Symbol:
Lsm4
Name:
LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
RGD ID:
1306808
Description:
Predicted to enable PH domain binding activity and U6 snRNA binding activity. Predicted to be involved in P-body assembly and spliceosomal snRNP assembly. Predicted to be located in cytosol; membrane; and nucleus. Predicted to be part of Lsm2-8 complex; U2-type precatalytic spliceosome; and spliceosomal snRNP complex. Predicted to be active in P-body. Orthologous to human LSM4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated); PARTICIPATES IN spliceosome pathway; RNA degradation pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC290647; LSM4 homolog, U6 small nuclear RNA associated; LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae); LSM4 U6 small nuclear RNA and mRNA degradation associated; U6 snRNA-associated Sm-like protein LSm4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LSM4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Lsm4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lsm4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LSM4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LSM4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lsm4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LSM4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LSM4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lsm4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DRG1 (developmentally regulated GTP binding protein 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
LSM4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Lsm4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lsm4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG17768
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
LSM4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
lsm-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
lsm4
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,789,466 - 18,795,164 (-) NCBI GRCr8 mRatBN7.2 16 18,755,481 - 18,761,106 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,755,484 - 18,760,926 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,797,134 - 18,802,546 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 19,930,058 - 19,935,475 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 18,850,088 - 18,855,500 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 20,506,399 - 20,511,818 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 20,506,399 - 20,511,818 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 20,363,442 - 20,368,886 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 19,261,065 - 19,266,484 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 19,261,067 - 19,266,367 (-) NCBI Celera 16 18,947,390 - 18,952,806 (-) NCBI Celera Cytogenetic Map 16 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lsm4 Rat 1,2-dimethylhydrazine multiple interactions ISO Lsm4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of LSM4 mRNA CTD PMID:22206623 Lsm4 Rat 17alpha-ethynylestradiol increases expression ISO Lsm4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of LSM4 mRNA CTD PMID:17942748 Lsm4 Rat 17alpha-ethynylestradiol multiple interactions ISO Lsm4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LSM4 mRNA CTD PMID:17942748 Lsm4 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of LSM4 mRNA CTD PMID:32145629 Lsm4 Rat 17beta-estradiol increases expression ISO Lsm4 (Mus musculus) 6480464 Estradiol results in increased expression of LSM4 mRNA CTD PMID:39298647 Lsm4 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Lsm4 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Lsm4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Lsm4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LSM4 mRNA CTD PMID:17942748 Lsm4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of LSM4 mRNA CTD PMID:34747641 Lsm4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Lsm4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LSM4 mRNA CTD PMID:21570461 Lsm4 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of LSM4 mRNA CTD PMID:21346803 Lsm4 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of LSM4 mRNA CTD PMID:21346803 Lsm4 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of LSM4 mRNA CTD PMID:21346803 Lsm4 Rat 2-palmitoylglycerol increases expression ISO LSM4 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of LSM4 mRNA CTD PMID:37199045 Lsm4 Rat 3-methylcholanthrene increases