Symbol:
Nenf
Name:
neudesin neurotrophic factor
RGD ID:
1303289
Description:
Predicted to enable growth factor activity. Predicted to be involved in negative regulation of appetite. Predicted to act upstream of or within positive regulation of MAPK cascade. Located in endoplasmic reticulum and mitochondrion. Orthologous to human NENF (neudesin neurotrophic factor); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
neudesin; neuron derived neurotrophic factor; neuron-derived neurotrophic factor; SCIRP10; SCIRP10-related protein; secreted protein of unknown function; Spinal cord injury related protein 10; spinal cord injury-related protein 10; Spuf
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NENF (neudesin neurotrophic factor)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nenf (neuron derived neurotrophic factor)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nenf (neudesin neurotrophic factor)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NENF (neudesin neurotrophic factor)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NENF (neudesin neurotrophic factor)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nenf (neudesin neurotrophic factor)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NENF (neudesin neurotrophic factor)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NENF (neudesin neurotrophic factor)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nenf (neudesin neurotrophic factor)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Nenf (neuron derived neurotrophic factor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NENF (neudesin neurotrophic factor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nenf (neudesin neurotrophic factor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nenf
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 105,419,113 - 105,425,911 (-) NCBI GRCr8 mRatBN7.2 13 102,888,004 - 102,894,804 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 102,888,004 - 102,894,804 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 105,408,038 - 105,414,836 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 106,791,887 - 106,798,681 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 104,006,981 - 104,013,771 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 109,990,294 - 109,997,092 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 109,990,294 - 109,997,092 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 114,555,781 - 114,562,973 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 107,368,359 - 107,377,301 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 107,557,462 - 107,566,405 (-) NCBI Celera 13 102,327,266 - 102,333,852 (-) NCBI Celera Cytogenetic Map 13 q27 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nenf Rat (1->4)-beta-D-glucan multiple interactions ISO Nenf (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NENF mRNA CTD PMID:36331819 Nenf Rat 1,2-dimethylhydrazine multiple interactions ISO Nenf (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NENF mRNA CTD PMID:22206623 Nenf Rat 17beta-estradiol increases expression ISO NENF (Homo sapiens) 6480464 Estradiol results in increased expression of NENF mRNA CTD PMID:15223131 Nenf Rat 17beta-estradiol increases expression ISO Nenf (Mus musculus) 6480464 Estradiol results in increased expression of NENF mRNA CTD PMID:39298647 Nenf Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of NENF mRNA CTD PMID:32145629 Nenf Rat 17beta-estradiol decreases expression ISO NENF (Homo sapiens) 6480464 Estradiol results in decreased expression of NENF mRNA CTD PMID:23019147 Nenf Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Nenf (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to NENF promoter] CTD PMID:19654925 Nenf Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NENF mRNA CTD PMID:34747641 Nenf Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NENF mRNA CTD PMID:20959002 and PMID:33387578 Nenf Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nenf (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NENF mRNA CTD PMID:21570461 Nenf Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO NENF (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of NENF mRNA CTD PMID:21296121 Nenf Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of NENF mRNA CTD PMID:21346803 Nenf Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of NENF mRNA CTD PMID:21346803 Nenf Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of NENF mRNA CTD PMID:21346803 Nenf Rat 2-hydroxypropanoic acid increases expression ISO NENF (Homo sapiens) 6480464 Lactic Acid results in increased expression of NENF mRNA CTD PMID:30851411 Nenf Rat 4,4'-sulfonyldiphenol affects expression ISO NENF (Homo sapiens) 6480464 bisphenol S affects the expression of NENF protein CTD PMID:31945527 Nenf Rat 4,4'-sulfonyldiphenol increases expression ISO NENF (Homo sapiens) 6480464 bisphenol S results in increased expression of NENF protein CTD PMID:34186270 Nenf Rat 4,4'-sulfonyldiphenol increases expression ISO Nenf (Mus musculus) 6480464 bisphenol S results in increased expression of NENF mRNA CTD PMID:39298647 Nenf Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NENF mRNA CTD PMID:30047161 Nenf Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of NENF