts co-treated with Resveratrol] results in increased expression of DDX21 mRNA CTD PMID:23557933 and PMID:26667767 Ddx21 Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of DDX21 mRNA CTD PMID:25905778 Ddx21 Rat resveratrol decreases expression ISO Ddx21 (Mus musculus) 6480464 resveratrol results in decreased expression of DDX21 protein CTD PMID:25505154 Ddx21 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of DDX21 mRNA CTD PMID:28374803 Ddx21 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO DDX21 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of DDX21 mRNA CTD PMID:35811015 Ddx21 Rat SB 431542 multiple interactions ISO DDX21 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of DDX21 protein CTD PMID:37664457 Ddx21 Rat sodium arsenite decreases expression ISO DDX21 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DDX21 mRNA CTD PMID:38568856 Ddx21 Rat sodium arsenite multiple interactions ISO DDX21 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of DDX21 mRNA CTD PMID:39836092 Ddx21 Rat sodium chloride multiple interactions ISO DDX21 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of DDX21 protein more ... CTD PMID:38598786 Ddx21 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of DDX21 mRNA CTD PMID:25993096 Ddx21 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of DDX21 mRNA CTD PMID:30047161 Ddx21 Rat sunitinib increases expression ISO DDX21 (Homo sapiens) 6480464 Sunitinib results in increased expression of DDX21 mRNA CTD PMID:31533062 Ddx21 Rat tamibarotene decreases expression ISO DDX21 (Homo sapiens) 6480464 tamibarotene results in decreased expression of DDX21 mRNA CTD PMID:15498508 Ddx21 Rat tamoxifen affects expression ISO DDX21 (Homo sapiens) 6480464 Tamoxifen affects the expression of DDX21 mRNA CTD PMID:14699072 Ddx21 Rat temozolomide increases expression ISO DDX21 (Homo sapiens) 6480464 Temozolomide results in increased expression of DDX21 mRNA CTD PMID:31758290 Ddx21 Rat tert-butyl hydroperoxide increases expression ISO DDX21 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of DDX21 mRNA CTD PMID:15336504 Ddx21 Rat tetrachloromethane increases expression ISO Ddx21 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of DDX21 mRNA CTD PMID:27339419 and PMID:31919559 Ddx21 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DDX21 mRNA] CTD PMID:31150632 Ddx21 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of DDX21 mRNA CTD PMID:31150632 Ddx21 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of DDX21 protein CTD PMID:35544339 Ddx21 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of DDX21 mRNA CTD PMID:23411599 and PMID:34492290 Ddx21 Rat titanium dioxide increases expression ISO Ddx21 (Mus musculus) 6480464 titanium dioxide results in increased expression of DDX21 mRNA CTD PMID:27760801 Ddx21 Rat titanium dioxide decreases methylation ISO Ddx21 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DDX21 gene CTD PMID:35295148 Ddx21 Rat Tributyltin oxide decreases expression ISO Ddx21 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of DDX21 protein CTD PMID:19552622 Ddx21 Rat Tributyltin oxide decreases phosphorylation ISO Ddx21 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased phosphorylation of DDX21 protein CTD PMID:22174045 Ddx21 Rat trimellitic anhydride increases expression ISO Ddx21 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of DDX21 mRNA CTD PMID:19042947 Ddx21 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of DDX21 mRNA CTD PMID:30589522 Ddx21 Rat tungsten decreases expression ISO Ddx21 (Mus musculus) 6480464 Tungsten results in decreased expression of DDX21 mRNA CTD PMID:30912803 Ddx21 Rat urethane decreases expression ISO DDX21 (Homo sapiens) 6480464 Urethane results in decreased expression of DDX21 mRNA CTD PMID:28818685 Ddx21 Rat valproic acid decreases expression ISO DDX21 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DDX21 mRNA CTD PMID:19101580 Ddx21 Rat valproic acid affects expression ISO DDX21 (Homo sapiens) 6480464 Valproic Acid affects the expression of DDX21 mRNA CTD PMID:25979313 Ddx21 Rat valproic acid increases expression ISO DDX21 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DDX21 mRNA CTD PMID:23179753 Ddx21 Rat valproic acid affects expression ISO Ddx21 (Mus musculus) 6480464 Valproic Acid affects the expression of DDX21 mRNA CTD PMID:17292431 Ddx21 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of DDX21 mRNA CTD PMID:23034163 Ddx21 Rat zinc dichloride multiple interactions ISO DDX21 (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in decreased expression of DDX21 mRNA] CTD PMID:22202117