expression ISO Lsm4 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of LSM4 mRNA CTD PMID:20713471 Lsm4 Rat 4,4'-sulfonyldiphenol affects expression ISO Lsm4 (Mus musculus) 6480464 bisphenol S affects the expression of LSM4 mRNA CTD PMID:39298647 Lsm4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of LSM4 mRNA CTD PMID:30047161 Lsm4 Rat 7,12-dimethyltetraphene increases expression ISO Lsm4 (Mus musculus) 6480464 9 more ... CTD PMID:38307155 Lsm4 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of LSM4 mRNA CTD PMID:28959563 Lsm4 Rat aflatoxin B1 decreases methylation ISO LSM4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of LSM4 intron CTD PMID:30157460 Lsm4 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of LSM4 mRNA CTD PMID:30047161 Lsm4 Rat antirheumatic drug decreases expression ISO LSM4 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of LSM4 mRNA CTD PMID:24449571 Lsm4 Rat arsane affects methylation ISO LSM4 (Homo sapiens) 6480464 Arsenic affects the methylation of LSM4 gene CTD PMID:25304211 Lsm4 Rat arsane multiple interactions ISO LSM4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LSM4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of LSM4 mRNA CTD PMID:39836092 Lsm4 Rat arsenic atom affects methylation ISO LSM4 (Homo sapiens) 6480464 Arsenic affects the methylation of LSM4 gene CTD PMID:25304211 Lsm4 Rat arsenic atom multiple interactions ISO LSM4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LSM4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of LSM4 mRNA CTD PMID:39836092 Lsm4 Rat arsenite(3-) multiple interactions ISO LSM4 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to LSM4 mRNA] CTD PMID:32406909 Lsm4 Rat benzo[a]pyrene decreases expression ISO Lsm4 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of LSM4 mRNA CTD PMID:20127859 Lsm4 Rat benzo[a]pyrene affects methylation ISO LSM4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of LSM4 intron CTD PMID:30157460 Lsm4 Rat benzo[b]fluoranthene increases expression ISO Lsm4 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of LSM4 mRNA CTD PMID:26377693 Lsm4 Rat bis(2-ethylhexyl) phthalate increases expression ISO Lsm4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of LSM4 mRNA CTD PMID:33754040 Lsm4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of LSM4 mRNA CTD PMID:25181051 Lsm4 Rat bisphenol A increases expression ISO Lsm4 (Mus musculus) 6480464 bisphenol A results in increased expression of LSM4 mRNA CTD PMID:32156529 Lsm4 Rat bisphenol A increases expression ISO LSM4 (Homo sapiens) 6480464 bisphenol A results in increased expression of LSM4 protein CTD PMID:37567409 Lsm4 Rat bisphenol A decreases expression ISO LSM4 (Homo sapiens) 6480464 bisphenol A results in decreased expression of LSM4 protein CTD PMID:31675489 Lsm4 Rat bisphenol A decreases expression ISO Lsm4 (Mus musculus) 6480464 bisphenol A results in decreased expression of LSM4 mRNA CTD PMID:33221593 and PMID:35598803 Lsm4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LSM4 mRNA CTD PMID:32145629 Lsm4 Rat bisphenol A affects expression ISO LSM4 (Homo sapiens) 6480464 bisphenol A affects the expression of LSM4 mRNA CTD PMID:30903817 Lsm4 Rat Bisphenol B increases expression ISO LSM4 (Homo sapiens) 6480464 bisphenol B results in increased expression of LSM4 protein CTD PMID:34186270 Lsm4 Rat bisphenol F increases expression ISO LSM4 (Homo sapiens) 6480464 bisphenol F results in increased expression of LSM4 protein CTD PMID:34186270 Lsm4 Rat bortezomib decreases expression ISO LSM4 (Homo sapiens) 6480464 Bortezomib results in decreased expression of LSM4 mRNA CTD PMID:20977926 Lsm4 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of LSM4 promoter CTD PMID:22457795 Lsm4 Rat chlorpyrifos decreases expression ISO Lsm4 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of LSM4 mRNA CTD PMID:37019170 Lsm4 Rat clobetasol increases expression ISO Lsm4 (Mus musculus) 6480464 Clobetasol results in increased expression of LSM4 mRNA CTD PMID:27462272 Lsm4 Rat clofibrate decreases expression ISO Lsm4 (Mus musculus) 6480464 Clofibrate results in decreased expression of LSM4 mRNA CTD PMID:17585979 Lsm4 Rat cobalt dichloride decreases expression ISO LSM4 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of LSM4 mRNA CTD PMID:19376846 Lsm4 Rat copper(II) sulfate decreases expression ISO LSM4 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of LSM4 mRNA CTD PMID:19549813 Lsm4 