Advanced Search (OLGA)

Gene: Lmf2 (lipase maturation factor 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Lmf2

Name:

lipase maturation factor 2

RGD ID:

1306274

Description:

Predicted to be involved in protein maturation. Predicted to be active in endoplasmic reticulum membrane. Orthologous to human LMF2 (lipase maturation factor 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; coumarin.

Type:

protein-coding (Ensembl: pseudogene)

RefSeq Status:

PROVISIONAL

Previously known as:

LOC315218; RGD1306274; similar to hypothetical protein BC002942; Tmem112b; transmembrane protein 112B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LMF2 (lipase maturation factor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Lmf2 (lipase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lmf2 (lipase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LMF2 (lipase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LMF2 (lipase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lmf2 (lipase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LMF2 (lipase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LMF2 (lipase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lmf2 (lipase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SLC25A45 (solute carrier family 25 member 45)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Lmf2 (lipase maturation factor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	LMF2 (lipase maturation factor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lmf2b (lipase maturation factor 2b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	lmf2a (lipase maturation factor 2a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	K11G12.6	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	lmf2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	122,297,971 - 122,302,423 (-)	NCBI		GRCr8
mRatBN7.2	7	120,418,343 - 120,422,825 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	120,418,345 - 120,422,823 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	122,169,034 - 122,173,490 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	124,395,189 - 124,399,644 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	124,357,860 - 124,362,311 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	130,322,018 - 130,326,470 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	130,322,020 - 130,326,470 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	130,007,319 - 130,011,771 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	127,646,134 - 127,650,588 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	127,680,363 - 127,684,818 (-)	NCBI
Celera	7	116,892,158 - 116,895,843 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lmf2	Rat	autism spectrum disorder		ISO	RGD:1606481	8554872	ClinVar Annotator: match by term: Autism spectrum disorder	ClinVar	PMID:11391650\|PMID:21984750\|PMID:21984751\|PMID:25255310
Lmf2	Rat	chromosome 22q13 duplication syndrome		ISO	RGD:1606481	8554872	ClinVar Annotator: match by term: Chromosome 22q13 duplication syndrome	ClinVar	PMID:31690835
Lmf2	Rat	congenital disorder of glycosylation Ig		ISO	RGD:1606481	8554872	ClinVar Annotator: match by term: ALG12-congenital disorder of glycosylation	ClinVar	PMID:15639192\|PMID:28492532\|PMID:31481313
Lmf2	Rat	intellectual disability		ISO	RGD:1606481	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
Lmf2	Rat	megaconial type congenital muscular dystrophy		ISO	RGD:1606481	8554872	ClinVar Annotator: match by term: Megaconial type congenital muscular dystrophy	ClinVar	PMID:21665002\|PMID:28492532
Lmf2	Rat	metachromatic leukodystrophy		ISO	RGD:1606481	8554872	ClinVar Annotator: match by term: Metachromatic leukodystrophy	ClinVar	PMID:10477432\|PMID:15211666\|PMID:25344692\|PMID:28492532\|PMID:30057904\|PMID:8962139
Lmf2	Rat	Phelan-McDermid syndrome		ISO	RGD:1606481	8554872	ClinVar Annotator: match by term: Phelan-McDermid syndrome	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lmf2	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1314800	6480464	Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of LMF2 mRNA]	CTD	PMID:22206623
Lmf2	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:1314800	6480464	1,2-Dimethylhydrazine results in increased expression of LMF2 mRNA	CTD	PMID:22206623
Lmf2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of LMF2 mRNA	CTD	PMID:21215274
Lmf2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of LMF2 mRNA	CTD	PMID:33387578\|PMID:34747641
Lmf2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1314800	6480464	Tetrachlorodibenzodioxin affects the expression of LMF2 mRNA	CTD	PMID:21570461
Lmf2	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1314800	6480464	bisphenol S results in decreased expression of LMF2 mRNA	CTD	PMID:39298647
Lmf2	Rat	aristolochic acid A	decreases expression	ISO	RGD:1606481	6480464	aristolochic acid I results in decreased expression of LMF2 protein	CTD	PMID:33212167
Lmf2	Rat	arsane	multiple interactions	ISO	RGD:1606481	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Lmf2	Rat	arsenic atom	multiple interactions	ISO	RGD:1606481	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Lmf2	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1314800	6480464	Benzo(a)pyrene promotes the reaction [AHR protein binds to LMF2 promoter]	CTD	PMID:19654925
Lmf2	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1314800	6480464	Benzo(a)pyrene results in increased expression of LMF2 mRNA	CTD	PMID:22228805