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-nitrofluorene (EXP) 3',5'-cyclic UMP (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-amino-2,6-dinitrotoluene (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) afimoxifene (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) amitrole (EXP) amphetamine (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) belinostat (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) chloropicrin (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibric acid (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) cordycepin (ISO) coumarin (ISO) cyclosporin A (ISO) DDE (ISO) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diethylstilbestrol (EXP) dioxygen (ISO) enzyme inhibitor (ISO) flutamide (EXP) FR900359 (ISO) fulvestrant (ISO) furan (ISO) furfural (ISO) gentamycin (EXP) ivermectin (ISO) leflunomide (ISO) lipopolysaccharide (ISO) lithium atom (EXP) lithium hydride (EXP) methamphetamine (EXP) methapyrilene (EXP) methidathion (ISO) methimazole (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nefazodone (EXP) nickel atom (ISO) ochratoxin A (ISO) okadaic acid (ISO) paracetamol (EXP) paraquat (EXP) parathion (ISO) pentachlorophenol (ISO) perfluorononanoic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (EXP,ISO) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) poly(I:C) (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP,ISO) progesterone (ISO) propiconazole (ISO) raloxifene (ISO) resveratrol (EXP,ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) sulfadimethoxine (EXP) sunitinib (ISO) tamibarotene (ISO) tamoxifen (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thapsigargin (EXP) thioacetamide (EXP) titanium dioxide (ISO) Tributyltin oxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP) tungsten (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) zinc dichloride (ISO)
Biological Process
defense response to virus (IEA) immune system process (IEA) innate immune response (IEA) positive regulation of canonical NF-kappaB signal transduction (IEA,ISO,ISS) positive regulation of myeloid dendritic cell cytokine production (IEA,ISO) positive regulation of transcription by RNA polymerase III (IEA,ISO) R-loop processing (IEA,ISO,ISS) response to exogenous dsRNA (IEA,ISO) response to virus (IEA,ISO) rRNA processing (IEA) transcription by RNA polymerase II (IEA,ISO,ISS)
Molecular Function
7SK snRNA binding (IEA,ISO,ISS) ATP binding (IEA) ATP hydrolysis activity (IEA) double-stranded RNA binding (IEA,ISO) helicase activity (IEA) hydrolase activity (IEA) identical protein binding (IEA,ISO) miRNA binding (IEA,ISO,ISS) mRNA binding (IBA) nucleic acid binding (IEA) nucleotide binding (IEA) protein binding (ISO) RNA binding (IEA) RNA helicase activity (IBA,IEA,ISO,ISS) rRNA binding (IEA,ISO,ISS) snoRNA binding (IEA,ISO,ISS)
Ddx21 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 31,077,044 - 31,097,238 (-) NCBI GRCr8 mRatBN7.2 20 30,534,319 - 30,554,513 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 30,534,319 - 30,554,543 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 31,545,279 - 31,565,477 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 30,936,186 - 30,956,386 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 31,673,000 - 31,693,177 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 32,213,147 - 32,232,632 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 32,213,148 - 32,232,632 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 33,997,711 - 34,017,196 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 29,838,671 - 29,860,514 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 20 31,953,138 - 31,973,565 (-) NCBI Celera Cytogenetic Map 20 q11 NCBI