Rat coumestrol increases expression ISO LSM4 (Homo sapiens) 6480464 Coumestrol results in increased expression of LSM4 mRNA CTD PMID:19167446 Lsm4 Rat cyclosporin A decreases expression ISO LSM4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of LSM4 mRNA CTD PMID:25562108 Lsm4 Rat dextran sulfate increases expression ISO Lsm4 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of LSM4 mRNA CTD PMID:35093514 Lsm4 Rat dextran sulfate decreases expression ISO Lsm4 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of LSM4 protein CTD PMID:35362542 Lsm4 Rat dextran sulfate multiple interactions ISO Lsm4 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of LSM4 protein] CTD PMID:35362542 Lsm4 Rat diazinon increases methylation ISO LSM4 (Homo sapiens) 6480464 Diazinon results in increased methylation of LSM4 gene CTD PMID:22964155 Lsm4 Rat Dibutyl phosphate affects expression ISO LSM4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of LSM4 mRNA CTD PMID:37042841 Lsm4 Rat dibutyl phthalate decreases expression ISO Lsm4 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of LSM4 mRNA CTD PMID:17361019 Lsm4 Rat dioxygen multiple interactions ISO Lsm4 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of LSM4 mRNA CTD PMID:30529165 Lsm4 Rat doxorubicin increases expression ISO LSM4 (Homo sapiens) 6480464 Doxorubicin results in increased expression of LSM4 mRNA CTD PMID:29803840 Lsm4 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of LSM4 mRNA CTD PMID:29391264 Lsm4 Rat Evodiamine multiple interactions ISO Lsm4 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of LSM4 protein] CTD PMID:35362542 Lsm4 Rat fenthion decreases expression ISO Lsm4 (Mus musculus) 6480464 Fenthion results in decreased expression of LSM4 mRNA CTD PMID:34813904 Lsm4 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of LSM4 mRNA CTD PMID:24136188 Lsm4 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of LSM4 mRNA CTD PMID:24136188 Lsm4 Rat folic acid multiple interactions ISO Lsm4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of LSM4 mRNA CTD PMID:22206623 Lsm4 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of LSM4 mRNA CTD PMID:24136188 Lsm4 Rat inulin multiple interactions ISO Lsm4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of LSM4 mRNA CTD PMID:36331819 Lsm4 Rat ivermectin decreases expression ISO LSM4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of LSM4 protein CTD PMID:32959892 Lsm4 Rat manganese atom multiple interactions ISO LSM4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LSM4 mRNA CTD PMID:39836092 Lsm4 Rat manganese(0) multiple interactions ISO LSM4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LSM4 mRNA CTD PMID:39836092 Lsm4 Rat manganese(II) chloride multiple interactions ISO LSM4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LSM4 mRNA CTD PMID:39836092 Lsm4 Rat methidathion decreases expression ISO Lsm4 (Mus musculus) 6480464 methidathion results in decreased expression of LSM4 mRNA CTD PMID:34813904 Lsm4 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of LSM4 mRNA CTD PMID:30047161 Lsm4 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of LSM4 gene CTD PMID:35440735 Lsm4 Rat nitrates multiple interactions ISO Lsm4 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of LSM4 mRNA CTD PMID:35964746 Lsm4 Rat ozone multiple interactions ISO LSM4 (Homo sapiens) 6480464 [Ozone results in increased abundance of Soot metabolite] which results in increased expression of LSM4 mRNA CTD PMID:28410501 Lsm4 Rat ozone multiple interactions ISO Lsm4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of LSM4 mRNA CTD PMID:34911549 Lsm4 Rat paracetamol affects expression ISO Lsm4 (Mus musculus) 6480464 Acetaminophen affects the expression of LSM4 mRNA CTD PMID:17562736 Lsm4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Lsm4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of LSM4 mRNA CTD PMID:36331819 Lsm4 Rat phenobarbital affects expression ISO LSM4 (Homo sapiens) 6480464 Phenobarbital affects the expression of LSM4 mRNA CTD PMID:19159669 Lsm4 Rat pirinixic acid increases expression ISO Lsm4 (Mus musculus) 6480464 pirinixic acid results in increased expression of LSM4 mRNA CTD PMID:18301758 Lsm4 Rat quercetin increases expression ISO LSM4 (Homo sapiens) 6480464 Quercetin results in increased expression of LSM4 mRNA CTD PMID:21632981 Lsm4 Rat resveratrol increases expression ISO LSM4 (Homo sapiens) 6480464 resveratrol