mRNA CTD PMID:31881176 Nenf Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of NENF mRNA CTD PMID:33354967 Nenf Rat Aflatoxin B2 alpha decreases methylation ISO NENF (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of NENF intron CTD PMID:30157460 Nenf Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of NENF mRNA CTD PMID:30047161 Nenf Rat antirheumatic drug increases expression ISO NENF (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of NENF mRNA CTD PMID:24449571 Nenf Rat Aroclor 1254 increases expression ISO Nenf (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of NENF mRNA CTD PMID:23650126 Nenf Rat arsenite(3-) multiple interactions ISO NENF (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to NENF mRNA] CTD PMID:32406909 Nenf Rat azoxystrobin increases expression ISO NENF (Homo sapiens) 6480464 azoxystrobin results in increased expression of NENF mRNA CTD PMID:33512557 Nenf Rat benzo[a]pyrene affects methylation ISO NENF (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NENF promoter CTD PMID:27901495 Nenf Rat benzo[a]pyrene diol epoxide I increases expression ISO NENF (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Nenf Rat benzo[e]pyrene decreases methylation ISO NENF (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of NENF intron CTD PMID:30157460 Nenf Rat bis(2-ethylhexyl) phthalate increases expression ISO Nenf (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of NENF mRNA CTD PMID:33754040 Nenf Rat bis(2-ethylhexyl) phthalate decreases expression ISO Nenf (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of NENF mRNA CTD PMID:34319233 Nenf Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NENF mRNA CTD PMID:25181051 Nenf Rat bisphenol A increases expression ISO Nenf (Mus musculus) 6480464 bisphenol A results in increased expression of NENF mRNA CTD PMID:32156529 Nenf Rat bisphenol A decreases expression ISO NENF (Homo sapiens) 6480464 bisphenol A results in decreased expression of NENF protein CTD PMID:34186270 Nenf Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NENF mRNA CTD PMID:32145629 Nenf Rat bisphenol A decreases expression ISO Nenf (Mus musculus) 6480464 bisphenol A results in decreased expression of NENF mRNA CTD PMID:30245210 and PMID:35598803 Nenf Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NENF mRNA CTD PMID:30816183 and PMID:32528016 Nenf Rat bisphenol F decreases expression ISO Nenf (Mus musculus) 6480464 bisphenol F results in decreased expression of NENF mRNA CTD PMID:38685157 Nenf Rat cadmium atom multiple interactions ISO NENF (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NENF mRNA CTD PMID:35301059 Nenf Rat cadmium dichloride increases expression ISO NENF (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of NENF mRNA CTD PMID:38568856 Nenf Rat cadmium dichloride multiple interactions ISO NENF (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NENF mRNA CTD PMID:35301059 Nenf Rat carbon nanotube decreases expression ISO Nenf (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Nenf Rat CGP 52608 multiple interactions ISO NENF (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to NENF gene] CTD PMID:28238834 Nenf Rat cisplatin increases expression ISO NENF (Homo sapiens) 6480464 Cisplatin results in increased expression of NENF mRNA CTD PMID:27594783 Nenf Rat cobalt dichloride increases expression ISO NENF (Homo sapiens) 6480464 cobaltous chloride results in increased expression of NENF mRNA CTD PMID:19376846 Nenf Rat diethylstilbestrol decreases expression ISO NENF (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of NENF mRNA CTD PMID:36621641 Nenf Rat dorsomorphin multiple interactions ISO NENF (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NENF mRNA CTD PMID:27188386 Nenf Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of NENF mRNA CTD PMID:23962444 Nenf Rat folic acid multiple interactions ISO Nenf (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NENF mRNA CTD PMID:22206623 Nenf Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of NENF mRNA CTD PMID:22061828 Nenf Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of NENF mRNA CTD PMID:21396975 Nenf Rat ivermectin decreases expression ISO NENF (Homo sapiens) 6480464 Ivermectin results in decreased expression of NENF protein CTD PMID:32959892 Nenf Rat lead(0) affects splicing ISO NENF (Homo sapiens) 6480464 Lead affects the splicing of NENF mRNA CTD PMID:28903495 Nenf Rat methapyrilene decreases methylation ISO NENF (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of NENF intron CTD PMID:30157460 Nenf Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of NENF mRNA CTD PMID:30047161 Nenf Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Nenf (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NENF mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of NENF mRNA CTD PMID:36331819 Nenf Rat phenobarbital increases expression ISO Nenf (Mus musculus) 6480464 Phenobarbital results in increased expression of NENF mRNA CTD PMID:19482888 Nenf Rat phenobarbital multiple interactions ISO Nenf (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of NENF mRNA] CTD PMID:19482888 Nenf Rat picoxystrobin increases expression ISO NENF (Homo sapiens) 6480464 picoxystrobin results in increased expression of