DDX21 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 68,956,170 - 68,985,068 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 68,956,135 - 68,985,068 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 70,715,926 - 70,744,824 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 70,385,898 - 70,414,285 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 70,385,897 - 70,414,285 NCBI Celera 10 63,991,762 - 64,020,150 (+) NCBI Celera Cytogenetic Map 10 q22.1 NCBI HuRef 10 64,717,792 - 64,746,685 (+) NCBI HuRef CHM1_1 10 70,997,606 - 71,026,553 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 69,825,602 - 69,854,499 (+) NCBI T2T-CHM13v2.0
Ddx21 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 62,416,026 - 62,438,077 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 62,416,030 - 62,438,060 (-) Ensembl GRCm39 Ensembl GRCm38 10 62,580,247 - 62,602,298 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 62,580,251 - 62,602,281 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 62,042,995 - 62,065,046 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 61,975,604 - 61,997,655 (-) NCBI MGSCv36 mm8 Celera 10 63,683,725 - 63,705,771 (-) NCBI Celera Cytogenetic Map 10 B4 NCBI cM Map 10 32.43 NCBI
Ddx21 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 22,050,937 - 22,071,118 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 22,050,029 - 22,071,213 (-) NCBI ChiLan1.0 ChiLan1.0
DDX21 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 81,102,441 - 81,131,439 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 81,098,619 - 81,136,760 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 65,423,319 - 65,452,266 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 67,956,857 - 67,985,867 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 67,956,857 - 67,985,867 (+) Ensembl panpan1.1 panPan2
DDX21 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 20,109,719 - 20,134,586 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 20,109,778 - 20,132,338 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 20,240,134 - 20,264,990 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 20,381,832 - 20,407,325 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 20,381,870 - 20,407,323 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 20,282,539 - 20,307,462 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 20,485,654 - 20,510,665 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 20,828,776 - 20,854,073 (+) NCBI UU_Cfam_GSD_1.0
Ddx21 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 60,933,799 - 60,956,220 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936521 9,429,015 - 9,448,890 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936521 9,426,544 - 9,448,973 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DDX21 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 72,039,982 - 72,063,773 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 72,039,985 - 72,063,778 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 78,054,874 - 78,078,395 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DDX21
Ddx21
.
Predicted Target Of
Count of predictions: 901 Count of miRNA genes: 320 Interacting mature miRNAs: 429 Transcripts: ENSRNOT00000068184 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
4889610 Pancm3 Pancreatic morphology QTL 3 3.75 0.001 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 20 17617832 47606836 Rat 2303587 Bw93 Body weight QTL 93 13 body mass (VT:0001259) body weight (CMO:0000012) 20 25106722 54435887 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 2303626 Vencon10 Ventilatory control QTL 10 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 20 19190721 54435887 Rat 1598869 Memor6 Memory QTL 6 3.1 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 20 29244388 54435887 Rat 7411652 Foco24 Food consumption QTL 24 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 11757515 54435887 Rat 1331747 Hrtrt16 Heart rate QTL 16 3.163 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 20 25209734 54435887 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 2303578 Gluco50 Glucose level QTL 50 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 20 25106722 54435887 Rat 2317880 Alcrsp25 Alcohol response QTL 25 2.3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 17697550 54435887 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat 9590092 Insglur9 Insulin/glucose ratio QTL 9 18.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 20 11757515 54435887 Rat 2300188 Bmd68 Bone mineral density QTL 68 6.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 20 25106722 54435887 Rat