results in increased expression of LSM4 mRNA CTD PMID:25436977 Lsm4 Rat SB 431542 multiple interactions ISO LSM4 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of LSM4 protein CTD PMID:37664457 Lsm4 Rat sodium arsenite decreases expression ISO Lsm4 (Mus musculus) 6480464 sodium arsenite results in decreased expression of LSM4 protein CTD PMID:29044176 Lsm4 Rat sodium arsenite multiple interactions ISO LSM4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LSM4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of LSM4 mRNA CTD PMID:39836092 Lsm4 Rat sodium arsenite increases expression ISO LSM4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of LSM4 mRNA CTD PMID:34032870 Lsm4 Rat sodium arsenite decreases expression ISO LSM4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of LSM4 mRNA CTD PMID:38568856 Lsm4 Rat sodium fluoride decreases expression ISO Lsm4 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of LSM4 protein CTD PMID:28918527 Lsm4 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of LSM4 mRNA CTD PMID:30047161 Lsm4 Rat temozolomide increases expression ISO LSM4 (Homo sapiens) 6480464 Temozolomide results in increased expression of LSM4 mRNA CTD PMID:31758290 Lsm4 Rat tert-butyl hydroperoxide decreases expression ISO LSM4 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of LSM4 mRNA CTD PMID:15336504 Lsm4 Rat tetrachloromethane affects expression ISO Lsm4 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of LSM4 mRNA CTD PMID:17484886 Lsm4 Rat titanium dioxide increases expression ISO Lsm4 (Mus musculus) 6480464 titanium dioxide results in increased expression of LSM4 mRNA CTD PMID:23557971 Lsm4 Rat titanium dioxide decreases methylation ISO Lsm4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of LSM4 gene and titanium dioxide results in decreased methylation of LSM4 promoter CTD PMID:35295148 Lsm4 Rat triptonide decreases expression ISO Lsm4 (Mus musculus) 6480464 triptonide results in decreased expression of LSM4 mRNA CTD PMID:33045310 Lsm4 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of LSM4 mRNA CTD PMID:24136188 Lsm4 Rat tungsten increases expression ISO Lsm4 (Mus musculus) 6480464 Tungsten results in increased expression of LSM4 mRNA CTD PMID:30912803 Lsm4 Rat tunicamycin decreases expression ISO LSM4 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of LSM4 mRNA CTD PMID:22378314 Lsm4 Rat valproic acid affects expression ISO LSM4 (Homo sapiens) 6480464 Valproic Acid affects the expression of LSM4 mRNA CTD PMID:25979313 Lsm4 Rat vorinostat increases expression ISO LSM4 (Homo sapiens) 6480464 vorinostat results in increased expression of LSM4 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-palmitoylglycerol (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acrylamide (EXP) aflatoxin B1 (ISO) amitrole (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) bortezomib (ISO) cadmium dichloride (EXP) chlorpyrifos (ISO) clobetasol (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) dextran sulfate (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dioxygen (ISO) doxorubicin (ISO) endosulfan (EXP) Evodiamine (ISO) fenthion (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) glafenine (EXP) inulin (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methidathion (ISO) methimazole (EXP) methoxychlor (EXP) nitrates (ISO) ozone (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) quercetin (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) triptonide (ISO) trovafloxacin (EXP) tungsten (ISO) tunicamycin (ISO) valproic acid (ISO) vorinostat (ISO)
1.
Proteomic analysis of in vivo-assembled pre-mRNA splicing complexes expands the catalog of participating factors.
Chen YI, etal., Nucleic Acids Res. 2007;35(12):3928-44. Epub 2007 May 30.
2.
Dendritic LSm1/CBP80-mRNPs mark the early steps of transport commitment and translational control.
di Penta A, etal., J Cell Biol. 2009 Feb 9;184(3):423-35. doi: 10.1083/jcb.200807033. Epub 2009 Feb 2.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Comprehensive gene review and curation
RGD comprehensive gene curation
10.
The spliceosome: design principles of a dynamic RNP machine.
Wahl MC, etal., Cell. 2009 Feb 20;136(4):701-18. doi: 10.1016/j.cell.2009.02.009.
11.
Aberrantly Methylated-Differentially Expressed Genes Identify Novel Atherosclerosis Risk Subtypes.
Xue Y, etal., Front Genet. 2020 Dec 14;11:569572. doi: 10.3389/fgene.2020.569572. eCollection 2020.