Lmf2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of LMF2 mRNA	CTD	PMID:25181051
Lmf2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of LMF2 mRNA	CTD	PMID:30816183\|PMID:34947998
Lmf2	Rat	bisphenol A	decreases expression	ISO	RGD:1606481	6480464	bisphenol A results in decreased expression of LMF2 mRNA	CTD	PMID:29275510
Lmf2	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of LMF2 gene	CTD	PMID:28505145
Lmf2	Rat	butan-1-ol	multiple interactions	ISO	RGD:1606481	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ...	CTD	PMID:29432896
Lmf2	Rat	CGP 52608	multiple interactions	ISO	RGD:1606481	6480464	CGP 52608 promotes the reaction [RORA protein binds to LMF2 gene]	CTD	PMID:28238834
Lmf2	Rat	coumarin	increases expression	EXP		6480464	coumarin results in increased expression of LMF2 mRNA	CTD	PMID:18480146
Lmf2	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of LMF2 mRNA	CTD	PMID:26577399
Lmf2	Rat	dioxygen	multiple interactions	ISO	RGD:1314800	6480464	[sulforaphane affects the susceptibility to Oxygen] which affects the expression of LMF2 mRNA	CTD	PMID:30529165
Lmf2	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of LMF2 mRNA	CTD	PMID:24136188
Lmf2	Rat	folic acid	multiple interactions	ISO	RGD:1314800	6480464	Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of LMF2 mRNA]	CTD	PMID:22206623
Lmf2	Rat	glyphosate	increases methylation	EXP		6480464	Glyphosate results in increased methylation of LMF2 gene	CTD	PMID:31011160
Lmf2	Rat	ivermectin	decreases expression	ISO	RGD:1606481	6480464	Ivermectin results in decreased expression of LMF2 protein	CTD	PMID:32959892
Lmf2	Rat	manganese atom	multiple interactions	ISO	RGD:1606481	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Lmf2	Rat	manganese(0)	multiple interactions	ISO	RGD:1606481	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Lmf2	Rat	manganese(II) chloride	multiple interactions	ISO	RGD:1606481	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Lmf2	Rat	methamphetamine	increases expression	ISO	RGD:1314800	6480464	Methamphetamine results in increased expression of LMF2 mRNA	CTD	PMID:26307267
Lmf2	Rat	ozone	multiple interactions	ISO	RGD:1606481	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of LMF2 mRNA	CTD	PMID:35430440
Lmf2	Rat	paracetamol	affects expression	ISO	RGD:1314800	6480464	Acetaminophen affects the expression of LMF2 mRNA	CTD	PMID:17562736
Lmf2	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of LMF2 mRNA	CTD	PMID:33387578
Lmf2	Rat	pentachlorophenol	increases expression	ISO	RGD:1314800	6480464	Pentachlorophenol results in increased expression of LMF2 mRNA	CTD	PMID:23892564
Lmf2	Rat	perfluorooctanoic acid	decreases expression	ISO	RGD:1606481	6480464	perfluorooctanoic acid results in decreased expression of LMF2 protein	CTD	PMID:26879310
Lmf2	Rat	pirinixic acid	increases expression	ISO	RGD:1314800	6480464	pirinixic acid results in increased expression of LMF2 mRNA	CTD	PMID:23811191
Lmf2	Rat	resveratrol	increases expression	ISO	RGD:1314800	6480464	resveratrol results in increased expression of LMF2 protein	CTD	PMID:25505154
Lmf2	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of LMF2 mRNA	CTD	PMID:28374803
Lmf2	Rat	sodium arsenite	increases expression	ISO	RGD:1606481	6480464	sodium arsenite results in increased expression of LMF2 mRNA	CTD	PMID:38568856
Lmf2	Rat	sodium arsenite	multiple interactions	ISO	RGD:1606481	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:33939924\|PMID:39836092
Lmf2	Rat	Soman	increases expression	EXP		6480464	Soman results in increased expression of LMF2 mRNA	CTD	PMID:19281266
Lmf2	Rat	sulforaphane	multiple interactions	ISO	RGD:1314800	6480464	[sulforaphane affects the susceptibility to Oxygen] which affects the expression of LMF2 mRNA	CTD	PMID:30529165
Lmf2	Rat	sulindac	decreases expression	EXP		6480464	Sulindac results in decreased expression of LMF2 mRNA	CTD	PMID:24136188
Lmf2	Rat	temozolomide	decreases expression	ISO	RGD:1606481	6480464	Temozolomide results in decreased expression of LMF2 mRNA	CTD	PMID:31758290
Lmf2	Rat	thapsigargin	increases expression	EXP		6480464	Thapsigargin results in increased expression of LMF2 protein	CTD	PMID:35544339
Lmf2	Rat	titanium dioxide	decreases methylation	ISO	RGD:1314800	6480464	titanium dioxide results in decreased methylation of LMF2 gene	CTD	PMID:35295148
Lmf2	Rat	triphenyl phosphate	affects expression	ISO	RGD:1606481	6480464	triphenyl phosphate affects the expression of LMF2 mRNA	CTD	PMID:37042841
Lmf2	Rat	valproic acid	increases methylation	ISO	RGD:1606481	6480464	Valproic Acid results in increased methylation of LMF2 gene	CTD	PMID:29154799
Lmf2	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of LMF2 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lmf2	Rat	protein maturation	involved_in	IBA	MGI:1923733\|PANTHER:PTN000374938	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Lmf2	Rat	protein maturation	involved_in	IEA	InterPro:IPR009613	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lmf2	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Lmf2	Rat	endoplasmic reticulum membrane	is_active_in	IBA	MGI:1923733\|PANTHER:PTN000374938	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Lmf2	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Lmf2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lmf2	Rat	protein binding	enables	ISO	RGD:1606481	1624291	UniProtKB:Q13137\|UniProtKB:Q15323\|UniProtKB:Q6A162 PMID:25416956	RGD	PMID:25416956
Lmf2	Rat	protein binding	enables	ISO	RGD:1606481,UniProtKB:Q9BU23-2	1624291	UniProtKB:A8MQ03\|UniProtKB:P60410 PMID:32296183	RGD	PMID:32296183