BI302095
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 30,554,669 - 30,554,822 (+) MAPPER mRatBN7.2 Rnor_6.0 20 32,232,789 - 32,232,941 NCBI Rnor6.0 Rnor_5.0 20 34,017,353 - 34,017,505 UniSTS Rnor5.0 RGSC_v3.4 20 29,860,671 - 29,860,823 UniSTS RGSC3.4 Celera 20 31,973,722 - 31,973,874 UniSTS RH 3.4 Map 20 308.38 UniSTS Cytogenetic Map 20 q11 UniSTS
RH129516
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 20 q11 UniSTS
RH133206
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 30,535,678 - 30,535,859 (+) MAPPER mRatBN7.2 mRatBN7.2 X 18,566,044 - 18,566,225 (+) MAPPER mRatBN7.2 Rnor_6.0 X 19,383,535 - 19,383,715 NCBI Rnor6.0 Rnor_6.0 20 32,214,507 - 32,214,687 NCBI Rnor6.0 Rnor_5.0 20 33,999,071 - 33,999,251 UniSTS Rnor5.0 Rnor_5.0 X 20,150,411 - 20,150,591 UniSTS Rnor5.0 RGSC_v3.4 X 38,742,330 - 38,742,510 UniSTS RGSC3.4 RGSC_v3.4 20 29,840,031 - 29,840,211 UniSTS RGSC3.4 Celera 20 31,954,498 - 31,954,678 UniSTS Celera X 18,831,612 - 18,831,792 UniSTS Cytogenetic Map 20 q11 UniSTS
RH144150
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 30,547,722 - 30,547,884 (+) MAPPER mRatBN7.2 Rnor_6.0 20 32,225,948 - 32,226,109 NCBI Rnor6.0 Rnor_5.0 20 34,010,512 - 34,010,673 UniSTS Rnor5.0 RGSC_v3.4 20 29,852,037 - 29,852,198 UniSTS RGSC3.4 Celera 20 31,966,539 - 31,966,700 UniSTS RH 3.4 Map 20 308.36 UniSTS Cytogenetic Map 20 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068184 ⟹ ENSRNOP00000063494
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 30,534,319 - 30,554,543 (-) Ensembl Rnor_6.0 Ensembl 20 32,213,148 - 32,232,632 (-) Ensembl
RefSeq Acc Id:
NM_001037201 ⟹ NP_001032278
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 31,077,044 - 31,097,238 (-) NCBI mRatBN7.2 20 30,534,319 - 30,554,513 (-) NCBI Rnor_6.0 20 32,213,147 - 32,232,632 (-) NCBI Rnor_5.0 20 33,997,711 - 34,017,196 (-) NCBI RGSC_v3.4 20 29,838,671 - 29,860,514 (-) RGD Celera 20 31,953,138 - 31,973,565 (-) RGD
Sequence:
CGCGGTTGTGGAAGCCGGTAGGCCTGAGCTGCTCCTGCTGAATAATGCCGGGAAAACTCCGCAGTGCGTCCAAGTCGGAGTCAGAAGGGACCGAGGAGAGTATGGAGACGCTGCAGAAGCCAAGCGAG
hide sequence
RefSeq Acc Id:
NP_001032278 ⟸ NM_001037201
- UniProtKB:
Q3B8Q1 (UniProtKB/Swiss-Prot), A6K457 (UniProtKB/TrEMBL)
- Sequence:
MPGKLRSASKSESEGTEESMETLQKPSEKKTRKEKPKSKTDEATEGVEEAASSKVKAVKKKGPSEDDVGPPKSKKAKKQEEEPQDDPASKSKTSKKKKEPLEKKAPSAKTKEMKAEEPSEEEADAPKP
hide sequence
Ensembl Acc Id:
ENSRNOP00000063494 ⟸ ENSRNOT00000068184
RGD ID: 13701616 Promoter ID: EPDNEW_R12140 Type: multiple initiation site Name: Ddx21_1 Description: DExD-box helicase 21 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 32,232,644 - 32,232,704 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-10-05
Ddx21
DExD-box helicase 21
Ddx21
DEAD-box helicase 21
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-01-13
Ddx21
DEAD-box helicase 21
Ddx21
DEAD (Asp-Glu-Ala-Asp) box helicase 21
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-11-04
Ddx21
DEAD (Asp-Glu-Ala-Asp) box helicase 21
Ddx21b
DEAD (Asp-Glu-Ala-Asp) box polypeptide 21b
Data merged from RGD:1304998
737654 APPROVED
2012-07-16
Ddx21
DEAD (Asp-Glu-Ala-Asp) box helicase 21
Ddx21
DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-03
Ddx21
DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
Ddx21a
DEAD (Asp-Glu-Ala-Asp) box polypeptide 21a
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Ddx21b
DEAD (Asp-Glu-Ala-Asp) box polypeptide 21b
Ddx21b_predicted
DEAD (Asp-Glu-Ala-Asp) box polypeptide 21b (predicted)
Symbol and Name updated
1559027 APPROVED
2005-12-06
Ddx21a
DEAD (Asp-Glu-Ala-Asp) box polypeptide 21a
Ddx21a_predicted
DEAD (Asp-Glu-Ala-Asp) box polypeptide 21a (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Ddx21a_predicted
DEAD (Asp-Glu-Ala-Asp) box polypeptide 21a (predicted)
Symbol and Name status set to approved
70820 APPROVED
2005-01-12
Ddx21b_predicted
DEAD (Asp-Glu-Ala-Asp) box polypeptide 21b (predicted)
Symbol and Name status set to approved
70820 APPROVED