Lsm4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,789,466 - 18,795,164 (-) NCBI GRCr8 mRatBN7.2 16 18,755,481 - 18,761,106 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,755,484 - 18,760,926 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,797,134 - 18,802,546 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 19,930,058 - 19,935,475 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 18,850,088 - 18,855,500 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 20,506,399 - 20,511,818 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 20,506,399 - 20,511,818 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 20,363,442 - 20,368,886 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 19,261,065 - 19,266,484 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 19,261,067 - 19,266,367 (-) NCBI Celera 16 18,947,390 - 18,952,806 (-) NCBI Celera Cytogenetic Map 16 p14 NCBI
LSM4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 18,306,236 - 18,323,076 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 18,306,236 - 18,323,112 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 18,417,046 - 18,433,886 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 18,278,717 - 18,294,962 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 18,278,717 - 18,294,958 NCBI Celera 19 18,319,475 - 18,335,755 (-) NCBI Celera Cytogenetic Map 19 p13.11 NCBI HuRef 19 17,980,724 - 17,997,682 (-) NCBI HuRef CHM1_1 19 18,417,296 - 18,434,252 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 18,440,354 - 18,457,193 (-) NCBI T2T-CHM13v2.0
Lsm4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 71,124,663 - 71,131,402 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 71,125,898 - 71,131,402 (+) Ensembl GRCm39 Ensembl GRCm38 8 70,673,231 - 70,678,752 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 70,673,248 - 70,678,752 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 73,197,130 - 73,202,651 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 73,602,381 - 73,607,741 (+) NCBI MGSCv36 mm8 Celera 8 73,229,842 - 73,235,362 (+) NCBI Celera Cytogenetic Map 8 B3.3 NCBI cM Map 8 34.15 NCBI
Lsm4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955524 3,157,607 - 3,165,196 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955524 3,157,607 - 3,165,196 (+) NCBI ChiLan1.0 ChiLan1.0
LSM4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 23,167,478 - 23,183,873 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 22,175,796 - 22,192,193 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 17,785,580 - 17,801,866 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 18,757,390 - 18,773,812 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 18,757,390 - 18,773,812 (-) Ensembl panpan1.1 panPan2
LSM4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 44,707,460 - 44,720,490 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 44,707,460 - 44,720,490 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 44,621,620 - 44,634,648 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 45,193,083 - 45,206,148 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 45,193,083 - 45,206,124 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 44,430,435 - 44,443,463 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 44,840,880 - 44,853,912 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 45,116,311 - 45,129,341 (+) NCBI UU_Cfam_GSD_1.0
Lsm4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 203,354,208 - 203,367,493 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936596 2,903,358 - 2,916,629 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936596 2,903,363 - 2,916,629 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LSM4
LSM4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 16,783,566 - 16,800,116 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 16,782,746 - 16,800,143 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 2,555,195 - 2,572,041 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lsm4
.
Predicted Target Of
Count of predictions: 265 Count of miRNA genes: 184 Interacting mature miRNAs: 197 Transcripts: ENSRNOT00000026567 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 631517 Scl9 Serum cholesterol level QTL 9 3.3 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 16 15726433 21034895 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 1600369 Hcas8 Hepatocarcinoma susceptibility QTL 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 16 1 22477621 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 1300133 Rf24 Renal function QTL 24 3.64 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 16 3380150 21361552 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