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:19946888

Lmf2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	122,297,971 - 122,302,423 (-)	NCBI		GRCr8
mRatBN7.2	7	120,418,343 - 120,422,825 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	120,418,345 - 120,422,823 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	122,169,034 - 122,173,490 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	124,395,189 - 124,399,644 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	124,357,860 - 124,362,311 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	130,322,018 - 130,326,470 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	130,322,020 - 130,326,470 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	130,007,319 - 130,011,771 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	127,646,134 - 127,650,588 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	127,680,363 - 127,684,818 (-)	NCBI
Celera	7	116,892,158 - 116,895,843 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

LMF2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	50,502,949 - 50,507,702 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	50,502,949 - 50,507,702 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	50,941,378 - 50,946,131 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	49,288,246 - 49,292,979 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	22	34,817,402 - 34,822,161 (-)	NCBI		Celera
Cytogenetic Map	22	q13.33	NCBI
HuRef	22	33,832,434 - 33,837,266 (-)	NCBI		HuRef
CHM1_1	22	50,900,119 - 50,904,701 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	22	51,013,236 - 51,018,273 (-)	NCBI		T2T-CHM13v2.0

Lmf2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	89,235,203 - 89,239,860 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	89,235,207 - 89,239,862 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	89,351,004 - 89,355,694 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	89,351,004 - 89,355,659 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	89,181,435 - 89,186,090 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	89,178,775 - 89,183,251 (-)	NCBI		MGSCv36	mm8
Celera	15	91,480,143 - 91,484,798 (-)	NCBI		Celera
Cytogenetic Map	15	E3	NCBI
cM Map	15	44.84	NCBI

Lmf2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	33,487,917 - 33,492,033 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	33,487,970 - 33,492,033 (-)	NCBI	ChiLan1.0	ChiLan1.0

LMF2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	60,423,350 - 60,428,168 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	63,113,790 - 63,118,967 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	30,749,448 - 30,754,616 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	49,859,550 - 49,864,265 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	49,859,550 - 49,864,237 (-)	Ensembl	panpan1.1		panPan2