NENF mRNA CTD PMID:33512557 Nenf Rat pirinixic acid increases expression ISO Nenf (Mus musculus) 6480464 pirinixic acid results in increased expression of NENF mRNA CTD PMID:18301758 and PMID:23811191 Nenf Rat rac-lactic acid increases expression ISO NENF (Homo sapiens) 6480464 Lactic Acid results in increased expression of NENF mRNA CTD PMID:30851411 Nenf Rat rotenone increases expression ISO NENF (Homo sapiens) 6480464 Rotenone results in increased expression of NENF mRNA CTD PMID:33512557 Nenf Rat SB 431542 multiple interactions ISO NENF (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NENF mRNA CTD PMID:27188386 Nenf Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of NENF mRNA CTD PMID:30047161 Nenf Rat sunitinib decreases expression ISO NENF (Homo sapiens) 6480464 Sunitinib results in decreased expression of NENF mRNA CTD PMID:31533062 Nenf Rat tetrachloromethane increases expression ISO Nenf (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of NENF mRNA CTD PMID:27339419 Nenf Rat titanium dioxide decreases methylation ISO Nenf (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NENF gene CTD PMID:35295148 Nenf Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of NENF mRNA CTD PMID:19448997 Nenf Rat valproic acid affects expression ISO NENF (Homo sapiens) 6480464 Valproic Acid affects the expression of NENF mRNA CTD PMID:25979313 Nenf Rat valproic acid increases expression ISO NENF (Homo sapiens) 6480464 Valproic Acid results in increased expression of NENF mRNA CTD PMID:23179753 more ... Nenf Rat valproic acid multiple interactions ISO NENF (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NENF mRNA CTD PMID:27188386 Nenf Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NENF mRNA CTD PMID:23034163 Nenf Rat vitamin E increases expression ISO NENF (Homo sapiens) 6480464 Vitamin E results in increased expression of NENF mRNA CTD PMID:19244175 Nenf Rat vorinostat increases expression ISO NENF (Homo sapiens) 6480464 vorinostat results in increased expression of NENF mRNA CTD PMID:27188386
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (EXP) Aflatoxin B2 alpha (ISO) amitrole (EXP) antirheumatic drug (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) cisplatin (ISO) cobalt dichloride (ISO) diethylstilbestrol (ISO) dorsomorphin (ISO) fipronil (EXP) folic acid (ISO) gentamycin (EXP) indole-3-methanol (EXP) ivermectin (ISO) lead(0) (ISO) methapyrilene (ISO) methimazole (EXP) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) picoxystrobin (ISO) pirinixic acid (ISO) rac-lactic acid (ISO) rotenone (ISO) SB 431542 (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) trichloroethene (EXP) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO)
Nenf (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 105,419,113 - 105,425,911 (-) NCBI GRCr8 mRatBN7.2 13 102,888,004 - 102,894,804 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 102,888,004 - 102,894,804 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 105,408,038 - 105,414,836 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 106,791,887 - 106,798,681 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 104,006,981 - 104,013,771 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 109,990,294 - 109,997,092 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 109,990,294 - 109,997,092 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 114,555,781 - 114,562,973 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 107,368,359 - 107,377,301 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 107,557,462 - 107,566,405 (-) NCBI Celera 13 102,327,266 - 102,333,852 (-) NCBI Celera Cytogenetic Map 13 q27 NCBI
NENF (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 212,432,920 - 212,446,379 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 212,432,920 - 212,446,379 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 212,606,262 - 212,619,721 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 210,672,903 - 210,686,344 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 185,831,945 - 185,845,437 (+) NCBI Celera Cytogenetic Map 1 q32.3 NCBI HuRef 1 183,282,375 - 183,295,705 (+) NCBI HuRef CHM1_1 1 213,879,110 - 213,892,598 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 211,677,617 - 211,691,093 (+) NCBI T2T-CHM13v2.0
Nenf (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 191,038,984 - 191,050,328 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 191,038,986 - 191,050,391 (-) Ensembl GRCm39 Ensembl GRCm38 1 191,306,787 - 191,318,131 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 191,306,789 - 191,318,194 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 193,130,676 - 193,141,997 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 193,007,412 - 193,018,733 (-) NCBI MGSCv36 mm8 MGSCv36 1 192,685,828 - 192,698,054 (-) NCBI MGSCv36 mm8 Celera 1 198,236,999 - 198,260,387 (-) NCBI Celera Cytogenetic Map 1 H6 NCBI cM Map 1 96.28 NCBI
Nenf (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955406 5,025,732 - 5,030,938 (-) NCBI ChiLan1.0 ChiLan1.0
NENF (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 36,959,772 - 36,973,058 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 36,924,232 - 36,937,473 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 187,998,006 - 188,011,260 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 192,868,804 - 192,874,364 (+) NCBI panpan1.1 PanPan1.1 panPan2