RH133230
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 18,760,978 - 18,761,184 (+) MAPPER mRatBN7.2 Rnor_6.0 16 20,511,896 - 20,512,101 NCBI Rnor6.0 Rnor_5.0 16 20,368,964 - 20,369,169 UniSTS Rnor5.0 RGSC_v3.4 16 19,266,562 - 19,266,767 UniSTS RGSC3.4 Celera 16 18,952,884 - 18,953,089 UniSTS RH 3.4 Map 16 190.5 UniSTS Cytogenetic Map 16 p14 UniSTS
RH141667
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 18,761,407 - 18,761,596 (+) MAPPER mRatBN7.2 Rnor_6.0 16 20,512,325 - 20,512,513 NCBI Rnor6.0 Rnor_5.0 16 20,369,393 - 20,369,581 UniSTS Rnor5.0 RGSC_v3.4 16 19,266,991 - 19,267,179 UniSTS RGSC3.4 Celera 16 18,953,313 - 18,953,501 UniSTS RH 3.4 Map 16 181.8 UniSTS Cytogenetic Map 16 p14 UniSTS
RH129410
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 18,755,482 - 18,755,688 (+) MAPPER mRatBN7.2 Rnor_6.0 16 20,506,400 - 20,506,605 NCBI Rnor6.0 Rnor_5.0 16 20,363,468 - 20,363,673 UniSTS Rnor5.0 RGSC_v3.4 16 19,261,066 - 19,261,271 UniSTS RGSC3.4 Celera 16 18,947,391 - 18,947,596 UniSTS RH 3.4 Map 16 181.8 UniSTS Cytogenetic Map 16 p14 UniSTS
LSM4
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 16 18,790,146 - 18,790,284 (+) Marker Load Pipeline mRatBN7.2 16 18,756,161 - 18,756,298 (+) MAPPER mRatBN7.2 Rnor_6.0 16 20,507,079 - 20,507,215 NCBI Rnor6.0 Rnor_5.0 16 20,364,147 - 20,364,283 UniSTS Rnor5.0 RGSC_v3.4 16 19,261,745 - 19,261,881 UniSTS RGSC3.4 Celera 16 18,948,070 - 18,948,206 UniSTS Cytogenetic Map 16 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026567 ⟹ ENSRNOP00000026567
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 18,755,484 - 18,760,926 (-) Ensembl Rnor_6.0 Ensembl 16 20,506,399 - 20,511,818 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097247 ⟹ ENSRNOP00000095698
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 18,755,723 - 18,757,622 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119396 ⟹ ENSRNOP00000083403
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 18,755,484 - 18,760,926 (-) Ensembl
RefSeq Acc Id:
NM_001106073 ⟹ NP_001099543
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,789,467 - 18,794,886 (-) NCBI mRatBN7.2 16 18,755,482 - 18,760,901 (-) NCBI Rnor_6.0 16 20,506,399 - 20,511,818 (-) NCBI Rnor_5.0 16 20,363,442 - 20,368,886 (-) NCBI RGSC_v3.4 16 19,261,065 - 19,266,484 (-) RGD Celera 16 18,947,390 - 18,952,806 (-) RGD
Sequence:
GGAATACGACGCGATACGCCGCCGCGTTATGTAGGCACCGCCTTATCCCGTTCCGATTGGATCGGTCCATTTAGTCACTCGCTGATTGGTTATAGTTTCTGCCAGTCTTTTTCAGGCTGGAGCGCGCG
hide sequence
RefSeq Acc Id:
XM_039094317 ⟹ XP_038950245
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,789,466 - 18,794,792 (-) NCBI mRatBN7.2 16 18,755,481 - 18,760,807 (-) NCBI
RefSeq Acc Id:
XM_039094318 ⟹ XP_038950246
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,790,506 - 18,795,164 (-) NCBI mRatBN7.2 16 18,756,521 - 18,761,106 (-) NCBI
RefSeq Acc Id:
XM_063275158 ⟹ XP_063131228
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 18,789,466 - 18,794,919 (-) NCBI
RefSeq Acc Id:
NP_001099543 ⟸ NM_001106073
- UniProtKB:
D4A2C6 (UniProtKB/TrEMBL), A6KA13 (UniProtKB/TrEMBL)
- Sequence:
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVREEAAKGRGRGGPQQQKQQKGRGMGGAGRGVFGGRGRGGIPGAGRGQPE
hide sequence
Ensembl Acc Id:
ENSRNOP00000026567 ⟸ ENSRNOT00000026567
RefSeq Acc Id:
XP_038950245 ⟸ XM_039094317
- Peptide Label:
isoform X2
- UniProtKB:
A6KA14 (UniProtKB/TrEMBL), A0A8I5ZZ77 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038950246 ⟸ XM_039094318
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSRNOP00000083403 ⟸ ENSRNOT00000119396
Ensembl Acc Id:
ENSRNOP00000095698 ⟸ ENSRNOT00000097247
RefSeq Acc Id:
XP_063131228 ⟸ XM_063275158
- Peptide Label:
isoform X1
- UniProtKB:
A6KA13 (UniProtKB/TrEMBL), D4A2C6 (UniProtKB/TrEMBL)
RGD ID: 13700020 Promoter ID: EPDNEW_R10543 Type: initiation region Name: Lsm4_1 Description: LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 20,511,688 - 20,511,748 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-07-09
Lsm4
LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
Lsm4
LSM4 U6 small nuclear RNA and mRNA degradation associated
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-07-01
Lsm4
LSM4 U6 small nuclear RNA and mRNA degradation associated
Lsm4
LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Lsm4
LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Lsm4_predicted
LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Lsm4_predicted
LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (predicted)
Symbol and Name status set to approved
70820 APPROVED