LMF2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	16,802,110 - 16,806,471 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	16,801,342 - 16,806,020 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	16,779,795 - 16,784,171 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	17,528,304 - 17,531,440 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	10	17,252,845 - 17,257,220 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	17,575,862 - 17,580,230 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	17,708,089 - 17,712,466 (+)	NCBI		UU_Cfam_GSD_1.0

Lmf2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	332,772 - 336,927 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936629	332,768 - 337,062 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936629	332,772 - 336,927 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LMF2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	233,401 - 238,266 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	233,601 - 238,266 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	110,542,033 - 110,546,699 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LMF2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	32,973,979 - 32,978,433 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	32,974,420 - 32,978,374 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	92,362,295 - 92,366,843 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lmf2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	269,147 - 273,054 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624752	269,054 - 273,316 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Lmf2
33 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	75
Count of miRNA genes:	68
Interacting mature miRNAs:	73
Transcripts:	ENSRNOT00000049538
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1354582	Stl11	Serum triglyceride level QTL 11	3.42		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	119513385	135012528	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
1357339	Stl14	Serum triglyceride level QTL 14	3.45	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	112729683	133492707	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	116677189	127103496	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	112308254	133492884	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
1582240	Sffal1	Serum free fatty acids level QTL 1	3.4	0.0021	blood free fatty acid amount (VT:0001553)	serum free fatty acids level (CMO:0000547)	7	116677010	124049952	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

RH133077

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	120,418,599 - 120,418,798 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	130,322,275 - 130,322,473	NCBI	Rnor6.0
Rnor_5.0	7	130,007,576 - 130,007,774	UniSTS	Rnor5.0
RGSC_v3.4	7	127,646,391 - 127,646,589	UniSTS	RGSC3.4
Celera	7	116,892,413 - 116,892,611	UniSTS
RH 3.4 Map	7	958.3	UniSTS
Cytogenetic Map	7	q34	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001079939	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC125982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088333	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC129102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000049538 ⟹ ENSRNOP00000051363

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	120,418,345 - 120,422,823 (-)	Ensembl
Rnor_6.0 Ensembl	7	130,322,020 - 130,326,470 (-)	Ensembl

RefSeq Acc Id:

NM_001079939 ⟹ NP_001073408

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	122,297,971 - 122,302,423 (-)	NCBI
mRatBN7.2	7	120,418,343 - 120,422,795 (-)	NCBI
Rnor_6.0	7	130,322,018 - 130,326,470 (-)	NCBI
Rnor_5.0	7	130,007,319 - 130,011,771 (-)	NCBI
RGSC_v3.4	7	127,646,134 - 127,650,588 (-)	RGD
Celera	7	116,892,158 - 116,895,843 (-)	RGD

Sequence:

show sequence

CAAGTATCTTGGCCGATTATTGATGAGTTCCTAGGCACTCGGTGGAGCTCAGTGACTGGAAGGATTCCGGGTGGGGCGTGGGCCAGAGGCGGGACTGGGGGCGGGTGGGAAACCAGAGGGCACTGTTT
CAGCAGGCCGTGTAGCGGACATGGCTAGCGCCAGGGTTCCACAGCAGCTTTTCCTACAGGGTGTGGCCGCTGTCTACTTGTTCGCCTTTGCGTCCCTCTACACCCAGATCCCAGGCCTCTATGGCCCA
GAGGGCATCCTTCCTGCTCGAAGAACGCTGCGGCCCCAAGGCAAGGGTCGGTGGCAGCAGCTGTGGGAAACACCAACAATTCTGTGGGAGGCACCAAGACTGGGGCTGGATACTGCACAGGGCCTGGA
TTTACTGACCTTACTGGGCACCGTGCTAGCCCTGGGTGCCCTGCTCCTGAACTCCCTGCGACACCCCTTCATCTACCTGCTGCTCTGGGCTGCCTACCTATCAGCCTGCCAGGTGGGCCAAGTGTTCC
TTTATTTCCAGTGGGATTCCCTGCTGCTGGAGACAGGCTTCCTGGCTATTCTGGTAGCCCCCCTGAGGCGGCCTTCCAAACACAAGATTCCCCAGGGTGGATTAGCAGGAGCCTTACCCCATGAAGAC
CTCCCATTCTGGCTTGTACGCTGGCTGCTCTTCCGACTCATGTTCGCCTCTGGTGTGGTCAAGCTGACCAGCCGCTGCCCTGCGTGGTGGGGACTCACTGCTCTGACCTACCACTATGAGACACAGTG
CCTGCCCACACCAGCTGCCTGGTTTGCCCACCACCTGCCAGTCTGGCTGCACAGGCTCAGCGTGGTGGCCACCTTCCTCATCGAGATTGCGGTGCCACCCCTGTTCTTTGCCCCCATTCGCCGCCTAC
GACTGTCCGCCTTCTATGCTCAGGCCTTACTGCAAATCCTGATTATCATTACGGGTAACTACAATTTCTTCAACCTGCTAACCTTGGTGCTCACCACTGCCCTCCTGGATGACCGTCACCTGTCCGCT
GAGCCCGAACTCAGATGCCACAAGAAGATGCCCACCTCCTGGCCCAAGACCCTGCTGACCTCGCTGTCCTTAATGCTGGAACTGACCGTCTATGGGCTGCTGGCCTACGGCACCATCTACTACTTTGG
GCTGGAGGTCGACTGGCAGCAGCAAATCGTTCTCTCTAAAACCACTTTCACGTTCCATCAGTTCTCCCAGTGGCTGAAGATGGTCACCCTGCCAACTGTGTGGCTGGGGACAGCCTCCCTAGCCTGGG
AGCTGCTTATTGCCCTCTGGAGGTGGATCCAGGTACAAGGATGGTCACGGAAGTTCTTTGCGGGTATCCAGCTCTCAGTCCTGGGCACTGCTACAGTGTTCTTGTTCCTGATCAGCCTGGTGCCTTAC
TCCTATGTGGAGCCTGGGACCCACGGTCGTCTCTGGACTGGGGCTCATCGCCTGTTCAGTTCTGTGGAGCACCTGCAGCTGGCCAACTCTTACGGCCTTTTCCGTCGGATGACTGGCCTGGGGGGGCG
ACCTGAAGTGGTGCTAGAGGGCAGCCATGATGGACACCATTGGACAGAGATTGAATTCATGTACAAACCTGGGAATGTGAGCCGACCACCCCCTTTCCTGATTCCTCACCAGCCGCGCCTTGATTGGC
AGATGTGGTTTGCAGCCCTTGGCCCACATACACACAGCCCCTGGTTCACCAGCCTGGTGCTGCGCCTCCTGCAGGGCAAGGAGCCAGTGATCCGACTGATCCAGAACCAGGTTGCCAACTACCCCTTT
CGTGAGCAGCCACCCACCTACCTGCGGGCCCAGCGCTATAAGTACTGGTTCTCAAAGCCTGGGGATCAGAGCCGCTGGTGGCACCGCCAGTGGGTAGAGGAATTCTTCCCATCTGTATCCTTGGGGGA
CCCAACCCTGGAGACACTGCTCCAACAGTTTGGACTAAAGGATAAGAGTCCACCCCGGGCCCGCAGCTCCAAAAATGCCCTTGCTCAGACACTGAACTGGGTGCGGGCACAGCTGTCTCCTCTGGAGC
CTTCTATCCTGCTATGGGGACTCTTAGGGGCAGTGGTGGCTATCCGAGTTGTGCGGACCCTACTCACCCCCCGCCCGCTCCAGTCCTCAAAACAGACTAGAGAGGAAAAACGTAAGCAGGCTCCCAAG
AAGGACTCCAGAGCTGTCTCTGAGCAGACTGCCCCCAACAGCAACAGCAATGGCTCCTGGGCCCCTCGGCGGAAAAAATAGCTTCATGTGCAATCAGCCAGACATATGTCCTGGTAAAGTCAGAGCCC
CAGGATCCCAGCCCCTACCATGACACAGCCCAGCCACTGTGCCTTAGCCAGTCCTGCCAGGGCAGATACAGACTGGAATGCCACCCCTGAGGATTGCTAGGTGTCACCTTGAGAGTCCTGCTCATCCC
TCTACACCAACCACATCCTTCGCTAGTCACCTTCTACTCTCTTGGCAACCAACCCAGAGTGGGCCTGTGGCCTCGCTCAGGGCTCTTCCTGGAACACTGTAATCAGTGTACCCACAGATGCAAAGGCC
TGAATCTGGAACTCCAACCCATCCCCACTGTGGAGAGGGCGAGCTAAACCTGCTGAGGACAGGAGCCAGGGGAAGTGGGTCCGAGAGAAGGTGCCTGCCTGCCTGCCTGCCTGCCCCTCCGACTGCAC
CAATAAAGGCCCCATTTTTACATACCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001073408	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A1L1J9	(Get FASTA)	NCBI Sequence Viewer
	AAH88333	(Get FASTA)	NCBI Sequence Viewer
	AAI29103	(Get FASTA)	NCBI Sequence Viewer
	EDL76559	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000101764