NENF (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 10,614,803 - 10,624,555 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 10,623,041 - 10,781,965 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 10,189,129 - 10,199,779 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 10,319,559 - 10,330,211 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 10,319,553 - 10,330,203 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 10,242,329 - 10,252,975 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 10,343,652 - 10,354,283 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 10,467,367 - 10,478,025 (+) NCBI UU_Cfam_GSD_1.0
Nenf (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
NENF (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 130,948,196 - 130,959,157 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 130,948,183 - 130,959,163 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 143,995,981 - 144,006,933 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NENF (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 17,080,134 - 17,091,391 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 17,080,005 - 17,091,346 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 17,577,495 - 17,588,859 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nenf (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 98 Count of miRNA genes: 83 Interacting mature miRNAs: 88 Transcripts: ENSRNOT00000005190 Prediction methods: Microtar, Rnahybrid, Targetscan Result types: miRGate_prediction
7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 21120177 109350286 Rat 738027 Lnnr6 Liver neoplastic nodule remodeling QTL 6 3.3 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 65613454 109350286 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 67635937 109350286 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 67635937 109350286 Rat 1576318 Schws5 Schwannoma susceptibility QTL 5 0.0351 nervous system integrity trait (VT:0010566) post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019) 13 64497900 109350286 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 64375743 109350286 Rat 8655951 Rf63 Renal function QTL 63 12.2 blood urea nitrogen amount (VT:0005265) plasma urea nitrogen level (CMO:0000586) 13 71610804 109350286 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 83286150 109350286 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 67635937 109350286 Rat
RH130483
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 102,888,059 - 102,888,268 (+) MAPPER mRatBN7.2 Rnor_6.0 13 109,990,350 - 109,990,558 NCBI Rnor6.0 Rnor_5.0 13 114,555,837 - 114,556,045 UniSTS Rnor5.0 RGSC_v3.4 13 107,368,415 - 107,368,623 UniSTS RGSC3.4 Celera 13 102,327,322 - 102,327,530 UniSTS RH 3.4 Map 13 727.2 UniSTS Cytogenetic Map 13 q27 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005190 ⟹ ENSRNOP00000005190
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 102,888,004 - 102,894,804 (-) Ensembl Rnor_6.0 Ensembl 13 109,990,294 - 109,997,092 (-) Ensembl
RefSeq Acc Id:
NM_001002851 ⟹ NP_001002851
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 105,419,113 - 105,425,911 (-) NCBI mRatBN7.2 13 102,888,004 - 102,894,804 (-) NCBI Rnor_6.0 13 109,990,294 - 109,997,092 (-) NCBI Rnor_5.0 13 114,555,781 - 114,562,973 (-) NCBI RGSC_v3.4 13 107,368,359 - 107,377,301 (-) RGD Celera 13 102,327,266 - 102,333,852 (-) RGD
Sequence:
CGCCTGCTCCTCGCTGTCCATGGCGCGCCCCGCGCCCTGGTGGTGGCTGCGGCCGCTGGCGGCGCTCGCCCTGGCGCTGGCGCTGGTCCGGGTGCCCTCAGCCCGGGCCGGGCAGATGCCGCGCCCCG CAGAGCGCGGGCCCCCAGTACGGCTCTTCACCGAGGAGGAGCTGGCCCGCTACAGCGGCGAGGAGGAGGATCAACCCATCTACTTGGCAGTGAAGGGAGTGGTGTTCGATGTCACCTCTGGGAAGGAG TTTTATGGACGTGGAGCCCCCTACAACGCCTTGGCCGGGAAGGACTCGAGCAGAGGTGTGGCCAAGATGTCGCTGGATCCTGCAGACCTCACTCATGACATTTCTGGTCTCACTGCCAAGGAGCTGGA AGCCCTCGATGACATCTTCAGCAAGGTGTACAAAGCCAAATACCCCATTGTTGGCTACACGGCCCGCAGGATCCTCAACGAGGATGGCAGCCCCAACCTGGACTTCAAGCCTGAAGACCAGCCCCATT TTGACATAAAGGACGAGTTCTAATGTCTAGCTGAGAAGCTGGTTCTAGGGAGAGGTGGGGGGACAGGAGTTAAATGTCCCACGGAACAAGCAGGGGAAGCCTCTGAGTGCTCTGCATCTGAATAAAAC TGATATTTAACTGGAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_001002851 ⟸ NM_001002851
- Peptide Label:
precursor
- UniProtKB:
Q6IUR5 (UniProtKB/Swiss-Prot), A6JGZ4 (UniProtKB/TrEMBL)
- Sequence:
MARPAPWWWLRPLAALALALALVRVPSARAGQMPRPAERGPPVRLFTEEELARYSGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALAGKDSSRGVAKMSLDPADLTHDISGLTAKELEALDDIF SKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF
hide sequence
Ensembl Acc Id:
ENSRNOP00000005190 ⟸ ENSRNOT00000005190
RGD ID: 13699114
Promoter ID: EPDNEW_R9639
Type: multiple initiation site
Name: Nenf_1
Description: neudesin neurotrophic factor
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 109,997,099 - 109,997,159 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-02
Nenf
neudesin neurotrophic factor
Nenf
neuron derived neurotrophic factor
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-03-30
Nenf
neuron derived neurotrophic factor
SCIRP10
SCIRP10-related protein
Symbol and Name updated
1299863
APPROVED
2005-09-30
SCIRP10
Symbol and Name status set to provisional
70820
PROVISIONAL