RefSeq Acc Id:

NP_001073408 ⟸ NM_001079939

- UniProtKB:

Q5I0G9 (UniProtKB/Swiss-Prot), A1L1J9 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MASARVPQQLFLQGVAAVYLFAFASLYTQIPGLYGPEGILPARRTLRPQGKGRWQQLWETPTILWEAPRLGLDTAQGLDLLTLLGTVLALGALLLNSLRHPFIYLLLWAAYLSACQVGQVFLYFQWDS
LLLETGFLAILVAPLRRPSKHKIPQGGLAGALPHEDLPFWLVRWLLFRLMFASGVVKLTSRCPAWWGLTALTYHYETQCLPTPAAWFAHHLPVWLHRLSVVATFLIEIAVPPLFFAPIRRLRLSAFYA
QALLQILIIITGNYNFFNLLTLVLTTALLDDRHLSAEPELRCHKKMPTSWPKTLLTSLSLMLELTVYGLLAYGTIYYFGLEVDWQQQIVLSKTTFTFHQFSQWLKMVTLPTVWLGTASLAWELLIALW
RWIQVQGWSRKFFAGIQLSVLGTATVFLFLISLVPYSYVEPGTHGRLWTGAHRLFSSVEHLQLANSYGLFRRMTGLGGRPEVVLEGSHDGHHWTEIEFMYKPGNVSRPPPFLIPHQPRLDWQMWFAAL
GPHTHSPWFTSLVLRLLQGKEPVIRLIQNQVANYPFREQPPTYLRAQRYKYWFSKPGDQSRWWHRQWVEEFFPSVSLGDPTLETLLQQFGLKDKSPPRARSSKNALAQTLNWVRAQLSPLEPSILLWG
LLGAVVAIRVVRTLLTPRPLQSSKQTREEKRKQAPKKDSRAVSEQTAPNSNSNGSWAPRRKK

hide sequence

Ensembl Acc Id:

ENSRNOP00000051363 ⟸ ENSRNOT00000049538

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A1L1J9-F1-model_v2	AlphaFold	A1L1J9	1-702	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13695584

Promoter ID:

EPDNEW_R6109

Type:

multiple initiation site

Name:

Lmf2_1

Description:

lipase maturation factor 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	130,326,338 - 130,326,398	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-32441	BioCyc
Ensembl Genes	ENSRNOG00000030633	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000049538	ENTREZGENE
IMAGE_CLONE	IMAGE:7099869	IMAGE-MGC_LOAD
	IMAGE:7365896	IMAGE-MGC_LOAD
InterPro	LMF	UniProtKB/Swiss-Prot
KEGG Report	rno:315218	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109593	IMAGE-MGC_LOAD
	MGC:156704	IMAGE-MGC_LOAD
NCBI Gene	315218	ENTREZGENE
PANTHER	LIPASE MATURATION FACTOR 2	UniProtKB/Swiss-Prot
	PTHR14463	UniProtKB/Swiss-Prot
Pfam	LMF1	UniProtKB/Swiss-Prot
PhenoGen	Lmf2	PhenoGen
RatGTEx	ENSRNOG00000030633	RatGTEx
UniProt	A1L1J9	ENTREZGENE, UniProtKB/Swiss-Prot
	Q5I0G9	ENTREZGENE
UniProt Secondary	Q5I0G9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-05-02	Lmf2	lipase maturation factor 2	Tmem112b	transmembrane protein 112B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Tmem112b	transmembrane protein 112B	RGD1306274	similar to hypothetical protein BC002942	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1306274	similar to hypothetical protein BC002942	RGD1306274_predicted	similar to hypothetical protein BC002942 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1306274_predicted	similar to hypothetical protein BC002942 (predicted)	LOC315218_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC315218_predicted	similar to hypothetical protein BC002942 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar